diff options
author | techknowlogick <matti@mdranta.net> | 2019-06-18 22:14:15 -0400 |
---|---|---|
committer | Lunny Xiao <xiaolunwen@gmail.com> | 2019-06-19 10:14:15 +0800 |
commit | 33ad5548002156f7fb7779870571600c0a181c85 (patch) | |
tree | 9d4269a2ea00fec152f462ffddffbeffba64ba2f /vendor/golang.org/x/text | |
parent | b209531959104cb6d5a8079ec567386720f3aaf3 (diff) | |
download | gitea-33ad5548002156f7fb7779870571600c0a181c85.tar.gz gitea-33ad5548002156f7fb7779870571600c0a181c85.zip |
update go-git to v4.12.0 - fixes #7248 (#7249)
Diffstat (limited to 'vendor/golang.org/x/text')
62 files changed, 26697 insertions, 9469 deletions
diff --git a/vendor/golang.org/x/text/encoding/encoding.go b/vendor/golang.org/x/text/encoding/encoding.go index 221f175c01..a0bd7cd4d0 100644 --- a/vendor/golang.org/x/text/encoding/encoding.go +++ b/vendor/golang.org/x/text/encoding/encoding.go @@ -124,7 +124,7 @@ func (e *Encoder) Writer(w io.Writer) io.Writer { } // ASCIISub is the ASCII substitute character, as recommended by -// http://unicode.org/reports/tr36/#Text_Comparison +// https://unicode.org/reports/tr36/#Text_Comparison const ASCIISub = '\x1a' // Nop is the nop encoding. Its transformed bytes are the same as the source diff --git a/vendor/golang.org/x/text/encoding/htmlindex/tables.go b/vendor/golang.org/x/text/encoding/htmlindex/tables.go index 9d6b4315c2..f074e2c6da 100644 --- a/vendor/golang.org/x/text/encoding/htmlindex/tables.go +++ b/vendor/golang.org/x/text/encoding/htmlindex/tables.go @@ -306,6 +306,7 @@ var nameMap = map[string]htmlEncoding{ "iso-2022-cn": replacement, "iso-2022-cn-ext": replacement, "iso-2022-kr": replacement, + "replacement": replacement, "utf-16be": utf16be, "utf-16": utf16le, "utf-16le": utf16le, diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/gen.go b/vendor/golang.org/x/text/encoding/internal/identifier/gen.go index 0c8eba7e52..26cfef9c6b 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/gen.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/gen.go @@ -109,7 +109,12 @@ func main() { use = use || a.Value != "person" } if a.Name.Local == "data" && use { - attr = a.Value + " " + // Patch up URLs to use https. From some links, the + // https version is different from the http one. + s := a.Value + s = strings.Replace(s, "http://", "https://", -1) + s = strings.Replace(s, "/unicode/", "/", -1) + attr = s + " " } } } diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go index 7351b4ef8a..5c9b85c280 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/identifier.go @@ -34,7 +34,7 @@ package identifier // - http://www.iana.org/assignments/character-sets/character-sets.xhtml // - http://www.iana.org/assignments/ianacharset-mib/ianacharset-mib // - http://www.ietf.org/rfc/rfc2978.txt -// - http://www.unicode.org/reports/tr22/ +// - https://www.unicode.org/reports/tr22/ // - http://www.w3.org/TR/encoding/ // - https://encoding.spec.whatwg.org/ // - https://encoding.spec.whatwg.org/encodings.json diff --git a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go index 768842b0a5..fc7df1bc71 100644 --- a/vendor/golang.org/x/text/encoding/internal/identifier/mib.go +++ b/vendor/golang.org/x/text/encoding/internal/identifier/mib.go @@ -538,8 +538,6 @@ const ( // ISO111ECMACyrillic is the MIB identifier with IANA name ECMA-cyrillic. // // ISO registry - // (formerly ECMA - // registry ) ISO111ECMACyrillic MIB = 77 // ISO121Canadian1 is the MIB identifier with IANA name CSA_Z243.4-1985-1. @@ -732,18 +730,18 @@ const ( // ISO885913 is the MIB identifier with IANA name ISO-8859-13. // - // ISO See http://www.iana.org/assignments/charset-reg/ISO-8859-13 http://www.iana.org/assignments/charset-reg/ISO-8859-13 + // ISO See https://www.iana.org/assignments/charset-reg/ISO-8859-13 https://www.iana.org/assignments/charset-reg/ISO-8859-13 ISO885913 MIB = 109 // ISO885914 is the MIB identifier with IANA name ISO-8859-14. // - // ISO See http://www.iana.org/assignments/charset-reg/ISO-8859-14 + // ISO See https://www.iana.org/assignments/charset-reg/ISO-8859-14 ISO885914 MIB = 110 // ISO885915 is the MIB identifier with IANA name ISO-8859-15. // // ISO - // Please see: http://www.iana.org/assignments/charset-reg/ISO-8859-15 + // Please see: https://www.iana.org/assignments/charset-reg/ISO-8859-15 ISO885915 MIB = 111 // ISO885916 is the MIB identifier with IANA name ISO-8859-16. @@ -754,41 +752,41 @@ const ( // GBK is the MIB identifier with IANA name GBK. // // Chinese IT Standardization Technical Committee - // Please see: http://www.iana.org/assignments/charset-reg/GBK + // Please see: https://www.iana.org/assignments/charset-reg/GBK GBK MIB = 113 // GB18030 is the MIB identifier with IANA name GB18030. // // Chinese IT Standardization Technical Committee - // Please see: http://www.iana.org/assignments/charset-reg/GB18030 + // Please see: https://www.iana.org/assignments/charset-reg/GB18030 GB18030 MIB = 114 // OSDEBCDICDF0415 is the MIB identifier with IANA name OSD_EBCDIC_DF04_15. // // Fujitsu-Siemens standard mainframe EBCDIC encoding - // Please see: http://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF04-15 + // Please see: https://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF04-15 OSDEBCDICDF0415 MIB = 115 // OSDEBCDICDF03IRV is the MIB identifier with IANA name OSD_EBCDIC_DF03_IRV. // // Fujitsu-Siemens standard mainframe EBCDIC encoding - // Please see: http://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF03-IRV + // Please see: https://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF03-IRV OSDEBCDICDF03IRV MIB = 116 // OSDEBCDICDF041 is the MIB identifier with IANA name OSD_EBCDIC_DF04_1. // // Fujitsu-Siemens standard mainframe EBCDIC encoding - // Please see: http://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF04-1 + // Please see: https://www.iana.org/assignments/charset-reg/OSD-EBCDIC-DF04-1 OSDEBCDICDF041 MIB = 117 // ISO115481 is the MIB identifier with IANA name ISO-11548-1. // - // See http://www.iana.org/assignments/charset-reg/ISO-11548-1 + // See https://www.iana.org/assignments/charset-reg/ISO-11548-1 ISO115481 MIB = 118 // KZ1048 is the MIB identifier with IANA name KZ-1048. // - // See http://www.iana.org/assignments/charset-reg/KZ-1048 + // See https://www.iana.org/assignments/charset-reg/KZ-1048 KZ1048 MIB = 119 // Unicode is the MIB identifier with IANA name ISO-10646-UCS-2. @@ -855,7 +853,7 @@ const ( // SCSU is the MIB identifier with IANA name SCSU. // - // SCSU See http://www.iana.org/assignments/charset-reg/SCSU + // SCSU See https://www.iana.org/assignments/charset-reg/SCSU SCSU MIB = 1011 // UTF7 is the MIB identifier with IANA name UTF-7. @@ -884,27 +882,27 @@ const ( // CESU8 is the MIB identifier with IANA name CESU-8. // - // http://www.unicode.org/unicode/reports/tr26 + // https://www.unicode.org/reports/tr26 CESU8 MIB = 1016 // UTF32 is the MIB identifier with IANA name UTF-32. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/reports/tr19/ UTF32 MIB = 1017 // UTF32BE is the MIB identifier with IANA name UTF-32BE. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/reports/tr19/ UTF32BE MIB = 1018 // UTF32LE is the MIB identifier with IANA name UTF-32LE. // - // http://www.unicode.org/unicode/reports/tr19/ + // https://www.unicode.org/reports/tr19/ UTF32LE MIB = 1019 // BOCU1 is the MIB identifier with IANA name BOCU-1. // - // http://www.unicode.org/notes/tn6/ + // https://www.unicode.org/notes/tn6/ BOCU1 MIB = 1020 // Windows30Latin1 is the MIB identifier with IANA name ISO-8859-1-Windows-3.0-Latin-1. @@ -1461,152 +1459,152 @@ const ( // IBM00858 is the MIB identifier with IANA name IBM00858. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM00858 + // IBM See https://www.iana.org/assignments/charset-reg/IBM00858 IBM00858 MIB = 2089 // IBM00924 is the MIB identifier with IANA name IBM00924. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM00924 + // IBM See https://www.iana.org/assignments/charset-reg/IBM00924 IBM00924 MIB = 2090 // IBM01140 is the MIB identifier with IANA name IBM01140. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01140 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01140 IBM01140 MIB = 2091 // IBM01141 is the MIB identifier with IANA name IBM01141. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01141 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01141 IBM01141 MIB = 2092 // IBM01142 is the MIB identifier with IANA name IBM01142. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01142 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01142 IBM01142 MIB = 2093 // IBM01143 is the MIB identifier with IANA name IBM01143. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01143 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01143 IBM01143 MIB = 2094 // IBM01144 is the MIB identifier with IANA name IBM01144. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01144 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01144 IBM01144 MIB = 2095 // IBM01145 is the MIB identifier with IANA name IBM01145. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01145 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01145 IBM01145 MIB = 2096 // IBM01146 is the MIB identifier with IANA name IBM01146. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01146 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01146 IBM01146 MIB = 2097 // IBM01147 is the MIB identifier with IANA name IBM01147. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01147 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01147 IBM01147 MIB = 2098 // IBM01148 is the MIB identifier with IANA name IBM01148. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01148 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01148 IBM01148 MIB = 2099 // IBM01149 is the MIB identifier with IANA name IBM01149. // - // IBM See http://www.iana.org/assignments/charset-reg/IBM01149 + // IBM See https://www.iana.org/assignments/charset-reg/IBM01149 IBM01149 MIB = 2100 // Big5HKSCS is the MIB identifier with IANA name Big5-HKSCS. // - // See http://www.iana.org/assignments/charset-reg/Big5-HKSCS + // See https://www.iana.org/assignments/charset-reg/Big5-HKSCS Big5HKSCS MIB = 2101 // IBM1047 is the MIB identifier with IANA name IBM1047. // - // IBM1047 (EBCDIC Latin 1/Open Systems) http://www-1.ibm.com/servers/eserver/iseries/software/globalization/pdf/cp01047z.pdf + // IBM1047 (EBCDIC Latin 1/Open Systems) https://www-1.ibm.com/servers/eserver/iseries/software/globalization/pdf/cp01047z.pdf IBM1047 MIB = 2102 // PTCP154 is the MIB identifier with IANA name PTCP154. // - // See http://www.iana.org/assignments/charset-reg/PTCP154 + // See https://www.iana.org/assignments/charset-reg/PTCP154 PTCP154 MIB = 2103 // Amiga1251 is the MIB identifier with IANA name Amiga-1251. // - // See http://www.amiga.ultranet.ru/Amiga-1251.html + // See https://www.amiga.ultranet.ru/Amiga-1251.html Amiga1251 MIB = 2104 // KOI7switched is the MIB identifier with IANA name KOI7-switched. // - // See http://www.iana.org/assignments/charset-reg/KOI7-switched + // See https://www.iana.org/assignments/charset-reg/KOI7-switched KOI7switched MIB = 2105 // BRF is the MIB identifier with IANA name BRF. // - // See http://www.iana.org/assignments/charset-reg/BRF + // See https://www.iana.org/assignments/charset-reg/BRF BRF MIB = 2106 // TSCII is the MIB identifier with IANA name TSCII. // - // See http://www.iana.org/assignments/charset-reg/TSCII + // See https://www.iana.org/assignments/charset-reg/TSCII TSCII MIB = 2107 // CP51932 is the MIB identifier with IANA name CP51932. // - // See http://www.iana.org/assignments/charset-reg/CP51932 + // See https://www.iana.org/assignments/charset-reg/CP51932 CP51932 MIB = 2108 // Windows874 is the MIB identifier with IANA name windows-874. // - // See http://www.iana.org/assignments/charset-reg/windows-874 + // See https://www.iana.org/assignments/charset-reg/windows-874 Windows874 MIB = 2109 // Windows1250 is the MIB identifier with IANA name windows-1250. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1250 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1250 Windows1250 MIB = 2250 // Windows1251 is the MIB identifier with IANA name windows-1251. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1251 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1251 Windows1251 MIB = 2251 // Windows1252 is the MIB identifier with IANA name windows-1252. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1252 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1252 Windows1252 MIB = 2252 // Windows1253 is the MIB identifier with IANA name windows-1253. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1253 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1253 Windows1253 MIB = 2253 // Windows1254 is the MIB identifier with IANA name windows-1254. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1254 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1254 Windows1254 MIB = 2254 // Windows1255 is the MIB identifier with IANA name windows-1255. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1255 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1255 Windows1255 MIB = 2255 // Windows1256 is the MIB identifier with IANA name windows-1256. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1256 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1256 Windows1256 MIB = 2256 // Windows1257 is the MIB identifier with IANA name windows-1257. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1257 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1257 Windows1257 MIB = 2257 // Windows1258 is the MIB identifier with IANA name windows-1258. // - // Microsoft http://www.iana.org/assignments/charset-reg/windows-1258 + // Microsoft https://www.iana.org/assignments/charset-reg/windows-1258 Windows1258 MIB = 2258 // TIS620 is the MIB identifier with IANA name TIS-620. @@ -1616,6 +1614,6 @@ const ( // CP50220 is the MIB identifier with IANA name CP50220. // - // See http://www.iana.org/assignments/charset-reg/CP50220 + // See https://www.iana.org/assignments/charset-reg/CP50220 CP50220 MIB = 2260 ) diff --git a/vendor/golang.org/x/text/encoding/japanese/maketables.go b/vendor/golang.org/x/text/encoding/japanese/maketables.go index d6c10deb07..023957a672 100644 --- a/vendor/golang.org/x/text/encoding/japanese/maketables.go +++ b/vendor/golang.org/x/text/encoding/japanese/maketables.go @@ -10,8 +10,8 @@ package main // go run maketables.go | gofmt > tables.go // TODO: Emoji extensions? -// http://www.unicode.org/faq/emoji_dingbats.html -// http://www.unicode.org/Public/UNIDATA/EmojiSources.txt +// https://www.unicode.org/faq/emoji_dingbats.html +// https://www.unicode.org/Public/UNIDATA/EmojiSources.txt import ( "bufio" diff --git a/vendor/golang.org/x/text/encoding/unicode/unicode.go b/vendor/golang.org/x/text/encoding/unicode/unicode.go index 579cadfb12..4850ff365b 100644 --- a/vendor/golang.org/x/text/encoding/unicode/unicode.go +++ b/vendor/golang.org/x/text/encoding/unicode/unicode.go @@ -145,7 +145,7 @@ func (utf8Decoder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err e // and consumed in a greater context that implies a certain endianness, use // IgnoreBOM. Otherwise, use ExpectBOM and always produce and consume a BOM. // -// In the language of http://www.unicode.org/faq/utf_bom.html#bom10, IgnoreBOM +// In the language of https://www.unicode.org/faq/utf_bom.html#bom10, IgnoreBOM // corresponds to "Where the precise type of the data stream is known... the // BOM should not be used" and ExpectBOM corresponds to "A particular // protocol... may require use of the BOM". diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/internal/language/common.go index 9d86e18554..cdfdb74971 100644 --- a/vendor/golang.org/x/text/language/common.go +++ b/vendor/golang.org/x/text/internal/language/common.go @@ -4,13 +4,13 @@ package language // This file contains code common to the maketables.go and the package code. -// langAliasType is the type of an alias in langAliasMap. -type langAliasType int8 +// AliasType is the type of an alias in AliasMap. +type AliasType int8 const ( - langDeprecated langAliasType = iota - langMacro - langLegacy + Deprecated AliasType = iota + Macro + Legacy - langAliasTypeUnknown langAliasType = -1 + AliasTypeUnknown AliasType = -1 ) diff --git a/vendor/golang.org/x/text/internal/language/compact.go b/vendor/golang.org/x/text/internal/language/compact.go new file mode 100644 index 0000000000..46a0015074 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact.go @@ -0,0 +1,29 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// CompactCoreInfo is a compact integer with the three core tags encoded. +type CompactCoreInfo uint32 + +// GetCompactCore generates a uint32 value that is guaranteed to be unique for +// different language, region, and script values. +func GetCompactCore(t Tag) (cci CompactCoreInfo, ok bool) { + if t.LangID > langNoIndexOffset { + return 0, false + } + cci |= CompactCoreInfo(t.LangID) << (8 + 12) + cci |= CompactCoreInfo(t.ScriptID) << 12 + cci |= CompactCoreInfo(t.RegionID) + return cci, true +} + +// Tag generates a tag from c. +func (c CompactCoreInfo) Tag() Tag { + return Tag{ + LangID: Language(c >> 20), + RegionID: Region(c & 0x3ff), + ScriptID: Script(c>>12) & 0xff, + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/compact.go b/vendor/golang.org/x/text/internal/language/compact/compact.go new file mode 100644 index 0000000000..1b36935ef7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/compact.go @@ -0,0 +1,61 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package compact defines a compact representation of language tags. +// +// Common language tags (at least all for which locale information is defined +// in CLDR) are assigned a unique index. Each Tag is associated with such an +// ID for selecting language-related resources (such as translations) as well +// as one for selecting regional defaults (currency, number formatting, etc.) +// +// It may want to export this functionality at some point, but at this point +// this is only available for use within x/text. +package compact // import "golang.org/x/text/internal/language/compact" + +import ( + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// ID is an integer identifying a single tag. +type ID uint16 + +func getCoreIndex(t language.Tag) (id ID, ok bool) { + cci, ok := language.GetCompactCore(t) + if !ok { + return 0, false + } + i := sort.Search(len(coreTags), func(i int) bool { + return cci <= coreTags[i] + }) + if i == len(coreTags) || coreTags[i] != cci { + return 0, false + } + return ID(i), true +} + +// Parent returns the ID of the parent or the root ID if id is already the root. +func (id ID) Parent() ID { + return parents[id] +} + +// Tag converts id to an internal language Tag. +func (id ID) Tag() language.Tag { + if int(id) >= len(coreTags) { + return specialTags[int(id)-len(coreTags)] + } + return coreTags[id].Tag() +} + +var specialTags []language.Tag + +func init() { + tags := strings.Split(specialTagsStr, " ") + specialTags = make([]language.Tag, len(tags)) + for i, t := range tags { + specialTags[i] = language.MustParse(t) + } +} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen.go b/vendor/golang.org/x/text/internal/language/compact/gen.go new file mode 100644 index 0000000000..0c36a052f6 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/gen.go @@ -0,0 +1,64 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +// Language tag table generator. +// Data read from the web. + +package main + +import ( + "flag" + "fmt" + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/unicode/cldr" +) + +var ( + test = flag.Bool("test", + false, + "test existing tables; can be used to compare web data with package data.") + outputFile = flag.String("output", + "tables.go", + "output file for generated tables") +) + +func main() { + gen.Init() + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "compact") + + fmt.Fprintln(w, `import "golang.org/x/text/internal/language"`) + + b := newBuilder(w) + gen.WriteCLDRVersion(w) + + b.writeCompactIndex() +} + +type builder struct { + w *gen.CodeWriter + data *cldr.CLDR + supp *cldr.SupplementalData +} + +func newBuilder(w *gen.CodeWriter) *builder { + r := gen.OpenCLDRCoreZip() + defer r.Close() + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatal(err) + } + b := builder{ + w: w, + data: data, + supp: data.Supplemental(), + } + return &b +} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_index.go b/vendor/golang.org/x/text/internal/language/compact/gen_index.go new file mode 100644 index 0000000000..136cefaf08 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/gen_index.go @@ -0,0 +1,113 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// This file generates derivative tables based on the language package itself. + +import ( + "fmt" + "log" + "sort" + "strings" + + "golang.org/x/text/internal/language" +) + +// Compact indices: +// Note -va-X variants only apply to localization variants. +// BCP variants only ever apply to language. +// The only ambiguity between tags is with regions. + +func (b *builder) writeCompactIndex() { + // Collect all language tags for which we have any data in CLDR. + m := map[language.Tag]bool{} + for _, lang := range b.data.Locales() { + // We include all locales unconditionally to be consistent with en_US. + // We want en_US, even though it has no data associated with it. + + // TODO: put any of the languages for which no data exists at the end + // of the index. This allows all components based on ICU to use that + // as the cutoff point. + // if x := data.RawLDML(lang); false || + // x.LocaleDisplayNames != nil || + // x.Characters != nil || + // x.Delimiters != nil || + // x.Measurement != nil || + // x.Dates != nil || + // x.Numbers != nil || + // x.Units != nil || + // x.ListPatterns != nil || + // x.Collations != nil || + // x.Segmentations != nil || + // x.Rbnf != nil || + // x.Annotations != nil || + // x.Metadata != nil { + + // TODO: support POSIX natively, albeit non-standard. + tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) + m[tag] = true + // } + } + + // TODO: plural rules are also defined for the deprecated tags: + // iw mo sh tl + // Consider removing these as compact tags. + + // Include locales for plural rules, which uses a different structure. + for _, plurals := range b.supp.Plurals { + for _, rules := range plurals.PluralRules { + for _, lang := range strings.Split(rules.Locales, " ") { + m[language.Make(lang)] = true + } + } + } + + var coreTags []language.CompactCoreInfo + var special []string + + for t := range m { + if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { + log.Fatalf("Unexpected extension %v in %v", x, t) + } + if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { + cci, ok := language.GetCompactCore(t) + if !ok { + log.Fatalf("Locale for non-basic language %q", t) + } + coreTags = append(coreTags, cci) + } else { + special = append(special, t.String()) + } + } + + w := b.w + + sort.Slice(coreTags, func(i, j int) bool { return coreTags[i] < coreTags[j] }) + sort.Strings(special) + + w.WriteComment(` + NumCompactTags is the number of common tags. The maximum tag is + NumCompactTags-1.`) + w.WriteConst("NumCompactTags", len(m)) + + fmt.Fprintln(w, "const (") + for i, t := range coreTags { + fmt.Fprintf(w, "%s ID = %d\n", ident(t.Tag().String()), i) + } + for i, t := range special { + fmt.Fprintf(w, "%s ID = %d\n", ident(t), i+len(coreTags)) + } + fmt.Fprintln(w, ")") + + w.WriteVar("coreTags", coreTags) + + w.WriteConst("specialTagsStr", strings.Join(special, " ")) +} + +func ident(s string) string { + return strings.Replace(s, "-", "", -1) + "Index" +} diff --git a/vendor/golang.org/x/text/internal/language/compact/gen_parents.go b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go new file mode 100644 index 0000000000..9543d58323 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/gen_parents.go @@ -0,0 +1,54 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" + "golang.org/x/text/unicode/cldr" +) + +func main() { + r := gen.OpenCLDRCoreZip() + defer r.Close() + + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + if err != nil { + log.Fatalf("DecodeZip: %v", err) + } + + w := gen.NewCodeWriter() + defer w.WriteGoFile("parents.go", "compact") + + // Create parents table. + type ID uint16 + parents := make([]ID, compact.NumCompactTags) + for _, loc := range data.Locales() { + tag := language.MustParse(loc) + index, ok := compact.FromTag(tag) + if !ok { + continue + } + parentIndex := compact.ID(0) // und + for p := tag.Parent(); p != language.Und; p = p.Parent() { + if x, ok := compact.FromTag(p); ok { + parentIndex = x + break + } + } + parents[index] = ID(parentIndex) + } + + w.WriteComment(` + parents maps a compact index of a tag to the compact index of the parent of + this tag.`) + w.WriteVar("parents", parents) +} diff --git a/vendor/golang.org/x/text/internal/language/compact/language.go b/vendor/golang.org/x/text/internal/language/compact/language.go new file mode 100644 index 0000000000..83816a72a8 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/language.go @@ -0,0 +1,260 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_index.go -output tables.go +//go:generate go run gen_parents.go + +package compact + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "strings" + + "golang.org/x/text/internal/language" +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. +type Tag struct { + // NOTE: exported tags will become part of the public API. + language ID + locale ID + full fullTag // always a language.Tag for now. +} + +const _und = 0 + +type fullTag interface { + IsRoot() bool + Parent() language.Tag +} + +// Make a compact Tag from a fully specified internal language Tag. +func Make(t language.Tag) (tag Tag) { + if region := t.TypeForKey("rg"); len(region) == 6 && region[2:] == "zzzz" { + if r, err := language.ParseRegion(region[:2]); err == nil { + tFull := t + t, _ = t.SetTypeForKey("rg", "") + // TODO: should we not consider "va" for the language tag? + var exact1, exact2 bool + tag.language, exact1 = FromTag(t) + t.RegionID = r + tag.locale, exact2 = FromTag(t) + if !exact1 || !exact2 { + tag.full = tFull + } + return tag + } + } + lang, ok := FromTag(t) + tag.language = lang + tag.locale = lang + if !ok { + tag.full = t + } + return tag +} + +// Tag returns an internal language Tag version of this tag. +func (t Tag) Tag() language.Tag { + if t.full != nil { + return t.full.(language.Tag) + } + tag := t.language.Tag() + if t.language != t.locale { + loc := t.locale.Tag() + tag, _ = tag.SetTypeForKey("rg", strings.ToLower(loc.RegionID.String())+"zzzz") + } + return tag +} + +// IsCompact reports whether this tag is fully defined in terms of ID. +func (t *Tag) IsCompact() bool { + return t.full == nil +} + +// MayHaveVariants reports whether a tag may have variants. If it returns false +// it is guaranteed the tag does not have variants. +func (t Tag) MayHaveVariants() bool { + return t.full != nil || int(t.language) >= len(coreTags) +} + +// MayHaveExtensions reports whether a tag may have extensions. If it returns +// false it is guaranteed the tag does not have them. +func (t Tag) MayHaveExtensions() bool { + return t.full != nil || + int(t.language) >= len(coreTags) || + t.language != t.locale +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if t.full != nil { + return t.full.IsRoot() + } + return t.language == _und +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.full != nil { + return Make(t.full.Parent()) + } + if t.language != t.locale { + // Simulate stripping -u-rg-xxxxxx + return Tag{language: t.language, locale: t.language} + } + // TODO: use parent lookup table once cycle from internal package is + // removed. Probably by internalizing the table and declaring this fast + // enough. + // lang := compactID(internal.Parent(uint16(t.language))) + lang, _ := FromTag(t.language.Tag().Parent()) + return Tag{language: lang, locale: lang} +} + +// returns token t and the rest of the string. +func nextToken(s string) (t, tail string) { + p := strings.Index(s[1:], "-") + if p == -1 { + return s[1:], "" + } + p++ + return s[1:p], s[p:] +} + +// LanguageID returns an index, where 0 <= index < NumCompactTags, for tags +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func LanguageID(t Tag) (id ID, exact bool) { + return t.language, t.full == nil +} + +// RegionalID returns the ID for the regional variant of this tag. This index is +// used to indicate region-specific overrides, such as default currency, default +// calendar and week data, default time cycle, and default measurement system +// and unit preferences. +// +// For instance, the tag en-GB-u-rg-uszzzz specifies British English with US +// settings for currency, number formatting, etc. The CompactIndex for this tag +// will be that for en-GB, while the RegionalID will be the one corresponding to +// en-US. +func RegionalID(t Tag) (id ID, exact bool) { + return t.locale, t.full == nil +} + +// LanguageTag returns t stripped of regional variant indicators. +// +// At the moment this means it is stripped of a regional and variant subtag "rg" +// and "va" in the "u" extension. +func (t Tag) LanguageTag() Tag { + if t.full == nil { + return Tag{language: t.language, locale: t.language} + } + tt := t.Tag() + tt.SetTypeForKey("rg", "") + tt.SetTypeForKey("va", "") + return Make(tt) +} + +// RegionalTag returns the regional variant of the tag. +// +// At the moment this means that the region is set from the regional subtag +// "rg" in the "u" extension. +func (t Tag) RegionalTag() Tag { + rt := Tag{language: t.locale, locale: t.locale} + if t.full == nil { + return rt + } + b := language.Builder{} + tag := t.Tag() + // tag, _ = tag.SetTypeForKey("rg", "") + b.SetTag(t.locale.Tag()) + if v := tag.Variants(); v != "" { + for _, v := range strings.Split(v, "-") { + b.AddVariant(v) + } + } + for _, e := range tag.Extensions() { + b.AddExt(e) + } + return t +} + +// FromTag reports closest matching ID for an internal language Tag. +func FromTag(t language.Tag) (id ID, exact bool) { + // TODO: perhaps give more frequent tags a lower index. + // TODO: we could make the indexes stable. This will excluded some + // possibilities for optimization, so don't do this quite yet. + exact = true + + b, s, r := t.Raw() + if t.HasString() { + if t.IsPrivateUse() { + // We have no entries for user-defined tags. + return 0, false + } + hasExtra := false + if t.HasVariants() { + if t.HasExtensions() { + build := language.Builder{} + build.SetTag(language.Tag{LangID: b, ScriptID: s, RegionID: r}) + build.AddVariant(t.Variants()) + exact = false + t = build.Make() + } + hasExtra = true + } else if _, ok := t.Extension('u'); ok { + // TODO: va may mean something else. Consider not considering it. + // Strip all but the 'va' entry. + old := t + variant := t.TypeForKey("va") + t = language.Tag{LangID: b, ScriptID: s, RegionID: r} + if variant != "" { + t, _ = t.SetTypeForKey("va", variant) + hasExtra = true + } + exact = old == t + } else { + exact = false + } + if hasExtra { + // We have some variants. + for i, s := range specialTags { + if s == t { + return ID(i + len(coreTags)), exact + } + } + exact = false + } + } + if x, ok := getCoreIndex(t); ok { + return x, exact + } + exact = false + if r != 0 && s == 0 { + // Deal with cases where an extra script is inserted for the region. + t, _ := t.Maximize() + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + for t = t.Parent(); t != root; t = t.Parent() { + // No variants specified: just compare core components. + // The key has the form lllssrrr, where l, s, and r are nibbles for + // respectively the langID, scriptID, and regionID. + if x, ok := getCoreIndex(t); ok { + return x, exact + } + } + return 0, exact +} + +var root = language.Tag{} diff --git a/vendor/golang.org/x/text/internal/language/compact/parents.go b/vendor/golang.org/x/text/internal/language/compact/parents.go new file mode 100644 index 0000000000..8d810723c7 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/parents.go @@ -0,0 +1,120 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +// parents maps a compact index of a tag to the compact index of the parent of +// this tag. +var parents = []ID{ // 775 elements + // Entry 0 - 3F + 0x0000, 0x0000, 0x0001, 0x0001, 0x0000, 0x0004, 0x0000, 0x0006, + 0x0000, 0x0008, 0x0000, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, + 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x000a, 0x0000, + 0x0000, 0x0028, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x0000, + 0x002f, 0x002e, 0x002e, 0x0000, 0x0033, 0x0000, 0x0035, 0x0000, + 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x0000, 0x003e, + // Entry 40 - 7F + 0x0000, 0x0040, 0x0040, 0x0000, 0x0043, 0x0043, 0x0000, 0x0046, + 0x0000, 0x0048, 0x0000, 0x0000, 0x004b, 0x004a, 0x004a, 0x0000, + 0x004f, 0x004f, 0x004f, 0x004f, 0x0000, 0x0054, 0x0054, 0x0000, + 0x0057, 0x0000, 0x0059, 0x0000, 0x005b, 0x0000, 0x005d, 0x005d, + 0x0000, 0x0060, 0x0000, 0x0062, 0x0000, 0x0064, 0x0000, 0x0066, + 0x0066, 0x0000, 0x0069, 0x0000, 0x006b, 0x006b, 0x006b, 0x006b, + 0x006b, 0x006b, 0x006b, 0x0000, 0x0073, 0x0000, 0x0075, 0x0000, + 0x0077, 0x0000, 0x0000, 0x007a, 0x0000, 0x007c, 0x0000, 0x007e, + // Entry 80 - BF + 0x0000, 0x0080, 0x0080, 0x0000, 0x0083, 0x0083, 0x0000, 0x0086, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0088, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0087, 0x0086, + // Entry C0 - FF + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0088, 0x0087, + 0x0087, 0x0088, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, + 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0086, 0x0086, 0x0087, + 0x0087, 0x0086, 0x0087, 0x0087, 0x0087, 0x0087, 0x0087, 0x0000, + 0x00ef, 0x0000, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f1, 0x00f1, + // Entry 100 - 13F + 0x00f2, 0x00f2, 0x00f1, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f1, + 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x00f2, 0x0000, 0x010e, + 0x0000, 0x0110, 0x0000, 0x0112, 0x0000, 0x0114, 0x0114, 0x0000, + 0x0117, 0x0117, 0x0117, 0x0117, 0x0000, 0x011c, 0x0000, 0x011e, + 0x0000, 0x0120, 0x0120, 0x0000, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + // Entry 140 - 17F + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, 0x0123, + 0x0123, 0x0123, 0x0000, 0x0152, 0x0000, 0x0154, 0x0000, 0x0156, + 0x0000, 0x0158, 0x0000, 0x015a, 0x0000, 0x015c, 0x015c, 0x015c, + 0x0000, 0x0160, 0x0000, 0x0000, 0x0163, 0x0000, 0x0165, 0x0000, + 0x0167, 0x0167, 0x0167, 0x0000, 0x016b, 0x0000, 0x016d, 0x0000, + 0x016f, 0x0000, 0x0171, 0x0171, 0x0000, 0x0174, 0x0000, 0x0176, + 0x0000, 0x0178, 0x0000, 0x017a, 0x0000, 0x017c, 0x0000, 0x017e, + // Entry 180 - 1BF + 0x0000, 0x0000, 0x0000, 0x0182, 0x0000, 0x0184, 0x0184, 0x0184, + 0x0184, 0x0000, 0x0000, 0x0000, 0x018b, 0x0000, 0x0000, 0x018e, + 0x0000, 0x0000, 0x0191, 0x0000, 0x0000, 0x0000, 0x0195, 0x0000, + 0x0197, 0x0000, 0x0000, 0x019a, 0x0000, 0x0000, 0x019d, 0x0000, + 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, + 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x0000, 0x01ad, 0x0000, + 0x01af, 0x0000, 0x01b1, 0x01b1, 0x0000, 0x01b4, 0x0000, 0x01b6, + 0x0000, 0x01b8, 0x0000, 0x01ba, 0x0000, 0x01bc, 0x0000, 0x0000, + // Entry 1C0 - 1FF + 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x0000, + 0x01c7, 0x0000, 0x01c9, 0x0000, 0x01cb, 0x01cb, 0x01cb, 0x01cb, + 0x0000, 0x01d0, 0x0000, 0x01d2, 0x01d2, 0x0000, 0x01d5, 0x0000, + 0x01d7, 0x0000, 0x01d9, 0x0000, 0x01db, 0x0000, 0x01dd, 0x0000, + 0x01df, 0x01df, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, + 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, + 0x0000, 0x01f0, 0x0000, 0x0000, 0x01f3, 0x0000, 0x01f5, 0x01f5, + 0x01f5, 0x0000, 0x01f9, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x0000, + // Entry 200 - 23F + 0x01ff, 0x0000, 0x0000, 0x0202, 0x0000, 0x0204, 0x0204, 0x0000, + 0x0207, 0x0000, 0x0209, 0x0209, 0x0000, 0x020c, 0x020c, 0x0000, + 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x020f, 0x0000, + 0x0217, 0x0000, 0x0219, 0x0000, 0x021b, 0x0000, 0x0000, 0x0000, + 0x0000, 0x0000, 0x0221, 0x0000, 0x0000, 0x0224, 0x0000, 0x0226, + 0x0226, 0x0000, 0x0229, 0x0000, 0x022b, 0x022b, 0x0000, 0x0000, + 0x022f, 0x022e, 0x022e, 0x0000, 0x0000, 0x0234, 0x0000, 0x0236, + 0x0000, 0x0238, 0x0000, 0x0244, 0x023a, 0x0244, 0x0244, 0x0244, + // Entry 240 - 27F + 0x0244, 0x0244, 0x0244, 0x0244, 0x023a, 0x0244, 0x0244, 0x0000, + 0x0247, 0x0247, 0x0247, 0x0000, 0x024b, 0x0000, 0x024d, 0x0000, + 0x024f, 0x024f, 0x0000, 0x0252, 0x0000, 0x0254, 0x0254, 0x0254, + 0x0254, 0x0254, 0x0254, 0x0000, 0x025b, 0x0000, 0x025d, 0x0000, + 0x025f, 0x0000, 0x0261, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, + 0x0000, 0x0268, 0x0268, 0x0268, 0x0000, 0x026c, 0x0000, 0x026e, + 0x0000, 0x0270, 0x0000, 0x0000, 0x0000, 0x0274, 0x0273, 0x0273, + 0x0000, 0x0278, 0x0000, 0x027a, 0x0000, 0x027c, 0x0000, 0x0000, + // Entry 280 - 2BF + 0x0000, 0x0000, 0x0281, 0x0000, 0x0000, 0x0284, 0x0000, 0x0286, + 0x0286, 0x0286, 0x0286, 0x0000, 0x028b, 0x028b, 0x028b, 0x0000, + 0x028f, 0x028f, 0x028f, 0x028f, 0x028f, 0x0000, 0x0295, 0x0295, + 0x0295, 0x0295, 0x0000, 0x0000, 0x0000, 0x0000, 0x029d, 0x029d, + 0x029d, 0x0000, 0x02a1, 0x02a1, 0x02a1, 0x02a1, 0x0000, 0x0000, + 0x02a7, 0x02a7, 0x02a7, 0x02a7, 0x0000, 0x02ac, 0x0000, 0x02ae, + 0x02ae, 0x0000, 0x02b1, 0x0000, 0x02b3, 0x0000, 0x02b5, 0x02b5, + 0x0000, 0x0000, 0x02b9, 0x0000, 0x0000, 0x0000, 0x02bd, 0x0000, + // Entry 2C0 - 2FF + 0x02bf, 0x02bf, 0x0000, 0x0000, 0x02c3, 0x0000, 0x02c5, 0x0000, + 0x02c7, 0x0000, 0x02c9, 0x0000, 0x02cb, 0x0000, 0x02cd, 0x02cd, + 0x0000, 0x0000, 0x02d1, 0x0000, 0x02d3, 0x02d0, 0x02d0, 0x0000, + 0x0000, 0x02d8, 0x02d7, 0x02d7, 0x0000, 0x0000, 0x02dd, 0x0000, + 0x02df, 0x0000, 0x02e1, 0x0000, 0x0000, 0x02e4, 0x0000, 0x02e6, + 0x0000, 0x0000, 0x02e9, 0x0000, 0x02eb, 0x0000, 0x02ed, 0x0000, + 0x02ef, 0x02ef, 0x0000, 0x0000, 0x02f3, 0x02f2, 0x02f2, 0x0000, + 0x02f7, 0x0000, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x02f9, 0x0000, + // Entry 300 - 33F + 0x02ff, 0x0300, 0x02ff, 0x0000, 0x0303, 0x0051, 0x00e6, +} // Size: 1574 bytes + +// Total table size 1574 bytes (1KiB); checksum: 895AAF0B diff --git a/vendor/golang.org/x/text/internal/language/compact/tables.go b/vendor/golang.org/x/text/internal/language/compact/tables.go new file mode 100644 index 0000000000..554ca354b6 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tables.go @@ -0,0 +1,1015 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package compact + +import "golang.org/x/text/internal/language" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +// NumCompactTags is the number of common tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = 775 +const ( + undIndex ID = 0 + afIndex ID = 1 + afNAIndex ID = 2 + afZAIndex ID = 3 + agqIndex ID = 4 + agqCMIndex ID = 5 + akIndex ID = 6 + akGHIndex ID = 7 + amIndex ID = 8 + amETIndex ID = 9 + arIndex ID = 10 + ar001Index ID = 11 + arAEIndex ID = 12 + arBHIndex ID = 13 + arDJIndex ID = 14 + arDZIndex ID = 15 + arEGIndex ID = 16 + arEHIndex ID = 17 + arERIndex ID = 18 + arILIndex ID = 19 + arIQIndex ID = 20 + arJOIndex ID = 21 + arKMIndex ID = 22 + arKWIndex ID = 23 + arLBIndex ID = 24 + arLYIndex ID = 25 + arMAIndex ID = 26 + arMRIndex ID = 27 + arOMIndex ID = 28 + arPSIndex ID = 29 + arQAIndex ID = 30 + arSAIndex ID = 31 + arSDIndex ID = 32 + arSOIndex ID = 33 + arSSIndex ID = 34 + arSYIndex ID = 35 + arTDIndex ID = 36 + arTNIndex ID = 37 + arYEIndex ID = 38 + arsIndex ID = 39 + asIndex ID = 40 + asINIndex ID = 41 + asaIndex ID = 42 + asaTZIndex ID = 43 + astIndex ID = 44 + astESIndex ID = 45 + azIndex ID = 46 + azCyrlIndex ID = 47 + azCyrlAZIndex ID = 48 + azLatnIndex ID = 49 + azLatnAZIndex ID = 50 + basIndex ID = 51 + basCMIndex ID = 52 + beIndex ID = 53 + beBYIndex ID = 54 + bemIndex ID = 55 + bemZMIndex ID = 56 + bezIndex ID = 57 + bezTZIndex ID = 58 + bgIndex ID = 59 + bgBGIndex ID = 60 + bhIndex ID = 61 + bmIndex ID = 62 + bmMLIndex ID = 63 + bnIndex ID = 64 + bnBDIndex ID = 65 + bnINIndex ID = 66 + boIndex ID = 67 + boCNIndex ID = 68 + boINIndex ID = 69 + brIndex ID = 70 + brFRIndex ID = 71 + brxIndex ID = 72 + brxINIndex ID = 73 + bsIndex ID = 74 + bsCyrlIndex ID = 75 + bsCyrlBAIndex ID = 76 + bsLatnIndex ID = 77 + bsLatnBAIndex ID = 78 + caIndex ID = 79 + caADIndex ID = 80 + caESIndex ID = 81 + caFRIndex ID = 82 + caITIndex ID = 83 + ccpIndex ID = 84 + ccpBDIndex ID = 85 + ccpINIndex ID = 86 + ceIndex ID = 87 + ceRUIndex ID = 88 + cggIndex ID = 89 + cggUGIndex ID = 90 + chrIndex ID = 91 + chrUSIndex ID = 92 + ckbIndex ID = 93 + ckbIQIndex ID = 94 + ckbIRIndex ID = 95 + csIndex ID = 96 + csCZIndex ID = 97 + cuIndex ID = 98 + cuRUIndex ID = 99 + cyIndex ID = 100 + cyGBIndex ID = 101 + daIndex ID = 102 + daDKIndex ID = 103 + daGLIndex ID = 104 + davIndex ID = 105 + davKEIndex ID = 106 + deIndex ID = 107 + deATIndex ID = 108 + deBEIndex ID = 109 + deCHIndex ID = 110 + deDEIndex ID = 111 + deITIndex ID = 112 + deLIIndex ID = 113 + deLUIndex ID = 114 + djeIndex ID = 115 + djeNEIndex ID = 116 + dsbIndex ID = 117 + dsbDEIndex ID = 118 + duaIndex ID = 119 + duaCMIndex ID = 120 + dvIndex ID = 121 + dyoIndex ID = 122 + dyoSNIndex ID = 123 + dzIndex ID = 124 + dzBTIndex ID = 125 + ebuIndex ID = 126 + ebuKEIndex ID = 127 + eeIndex ID = 128 + eeGHIndex ID = 129 + eeTGIndex ID = 130 + elIndex ID = 131 + elCYIndex ID = 132 + elGRIndex ID = 133 + enIndex ID = 134 + en001Index ID = 135 + en150Index ID = 136 + enAGIndex ID = 137 + enAIIndex ID = 138 + enASIndex ID = 139 + enATIndex ID = 140 + enAUIndex ID = 141 + enBBIndex ID = 142 + enBEIndex ID = 143 + enBIIndex ID = 144 + enBMIndex ID = 145 + enBSIndex ID = 146 + enBWIndex ID = 147 + enBZIndex ID = 148 + enCAIndex ID = 149 + enCCIndex ID = 150 + enCHIndex ID = 151 + enCKIndex ID = 152 + enCMIndex ID = 153 + enCXIndex ID = 154 + enCYIndex ID = 155 + enDEIndex ID = 156 + enDGIndex ID = 157 + enDKIndex ID = 158 + enDMIndex ID = 159 + enERIndex ID = 160 + enFIIndex ID = 161 + enFJIndex ID = 162 + enFKIndex ID = 163 + enFMIndex ID = 164 + enGBIndex ID = 165 + enGDIndex ID = 166 + enGGIndex ID = 167 + enGHIndex ID = 168 + enGIIndex ID = 169 + enGMIndex ID = 170 + enGUIndex ID = 171 + enGYIndex ID = 172 + enHKIndex ID = 173 + enIEIndex ID = 174 + enILIndex ID = 175 + enIMIndex ID = 176 + enINIndex ID = 177 + enIOIndex ID = 178 + enJEIndex ID = 179 + enJMIndex ID = 180 + enKEIndex ID = 181 + enKIIndex ID = 182 + enKNIndex ID = 183 + enKYIndex ID = 184 + enLCIndex ID = 185 + enLRIndex ID = 186 + enLSIndex ID = 187 + enMGIndex ID = 188 + enMHIndex ID = 189 + enMOIndex ID = 190 + enMPIndex ID = 191 + enMSIndex ID = 192 + enMTIndex ID = 193 + enMUIndex ID = 194 + enMWIndex ID = 195 + enMYIndex ID = 196 + enNAIndex ID = 197 + enNFIndex ID = 198 + enNGIndex ID = 199 + enNLIndex ID = 200 + enNRIndex ID = 201 + enNUIndex ID = 202 + enNZIndex ID = 203 + enPGIndex ID = 204 + enPHIndex ID = 205 + enPKIndex ID = 206 + enPNIndex ID = 207 + enPRIndex ID = 208 + enPWIndex ID = 209 + enRWIndex ID = 210 + enSBIndex ID = 211 + enSCIndex ID = 212 + enSDIndex ID = 213 + enSEIndex ID = 214 + enSGIndex ID = 215 + enSHIndex ID = 216 + enSIIndex ID = 217 + enSLIndex ID = 218 + enSSIndex ID = 219 + enSXIndex ID = 220 + enSZIndex ID = 221 + enTCIndex ID = 222 + enTKIndex ID = 223 + enTOIndex ID = 224 + enTTIndex ID = 225 + enTVIndex ID = 226 + enTZIndex ID = 227 + enUGIndex ID = 228 + enUMIndex ID = 229 + enUSIndex ID = 230 + enVCIndex ID = 231 + enVGIndex ID = 232 + enVIIndex ID = 233 + enVUIndex ID = 234 + enWSIndex ID = 235 + enZAIndex ID = 236 + enZMIndex ID = 237 + enZWIndex ID = 238 + eoIndex ID = 239 + eo001Index ID = 240 + esIndex ID = 241 + es419Index ID = 242 + esARIndex ID = 243 + esBOIndex ID = 244 + esBRIndex ID = 245 + esBZIndex ID = 246 + esCLIndex ID = 247 + esCOIndex ID = 248 + esCRIndex ID = 249 + esCUIndex ID = 250 + esDOIndex ID = 251 + esEAIndex ID = 252 + esECIndex ID = 253 + esESIndex ID = 254 + esGQIndex ID = 255 + esGTIndex ID = 256 + esHNIndex ID = 257 + esICIndex ID = 258 + esMXIndex ID = 259 + esNIIndex ID = 260 + esPAIndex ID = 261 + esPEIndex ID = 262 + esPHIndex ID = 263 + esPRIndex ID = 264 + esPYIndex ID = 265 + esSVIndex ID = 266 + esUSIndex ID = 267 + esUYIndex ID = 268 + esVEIndex ID = 269 + etIndex ID = 270 + etEEIndex ID = 271 + euIndex ID = 272 + euESIndex ID = 273 + ewoIndex ID = 274 + ewoCMIndex ID = 275 + faIndex ID = 276 + faAFIndex ID = 277 + faIRIndex ID = 278 + ffIndex ID = 279 + ffCMIndex ID = 280 + ffGNIndex ID = 281 + ffMRIndex ID = 282 + ffSNIndex ID = 283 + fiIndex ID = 284 + fiFIIndex ID = 285 + filIndex ID = 286 + filPHIndex ID = 287 + foIndex ID = 288 + foDKIndex ID = 289 + foFOIndex ID = 290 + frIndex ID = 291 + frBEIndex ID = 292 + frBFIndex ID = 293 + frBIIndex ID = 294 + frBJIndex ID = 295 + frBLIndex ID = 296 + frCAIndex ID = 297 + frCDIndex ID = 298 + frCFIndex ID = 299 + frCGIndex ID = 300 + frCHIndex ID = 301 + frCIIndex ID = 302 + frCMIndex ID = 303 + frDJIndex ID = 304 + frDZIndex ID = 305 + frFRIndex ID = 306 + frGAIndex ID = 307 + frGFIndex ID = 308 + frGNIndex ID = 309 + frGPIndex ID = 310 + frGQIndex ID = 311 + frHTIndex ID = 312 + frKMIndex ID = 313 + frLUIndex ID = 314 + frMAIndex ID = 315 + frMCIndex ID = 316 + frMFIndex ID = 317 + frMGIndex ID = 318 + frMLIndex ID = 319 + frMQIndex ID = 320 + frMRIndex ID = 321 + frMUIndex ID = 322 + frNCIndex ID = 323 + frNEIndex ID = 324 + frPFIndex ID = 325 + frPMIndex ID = 326 + frREIndex ID = 327 + frRWIndex ID = 328 + frSCIndex ID = 329 + frSNIndex ID = 330 + frSYIndex ID = 331 + frTDIndex ID = 332 + frTGIndex ID = 333 + frTNIndex ID = 334 + frVUIndex ID = 335 + frWFIndex ID = 336 + frYTIndex ID = 337 + furIndex ID = 338 + furITIndex ID = 339 + fyIndex ID = 340 + fyNLIndex ID = 341 + gaIndex ID = 342 + gaIEIndex ID = 343 + gdIndex ID = 344 + gdGBIndex ID = 345 + glIndex ID = 346 + glESIndex ID = 347 + gswIndex ID = 348 + gswCHIndex ID = 349 + gswFRIndex ID = 350 + gswLIIndex ID = 351 + guIndex ID = 352 + guINIndex ID = 353 + guwIndex ID = 354 + guzIndex ID = 355 + guzKEIndex ID = 356 + gvIndex ID = 357 + gvIMIndex ID = 358 + haIndex ID = 359 + haGHIndex ID = 360 + haNEIndex ID = 361 + haNGIndex ID = 362 + hawIndex ID = 363 + hawUSIndex ID = 364 + heIndex ID = 365 + heILIndex ID = 366 + hiIndex ID = 367 + hiINIndex ID = 368 + hrIndex ID = 369 + hrBAIndex ID = 370 + hrHRIndex ID = 371 + hsbIndex ID = 372 + hsbDEIndex ID = 373 + huIndex ID = 374 + huHUIndex ID = 375 + hyIndex ID = 376 + hyAMIndex ID = 377 + idIndex ID = 378 + idIDIndex ID = 379 + igIndex ID = 380 + igNGIndex ID = 381 + iiIndex ID = 382 + iiCNIndex ID = 383 + inIndex ID = 384 + ioIndex ID = 385 + isIndex ID = 386 + isISIndex ID = 387 + itIndex ID = 388 + itCHIndex ID = 389 + itITIndex ID = 390 + itSMIndex ID = 391 + itVAIndex ID = 392 + iuIndex ID = 393 + iwIndex ID = 394 + jaIndex ID = 395 + jaJPIndex ID = 396 + jboIndex ID = 397 + jgoIndex ID = 398 + jgoCMIndex ID = 399 + jiIndex ID = 400 + jmcIndex ID = 401 + jmcTZIndex ID = 402 + jvIndex ID = 403 + jwIndex ID = 404 + kaIndex ID = 405 + kaGEIndex ID = 406 + kabIndex ID = 407 + kabDZIndex ID = 408 + kajIndex ID = 409 + kamIndex ID = 410 + kamKEIndex ID = 411 + kcgIndex ID = 412 + kdeIndex ID = 413 + kdeTZIndex ID = 414 + keaIndex ID = 415 + keaCVIndex ID = 416 + khqIndex ID = 417 + khqMLIndex ID = 418 + kiIndex ID = 419 + kiKEIndex ID = 420 + kkIndex ID = 421 + kkKZIndex ID = 422 + kkjIndex ID = 423 + kkjCMIndex ID = 424 + klIndex ID = 425 + klGLIndex ID = 426 + klnIndex ID = 427 + klnKEIndex ID = 428 + kmIndex ID = 429 + kmKHIndex ID = 430 + knIndex ID = 431 + knINIndex ID = 432 + koIndex ID = 433 + koKPIndex ID = 434 + koKRIndex ID = 435 + kokIndex ID = 436 + kokINIndex ID = 437 + ksIndex ID = 438 + ksINIndex ID = 439 + ksbIndex ID = 440 + ksbTZIndex ID = 441 + ksfIndex ID = 442 + ksfCMIndex ID = 443 + kshIndex ID = 444 + kshDEIndex ID = 445 + kuIndex ID = 446 + kwIndex ID = 447 + kwGBIndex ID = 448 + kyIndex ID = 449 + kyKGIndex ID = 450 + lagIndex ID = 451 + lagTZIndex ID = 452 + lbIndex ID = 453 + lbLUIndex ID = 454 + lgIndex ID = 455 + lgUGIndex ID = 456 + lktIndex ID = 457 + lktUSIndex ID = 458 + lnIndex ID = 459 + lnAOIndex ID = 460 + lnCDIndex ID = 461 + lnCFIndex ID = 462 + lnCGIndex ID = 463 + loIndex ID = 464 + loLAIndex ID = 465 + lrcIndex ID = 466 + lrcIQIndex ID = 467 + lrcIRIndex ID = 468 + ltIndex ID = 469 + ltLTIndex ID = 470 + luIndex ID = 471 + luCDIndex ID = 472 + luoIndex ID = 473 + luoKEIndex ID = 474 + luyIndex ID = 475 + luyKEIndex ID = 476 + lvIndex ID = 477 + lvLVIndex ID = 478 + masIndex ID = 479 + masKEIndex ID = 480 + masTZIndex ID = 481 + merIndex ID = 482 + merKEIndex ID = 483 + mfeIndex ID = 484 + mfeMUIndex ID = 485 + mgIndex ID = 486 + mgMGIndex ID = 487 + mghIndex ID = 488 + mghMZIndex ID = 489 + mgoIndex ID = 490 + mgoCMIndex ID = 491 + mkIndex ID = 492 + mkMKIndex ID = 493 + mlIndex ID = 494 + mlINIndex ID = 495 + mnIndex ID = 496 + mnMNIndex ID = 497 + moIndex ID = 498 + mrIndex ID = 499 + mrINIndex ID = 500 + msIndex ID = 501 + msBNIndex ID = 502 + msMYIndex ID = 503 + msSGIndex ID = 504 + mtIndex ID = 505 + mtMTIndex ID = 506 + muaIndex ID = 507 + muaCMIndex ID = 508 + myIndex ID = 509 + myMMIndex ID = 510 + mznIndex ID = 511 + mznIRIndex ID = 512 + nahIndex ID = 513 + naqIndex ID = 514 + naqNAIndex ID = 515 + nbIndex ID = 516 + nbNOIndex ID = 517 + nbSJIndex ID = 518 + ndIndex ID = 519 + ndZWIndex ID = 520 + ndsIndex ID = 521 + ndsDEIndex ID = 522 + ndsNLIndex ID = 523 + neIndex ID = 524 + neINIndex ID = 525 + neNPIndex ID = 526 + nlIndex ID = 527 + nlAWIndex ID = 528 + nlBEIndex ID = 529 + nlBQIndex ID = 530 + nlCWIndex ID = 531 + nlNLIndex ID = 532 + nlSRIndex ID = 533 + nlSXIndex ID = 534 + nmgIndex ID = 535 + nmgCMIndex ID = 536 + nnIndex ID = 537 + nnNOIndex ID = 538 + nnhIndex ID = 539 + nnhCMIndex ID = 540 + noIndex ID = 541 + nqoIndex ID = 542 + nrIndex ID = 543 + nsoIndex ID = 544 + nusIndex ID = 545 + nusSSIndex ID = 546 + nyIndex ID = 547 + nynIndex ID = 548 + nynUGIndex ID = 549 + omIndex ID = 550 + omETIndex ID = 551 + omKEIndex ID = 552 + orIndex ID = 553 + orINIndex ID = 554 + osIndex ID = 555 + osGEIndex ID = 556 + osRUIndex ID = 557 + paIndex ID = 558 + paArabIndex ID = 559 + paArabPKIndex ID = 560 + paGuruIndex ID = 561 + paGuruINIndex ID = 562 + papIndex ID = 563 + plIndex ID = 564 + plPLIndex ID = 565 + prgIndex ID = 566 + prg001Index ID = 567 + psIndex ID = 568 + psAFIndex ID = 569 + ptIndex ID = 570 + ptAOIndex ID = 571 + ptBRIndex ID = 572 + ptCHIndex ID = 573 + ptCVIndex ID = 574 + ptGQIndex ID = 575 + ptGWIndex ID = 576 + ptLUIndex ID = 577 + ptMOIndex ID = 578 + ptMZIndex ID = 579 + ptPTIndex ID = 580 + ptSTIndex ID = 581 + ptTLIndex ID = 582 + quIndex ID = 583 + quBOIndex ID = 584 + quECIndex ID = 585 + quPEIndex ID = 586 + rmIndex ID = 587 + rmCHIndex ID = 588 + rnIndex ID = 589 + rnBIIndex ID = 590 + roIndex ID = 591 + roMDIndex ID = 592 + roROIndex ID = 593 + rofIndex ID = 594 + rofTZIndex ID = 595 + ruIndex ID = 596 + ruBYIndex ID = 597 + ruKGIndex ID = 598 + ruKZIndex ID = 599 + ruMDIndex ID = 600 + ruRUIndex ID = 601 + ruUAIndex ID = 602 + rwIndex ID = 603 + rwRWIndex ID = 604 + rwkIndex ID = 605 + rwkTZIndex ID = 606 + sahIndex ID = 607 + sahRUIndex ID = 608 + saqIndex ID = 609 + saqKEIndex ID = 610 + sbpIndex ID = 611 + sbpTZIndex ID = 612 + sdIndex ID = 613 + sdPKIndex ID = 614 + sdhIndex ID = 615 + seIndex ID = 616 + seFIIndex ID = 617 + seNOIndex ID = 618 + seSEIndex ID = 619 + sehIndex ID = 620 + sehMZIndex ID = 621 + sesIndex ID = 622 + sesMLIndex ID = 623 + sgIndex ID = 624 + sgCFIndex ID = 625 + shIndex ID = 626 + shiIndex ID = 627 + shiLatnIndex ID = 628 + shiLatnMAIndex ID = 629 + shiTfngIndex ID = 630 + shiTfngMAIndex ID = 631 + siIndex ID = 632 + siLKIndex ID = 633 + skIndex ID = 634 + skSKIndex ID = 635 + slIndex ID = 636 + slSIIndex ID = 637 + smaIndex ID = 638 + smiIndex ID = 639 + smjIndex ID = 640 + smnIndex ID = 641 + smnFIIndex ID = 642 + smsIndex ID = 643 + snIndex ID = 644 + snZWIndex ID = 645 + soIndex ID = 646 + soDJIndex ID = 647 + soETIndex ID = 648 + soKEIndex ID = 649 + soSOIndex ID = 650 + sqIndex ID = 651 + sqALIndex ID = 652 + sqMKIndex ID = 653 + sqXKIndex ID = 654 + srIndex ID = 655 + srCyrlIndex ID = 656 + srCyrlBAIndex ID = 657 + srCyrlMEIndex ID = 658 + srCyrlRSIndex ID = 659 + srCyrlXKIndex ID = 660 + srLatnIndex ID = 661 + srLatnBAIndex ID = 662 + srLatnMEIndex ID = 663 + srLatnRSIndex ID = 664 + srLatnXKIndex ID = 665 + ssIndex ID = 666 + ssyIndex ID = 667 + stIndex ID = 668 + svIndex ID = 669 + svAXIndex ID = 670 + svFIIndex ID = 671 + svSEIndex ID = 672 + swIndex ID = 673 + swCDIndex ID = 674 + swKEIndex ID = 675 + swTZIndex ID = 676 + swUGIndex ID = 677 + syrIndex ID = 678 + taIndex ID = 679 + taINIndex ID = 680 + taLKIndex ID = 681 + taMYIndex ID = 682 + taSGIndex ID = 683 + teIndex ID = 684 + teINIndex ID = 685 + teoIndex ID = 686 + teoKEIndex ID = 687 + teoUGIndex ID = 688 + tgIndex ID = 689 + tgTJIndex ID = 690 + thIndex ID = 691 + thTHIndex ID = 692 + tiIndex ID = 693 + tiERIndex ID = 694 + tiETIndex ID = 695 + tigIndex ID = 696 + tkIndex ID = 697 + tkTMIndex ID = 698 + tlIndex ID = 699 + tnIndex ID = 700 + toIndex ID = 701 + toTOIndex ID = 702 + trIndex ID = 703 + trCYIndex ID = 704 + trTRIndex ID = 705 + tsIndex ID = 706 + ttIndex ID = 707 + ttRUIndex ID = 708 + twqIndex ID = 709 + twqNEIndex ID = 710 + tzmIndex ID = 711 + tzmMAIndex ID = 712 + ugIndex ID = 713 + ugCNIndex ID = 714 + ukIndex ID = 715 + ukUAIndex ID = 716 + urIndex ID = 717 + urINIndex ID = 718 + urPKIndex ID = 719 + uzIndex ID = 720 + uzArabIndex ID = 721 + uzArabAFIndex ID = 722 + uzCyrlIndex ID = 723 + uzCyrlUZIndex ID = 724 + uzLatnIndex ID = 725 + uzLatnUZIndex ID = 726 + vaiIndex ID = 727 + vaiLatnIndex ID = 728 + vaiLatnLRIndex ID = 729 + vaiVaiiIndex ID = 730 + vaiVaiiLRIndex ID = 731 + veIndex ID = 732 + viIndex ID = 733 + viVNIndex ID = 734 + voIndex ID = 735 + vo001Index ID = 736 + vunIndex ID = 737 + vunTZIndex ID = 738 + waIndex ID = 739 + waeIndex ID = 740 + waeCHIndex ID = 741 + woIndex ID = 742 + woSNIndex ID = 743 + xhIndex ID = 744 + xogIndex ID = 745 + xogUGIndex ID = 746 + yavIndex ID = 747 + yavCMIndex ID = 748 + yiIndex ID = 749 + yi001Index ID = 750 + yoIndex ID = 751 + yoBJIndex ID = 752 + yoNGIndex ID = 753 + yueIndex ID = 754 + yueHansIndex ID = 755 + yueHansCNIndex ID = 756 + yueHantIndex ID = 757 + yueHantHKIndex ID = 758 + zghIndex ID = 759 + zghMAIndex ID = 760 + zhIndex ID = 761 + zhHansIndex ID = 762 + zhHansCNIndex ID = 763 + zhHansHKIndex ID = 764 + zhHansMOIndex ID = 765 + zhHansSGIndex ID = 766 + zhHantIndex ID = 767 + zhHantHKIndex ID = 768 + zhHantMOIndex ID = 769 + zhHantTWIndex ID = 770 + zuIndex ID = 771 + zuZAIndex ID = 772 + caESvalenciaIndex ID = 773 + enUSuvaposixIndex ID = 774 +) + +var coreTags = []language.CompactCoreInfo{ // 773 elements + // Entry 0 - 1F + 0x00000000, 0x01600000, 0x016000d2, 0x01600161, + 0x01c00000, 0x01c00052, 0x02100000, 0x02100080, + 0x02700000, 0x0270006f, 0x03a00000, 0x03a00001, + 0x03a00023, 0x03a00039, 0x03a00062, 0x03a00067, + 0x03a0006b, 0x03a0006c, 0x03a0006d, 0x03a00097, + 0x03a0009b, 0x03a000a1, 0x03a000a8, 0x03a000ac, + 0x03a000b0, 0x03a000b9, 0x03a000ba, 0x03a000c9, + 0x03a000e1, 0x03a000ed, 0x03a000f3, 0x03a00108, + // Entry 20 - 3F + 0x03a0010b, 0x03a00115, 0x03a00117, 0x03a0011c, + 0x03a00120, 0x03a00128, 0x03a0015e, 0x04000000, + 0x04300000, 0x04300099, 0x04400000, 0x0440012f, + 0x04800000, 0x0480006e, 0x05800000, 0x0581f000, + 0x0581f032, 0x05857000, 0x05857032, 0x05e00000, + 0x05e00052, 0x07100000, 0x07100047, 0x07500000, + 0x07500162, 0x07900000, 0x0790012f, 0x07e00000, + 0x07e00038, 0x08200000, 0x0a000000, 0x0a0000c3, + // Entry 40 - 5F + 0x0a500000, 0x0a500035, 0x0a500099, 0x0a900000, + 0x0a900053, 0x0a900099, 0x0b200000, 0x0b200078, + 0x0b500000, 0x0b500099, 0x0b700000, 0x0b71f000, + 0x0b71f033, 0x0b757000, 0x0b757033, 0x0d700000, + 0x0d700022, 0x0d70006e, 0x0d700078, 0x0d70009e, + 0x0db00000, 0x0db00035, 0x0db00099, 0x0dc00000, + 0x0dc00106, 0x0df00000, 0x0df00131, 0x0e500000, + 0x0e500135, 0x0e900000, 0x0e90009b, 0x0e90009c, + // Entry 60 - 7F + 0x0fa00000, 0x0fa0005e, 0x0fe00000, 0x0fe00106, + 0x10000000, 0x1000007b, 0x10100000, 0x10100063, + 0x10100082, 0x10800000, 0x108000a4, 0x10d00000, + 0x10d0002e, 0x10d00036, 0x10d0004e, 0x10d00060, + 0x10d0009e, 0x10d000b2, 0x10d000b7, 0x11700000, + 0x117000d4, 0x11f00000, 0x11f00060, 0x12400000, + 0x12400052, 0x12800000, 0x12b00000, 0x12b00114, + 0x12d00000, 0x12d00043, 0x12f00000, 0x12f000a4, + // Entry 80 - 9F + 0x13000000, 0x13000080, 0x13000122, 0x13600000, + 0x1360005d, 0x13600087, 0x13900000, 0x13900001, + 0x1390001a, 0x13900025, 0x13900026, 0x1390002d, + 0x1390002e, 0x1390002f, 0x13900034, 0x13900036, + 0x1390003a, 0x1390003d, 0x13900042, 0x13900046, + 0x13900048, 0x13900049, 0x1390004a, 0x1390004e, + 0x13900050, 0x13900052, 0x1390005c, 0x1390005d, + 0x13900060, 0x13900061, 0x13900063, 0x13900064, + // Entry A0 - BF + 0x1390006d, 0x13900072, 0x13900073, 0x13900074, + 0x13900075, 0x1390007b, 0x1390007c, 0x1390007f, + 0x13900080, 0x13900081, 0x13900083, 0x1390008a, + 0x1390008c, 0x1390008d, 0x13900096, 0x13900097, + 0x13900098, 0x13900099, 0x1390009a, 0x1390009f, + 0x139000a0, 0x139000a4, 0x139000a7, 0x139000a9, + 0x139000ad, 0x139000b1, 0x139000b4, 0x139000b5, + 0x139000bf, 0x139000c0, 0x139000c6, 0x139000c7, + // Entry C0 - DF + 0x139000ca, 0x139000cb, 0x139000cc, 0x139000ce, + 0x139000d0, 0x139000d2, 0x139000d5, 0x139000d6, + 0x139000d9, 0x139000dd, 0x139000df, 0x139000e0, + 0x139000e6, 0x139000e7, 0x139000e8, 0x139000eb, + 0x139000ec, 0x139000f0, 0x13900107, 0x13900109, + 0x1390010a, 0x1390010b, 0x1390010c, 0x1390010d, + 0x1390010e, 0x1390010f, 0x13900112, 0x13900117, + 0x1390011b, 0x1390011d, 0x1390011f, 0x13900125, + // Entry E0 - FF + 0x13900129, 0x1390012c, 0x1390012d, 0x1390012f, + 0x13900131, 0x13900133, 0x13900135, 0x13900139, + 0x1390013c, 0x1390013d, 0x1390013f, 0x13900142, + 0x13900161, 0x13900162, 0x13900164, 0x13c00000, + 0x13c00001, 0x13e00000, 0x13e0001f, 0x13e0002c, + 0x13e0003f, 0x13e00041, 0x13e00048, 0x13e00051, + 0x13e00054, 0x13e00056, 0x13e00059, 0x13e00065, + 0x13e00068, 0x13e00069, 0x13e0006e, 0x13e00086, + // Entry 100 - 11F + 0x13e00089, 0x13e0008f, 0x13e00094, 0x13e000cf, + 0x13e000d8, 0x13e000e2, 0x13e000e4, 0x13e000e7, + 0x13e000ec, 0x13e000f1, 0x13e0011a, 0x13e00135, + 0x13e00136, 0x13e0013b, 0x14000000, 0x1400006a, + 0x14500000, 0x1450006e, 0x14600000, 0x14600052, + 0x14800000, 0x14800024, 0x1480009c, 0x14e00000, + 0x14e00052, 0x14e00084, 0x14e000c9, 0x14e00114, + 0x15100000, 0x15100072, 0x15300000, 0x153000e7, + // Entry 120 - 13F + 0x15800000, 0x15800063, 0x15800076, 0x15e00000, + 0x15e00036, 0x15e00037, 0x15e0003a, 0x15e0003b, + 0x15e0003c, 0x15e00049, 0x15e0004b, 0x15e0004c, + 0x15e0004d, 0x15e0004e, 0x15e0004f, 0x15e00052, + 0x15e00062, 0x15e00067, 0x15e00078, 0x15e0007a, + 0x15e0007e, 0x15e00084, 0x15e00085, 0x15e00086, + 0x15e00091, 0x15e000a8, 0x15e000b7, 0x15e000ba, + 0x15e000bb, 0x15e000be, 0x15e000bf, 0x15e000c3, + // Entry 140 - 15F + 0x15e000c8, 0x15e000c9, 0x15e000cc, 0x15e000d3, + 0x15e000d4, 0x15e000e5, 0x15e000ea, 0x15e00102, + 0x15e00107, 0x15e0010a, 0x15e00114, 0x15e0011c, + 0x15e00120, 0x15e00122, 0x15e00128, 0x15e0013f, + 0x15e00140, 0x15e0015f, 0x16900000, 0x1690009e, + 0x16d00000, 0x16d000d9, 0x16e00000, 0x16e00096, + 0x17e00000, 0x17e0007b, 0x19000000, 0x1900006e, + 0x1a300000, 0x1a30004e, 0x1a300078, 0x1a3000b2, + // Entry 160 - 17F + 0x1a400000, 0x1a400099, 0x1a900000, 0x1ab00000, + 0x1ab000a4, 0x1ac00000, 0x1ac00098, 0x1b400000, + 0x1b400080, 0x1b4000d4, 0x1b4000d6, 0x1b800000, + 0x1b800135, 0x1bc00000, 0x1bc00097, 0x1be00000, + 0x1be00099, 0x1d100000, 0x1d100033, 0x1d100090, + 0x1d200000, 0x1d200060, 0x1d500000, 0x1d500092, + 0x1d700000, 0x1d700028, 0x1e100000, 0x1e100095, + 0x1e700000, 0x1e7000d6, 0x1ea00000, 0x1ea00053, + // Entry 180 - 19F + 0x1f300000, 0x1f500000, 0x1f800000, 0x1f80009d, + 0x1f900000, 0x1f90004e, 0x1f90009e, 0x1f900113, + 0x1f900138, 0x1fa00000, 0x1fb00000, 0x20000000, + 0x200000a2, 0x20300000, 0x20700000, 0x20700052, + 0x20800000, 0x20a00000, 0x20a0012f, 0x20e00000, + 0x20f00000, 0x21000000, 0x2100007d, 0x21200000, + 0x21200067, 0x21600000, 0x21700000, 0x217000a4, + 0x21f00000, 0x22300000, 0x2230012f, 0x22700000, + // Entry 1A0 - 1BF + 0x2270005a, 0x23400000, 0x234000c3, 0x23900000, + 0x239000a4, 0x24200000, 0x242000ae, 0x24400000, + 0x24400052, 0x24500000, 0x24500082, 0x24600000, + 0x246000a4, 0x24a00000, 0x24a000a6, 0x25100000, + 0x25100099, 0x25400000, 0x254000aa, 0x254000ab, + 0x25600000, 0x25600099, 0x26a00000, 0x26a00099, + 0x26b00000, 0x26b0012f, 0x26d00000, 0x26d00052, + 0x26e00000, 0x26e00060, 0x27400000, 0x28100000, + // Entry 1C0 - 1DF + 0x2810007b, 0x28a00000, 0x28a000a5, 0x29100000, + 0x2910012f, 0x29500000, 0x295000b7, 0x2a300000, + 0x2a300131, 0x2af00000, 0x2af00135, 0x2b500000, + 0x2b50002a, 0x2b50004b, 0x2b50004c, 0x2b50004d, + 0x2b800000, 0x2b8000af, 0x2bf00000, 0x2bf0009b, + 0x2bf0009c, 0x2c000000, 0x2c0000b6, 0x2c200000, + 0x2c20004b, 0x2c400000, 0x2c4000a4, 0x2c500000, + 0x2c5000a4, 0x2c700000, 0x2c7000b8, 0x2d100000, + // Entry 1E0 - 1FF + 0x2d1000a4, 0x2d10012f, 0x2e900000, 0x2e9000a4, + 0x2ed00000, 0x2ed000cc, 0x2f100000, 0x2f1000bf, + 0x2f200000, 0x2f2000d1, 0x2f400000, 0x2f400052, + 0x2ff00000, 0x2ff000c2, 0x30400000, 0x30400099, + 0x30b00000, 0x30b000c5, 0x31000000, 0x31b00000, + 0x31b00099, 0x31f00000, 0x31f0003e, 0x31f000d0, + 0x31f0010d, 0x32000000, 0x320000cb, 0x32500000, + 0x32500052, 0x33100000, 0x331000c4, 0x33a00000, + // Entry 200 - 21F + 0x33a0009c, 0x34100000, 0x34500000, 0x345000d2, + 0x34700000, 0x347000da, 0x34700110, 0x34e00000, + 0x34e00164, 0x35000000, 0x35000060, 0x350000d9, + 0x35100000, 0x35100099, 0x351000db, 0x36700000, + 0x36700030, 0x36700036, 0x36700040, 0x3670005b, + 0x367000d9, 0x36700116, 0x3670011b, 0x36800000, + 0x36800052, 0x36a00000, 0x36a000da, 0x36c00000, + 0x36c00052, 0x36f00000, 0x37500000, 0x37600000, + // Entry 220 - 23F + 0x37a00000, 0x38000000, 0x38000117, 0x38700000, + 0x38900000, 0x38900131, 0x39000000, 0x3900006f, + 0x390000a4, 0x39500000, 0x39500099, 0x39800000, + 0x3980007d, 0x39800106, 0x39d00000, 0x39d05000, + 0x39d050e8, 0x39d33000, 0x39d33099, 0x3a100000, + 0x3b300000, 0x3b3000e9, 0x3bd00000, 0x3bd00001, + 0x3be00000, 0x3be00024, 0x3c000000, 0x3c00002a, + 0x3c000041, 0x3c00004e, 0x3c00005a, 0x3c000086, + // Entry 240 - 25F + 0x3c00008b, 0x3c0000b7, 0x3c0000c6, 0x3c0000d1, + 0x3c0000ee, 0x3c000118, 0x3c000126, 0x3c400000, + 0x3c40003f, 0x3c400069, 0x3c4000e4, 0x3d400000, + 0x3d40004e, 0x3d900000, 0x3d90003a, 0x3dc00000, + 0x3dc000bc, 0x3dc00104, 0x3de00000, 0x3de0012f, + 0x3e200000, 0x3e200047, 0x3e2000a5, 0x3e2000ae, + 0x3e2000bc, 0x3e200106, 0x3e200130, 0x3e500000, + 0x3e500107, 0x3e600000, 0x3e60012f, 0x3eb00000, + // Entry 260 - 27F + 0x3eb00106, 0x3ec00000, 0x3ec000a4, 0x3f300000, + 0x3f30012f, 0x3fa00000, 0x3fa000e8, 0x3fc00000, + 0x3fd00000, 0x3fd00072, 0x3fd000da, 0x3fd0010c, + 0x3ff00000, 0x3ff000d1, 0x40100000, 0x401000c3, + 0x40200000, 0x4020004c, 0x40700000, 0x40800000, + 0x40857000, 0x408570ba, 0x408dc000, 0x408dc0ba, + 0x40c00000, 0x40c000b3, 0x41200000, 0x41200111, + 0x41600000, 0x4160010f, 0x41c00000, 0x41d00000, + // Entry 280 - 29F + 0x41e00000, 0x41f00000, 0x41f00072, 0x42200000, + 0x42300000, 0x42300164, 0x42900000, 0x42900062, + 0x4290006f, 0x429000a4, 0x42900115, 0x43100000, + 0x43100027, 0x431000c2, 0x4310014d, 0x43200000, + 0x4321f000, 0x4321f033, 0x4321f0bd, 0x4321f105, + 0x4321f14d, 0x43257000, 0x43257033, 0x432570bd, + 0x43257105, 0x4325714d, 0x43700000, 0x43a00000, + 0x43b00000, 0x44400000, 0x44400031, 0x44400072, + // Entry 2A0 - 2BF + 0x4440010c, 0x44500000, 0x4450004b, 0x445000a4, + 0x4450012f, 0x44500131, 0x44e00000, 0x45000000, + 0x45000099, 0x450000b3, 0x450000d0, 0x4500010d, + 0x46100000, 0x46100099, 0x46400000, 0x464000a4, + 0x46400131, 0x46700000, 0x46700124, 0x46b00000, + 0x46b00123, 0x46f00000, 0x46f0006d, 0x46f0006f, + 0x47100000, 0x47600000, 0x47600127, 0x47a00000, + 0x48000000, 0x48200000, 0x48200129, 0x48a00000, + // Entry 2C0 - 2DF + 0x48a0005d, 0x48a0012b, 0x48e00000, 0x49400000, + 0x49400106, 0x4a400000, 0x4a4000d4, 0x4a900000, + 0x4a9000ba, 0x4ac00000, 0x4ac00053, 0x4ae00000, + 0x4ae00130, 0x4b400000, 0x4b400099, 0x4b4000e8, + 0x4bc00000, 0x4bc05000, 0x4bc05024, 0x4bc1f000, + 0x4bc1f137, 0x4bc57000, 0x4bc57137, 0x4be00000, + 0x4be57000, 0x4be570b4, 0x4bee3000, 0x4bee30b4, + 0x4c000000, 0x4c300000, 0x4c30013e, 0x4c900000, + // Entry 2E0 - 2FF + 0x4c900001, 0x4cc00000, 0x4cc0012f, 0x4ce00000, + 0x4cf00000, 0x4cf0004e, 0x4e500000, 0x4e500114, + 0x4f200000, 0x4fb00000, 0x4fb00131, 0x50900000, + 0x50900052, 0x51200000, 0x51200001, 0x51800000, + 0x5180003b, 0x518000d6, 0x51f00000, 0x51f38000, + 0x51f38053, 0x51f39000, 0x51f3908d, 0x52800000, + 0x528000ba, 0x52900000, 0x52938000, 0x52938053, + 0x5293808d, 0x529380c6, 0x5293810d, 0x52939000, + // Entry 300 - 31F + 0x5293908d, 0x529390c6, 0x5293912e, 0x52f00000, + 0x52f00161, +} // Size: 3116 bytes + +const specialTagsStr string = "ca-ES-valencia en-US-u-va-posix" + +// Total table size 3147 bytes (3KiB); checksum: F4E57D15 diff --git a/vendor/golang.org/x/text/internal/language/compact/tags.go b/vendor/golang.org/x/text/internal/language/compact/tags.go new file mode 100644 index 0000000000..ca135d295a --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compact/tags.go @@ -0,0 +1,91 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package compact + +var ( + und = Tag{} + + Und Tag = Tag{} + + Afrikaans Tag = Tag{language: afIndex, locale: afIndex} + Amharic Tag = Tag{language: amIndex, locale: amIndex} + Arabic Tag = Tag{language: arIndex, locale: arIndex} + ModernStandardArabic Tag = Tag{language: ar001Index, locale: ar001Index} + Azerbaijani Tag = Tag{language: azIndex, locale: azIndex} + Bulgarian Tag = Tag{language: bgIndex, locale: bgIndex} + Bengali Tag = Tag{language: bnIndex, locale: bnIndex} + Catalan Tag = Tag{language: caIndex, locale: caIndex} + Czech Tag = Tag{language: csIndex, locale: csIndex} + Danish Tag = Tag{language: daIndex, locale: daIndex} + German Tag = Tag{language: deIndex, locale: deIndex} + Greek Tag = Tag{language: elIndex, locale: elIndex} + English Tag = Tag{language: enIndex, locale: enIndex} + AmericanEnglish Tag = Tag{language: enUSIndex, locale: enUSIndex} + BritishEnglish Tag = Tag{language: enGBIndex, locale: enGBIndex} + Spanish Tag = Tag{language: esIndex, locale: esIndex} + EuropeanSpanish Tag = Tag{language: esESIndex, locale: esESIndex} + LatinAmericanSpanish Tag = Tag{language: es419Index, locale: es419Index} + Estonian Tag = Tag{language: etIndex, locale: etIndex} + Persian Tag = Tag{language: faIndex, locale: faIndex} + Finnish Tag = Tag{language: fiIndex, locale: fiIndex} + Filipino Tag = Tag{language: filIndex, locale: filIndex} + French Tag = Tag{language: frIndex, locale: frIndex} + CanadianFrench Tag = Tag{language: frCAIndex, locale: frCAIndex} + Gujarati Tag = Tag{language: guIndex, locale: guIndex} + Hebrew Tag = Tag{language: heIndex, locale: heIndex} + Hindi Tag = Tag{language: hiIndex, locale: hiIndex} + Croatian Tag = Tag{language: hrIndex, locale: hrIndex} + Hungarian Tag = Tag{language: huIndex, locale: huIndex} + Armenian Tag = Tag{language: hyIndex, locale: hyIndex} + Indonesian Tag = Tag{language: idIndex, locale: idIndex} + Icelandic Tag = Tag{language: isIndex, locale: isIndex} + Italian Tag = Tag{language: itIndex, locale: itIndex} + Japanese Tag = Tag{language: jaIndex, locale: jaIndex} + Georgian Tag = Tag{language: kaIndex, locale: kaIndex} + Kazakh Tag = Tag{language: kkIndex, locale: kkIndex} + Khmer Tag = Tag{language: kmIndex, locale: kmIndex} + Kannada Tag = Tag{language: knIndex, locale: knIndex} + Korean Tag = Tag{language: koIndex, locale: koIndex} + Kirghiz Tag = Tag{language: kyIndex, locale: kyIndex} + Lao Tag = Tag{language: loIndex, locale: loIndex} + Lithuanian Tag = Tag{language: ltIndex, locale: ltIndex} + Latvian Tag = Tag{language: lvIndex, locale: lvIndex} + Macedonian Tag = Tag{language: mkIndex, locale: mkIndex} + Malayalam Tag = Tag{language: mlIndex, locale: mlIndex} + Mongolian Tag = Tag{language: mnIndex, locale: mnIndex} + Marathi Tag = Tag{language: mrIndex, locale: mrIndex} + Malay Tag = Tag{language: msIndex, locale: msIndex} + Burmese Tag = Tag{language: myIndex, locale: myIndex} + Nepali Tag = Tag{language: neIndex, locale: neIndex} + Dutch Tag = Tag{language: nlIndex, locale: nlIndex} + Norwegian Tag = Tag{language: noIndex, locale: noIndex} + Punjabi Tag = Tag{language: paIndex, locale: paIndex} + Polish Tag = Tag{language: plIndex, locale: plIndex} + Portuguese Tag = Tag{language: ptIndex, locale: ptIndex} + BrazilianPortuguese Tag = Tag{language: ptBRIndex, locale: ptBRIndex} + EuropeanPortuguese Tag = Tag{language: ptPTIndex, locale: ptPTIndex} + Romanian Tag = Tag{language: roIndex, locale: roIndex} + Russian Tag = Tag{language: ruIndex, locale: ruIndex} + Sinhala Tag = Tag{language: siIndex, locale: siIndex} + Slovak Tag = Tag{language: skIndex, locale: skIndex} + Slovenian Tag = Tag{language: slIndex, locale: slIndex} + Albanian Tag = Tag{language: sqIndex, locale: sqIndex} + Serbian Tag = Tag{language: srIndex, locale: srIndex} + SerbianLatin Tag = Tag{language: srLatnIndex, locale: srLatnIndex} + Swedish Tag = Tag{language: svIndex, locale: svIndex} + Swahili Tag = Tag{language: swIndex, locale: swIndex} + Tamil Tag = Tag{language: taIndex, locale: taIndex} + Telugu Tag = Tag{language: teIndex, locale: teIndex} + Thai Tag = Tag{language: thIndex, locale: thIndex} + Turkish Tag = Tag{language: trIndex, locale: trIndex} + Ukrainian Tag = Tag{language: ukIndex, locale: ukIndex} + Urdu Tag = Tag{language: urIndex, locale: urIndex} + Uzbek Tag = Tag{language: uzIndex, locale: uzIndex} + Vietnamese Tag = Tag{language: viIndex, locale: viIndex} + Chinese Tag = Tag{language: zhIndex, locale: zhIndex} + SimplifiedChinese Tag = Tag{language: zhHansIndex, locale: zhHansIndex} + TraditionalChinese Tag = Tag{language: zhHantIndex, locale: zhHantIndex} + Zulu Tag = Tag{language: zuIndex, locale: zuIndex} +) diff --git a/vendor/golang.org/x/text/internal/language/compose.go b/vendor/golang.org/x/text/internal/language/compose.go new file mode 100644 index 0000000000..4ae78e0fa5 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/compose.go @@ -0,0 +1,167 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "sort" + "strings" +) + +// A Builder allows constructing a Tag from individual components. +// Its main user is Compose in the top-level language package. +type Builder struct { + Tag Tag + + private string // the x extension + variants []string + extensions []string +} + +// Make returns a new Tag from the current settings. +func (b *Builder) Make() Tag { + t := b.Tag + + if len(b.extensions) > 0 || len(b.variants) > 0 { + sort.Sort(sortVariants(b.variants)) + sort.Strings(b.extensions) + + if b.private != "" { + b.extensions = append(b.extensions, b.private) + } + n := maxCoreSize + tokenLen(b.variants...) + tokenLen(b.extensions...) + buf := make([]byte, n) + p := t.genCoreBytes(buf) + t.pVariant = byte(p) + p += appendTokens(buf[p:], b.variants...) + t.pExt = uint16(p) + p += appendTokens(buf[p:], b.extensions...) + t.str = string(buf[:p]) + // We may not always need to remake the string, but when or when not + // to do so is rather tricky. + scan := makeScanner(buf[:p]) + t, _ = parse(&scan, "") + return t + + } else if b.private != "" { + t.str = b.private + t.RemakeString() + } + return t +} + +// SetTag copies all the settings from a given Tag. Any previously set values +// are discarded. +func (b *Builder) SetTag(t Tag) { + b.Tag.LangID = t.LangID + b.Tag.RegionID = t.RegionID + b.Tag.ScriptID = t.ScriptID + // TODO: optimize + b.variants = b.variants[:0] + if variants := t.Variants(); variants != "" { + for _, vr := range strings.Split(variants[1:], "-") { + b.variants = append(b.variants, vr) + } + } + b.extensions, b.private = b.extensions[:0], "" + for _, e := range t.Extensions() { + b.AddExt(e) + } +} + +// AddExt adds extension e to the tag. e must be a valid extension as returned +// by Tag.Extension. If the extension already exists, it will be discarded, +// except for a -u extension, where non-existing key-type pairs will added. +func (b *Builder) AddExt(e string) { + if e[0] == 'x' { + if b.private == "" { + b.private = e + } + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] += e[1:] + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// SetExt sets the extension e to the tag. e must be a valid extension as +// returned by Tag.Extension. If the extension already exists, it will be +// overwritten, except for a -u extension, where the individual key-type pairs +// will be set. +func (b *Builder) SetExt(e string) { + if e[0] == 'x' { + b.private = e + return + } + for i, s := range b.extensions { + if s[0] == e[0] { + if e[0] == 'u' { + b.extensions[i] = e + s[1:] + } else { + b.extensions[i] = e + } + return + } + } + b.extensions = append(b.extensions, e) +} + +// AddVariant adds any number of variants. +func (b *Builder) AddVariant(v ...string) { + for _, v := range v { + if v != "" { + b.variants = append(b.variants, v) + } + } +} + +// ClearVariants removes any variants previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearVariants() { + b.variants = b.variants[:0] +} + +// ClearExtensions removes any extensions previously added, including those +// copied from a Tag in SetTag. +func (b *Builder) ClearExtensions() { + b.private = "" + b.extensions = b.extensions[:0] +} + +func tokenLen(token ...string) (n int) { + for _, t := range token { + n += len(t) + 1 + } + return +} + +func appendTokens(b []byte, token ...string) int { + p := 0 + for _, t := range token { + b[p] = '-' + copy(b[p+1:], t) + p += 1 + len(t) + } + return p +} + +type sortVariants []string + +func (s sortVariants) Len() int { + return len(s) +} + +func (s sortVariants) Swap(i, j int) { + s[j], s[i] = s[i], s[j] +} + +func (s sortVariants) Less(i, j int) bool { + return variantIndex[s[i]] < variantIndex[s[j]] +} diff --git a/vendor/golang.org/x/text/internal/language/coverage.go b/vendor/golang.org/x/text/internal/language/coverage.go new file mode 100644 index 0000000000..9b20b88feb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/coverage.go @@ -0,0 +1,28 @@ +// Copyright 2014 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// BaseLanguages returns the list of all supported base languages. It generates +// the list by traversing the internal structures. +func BaseLanguages() []Language { + base := make([]Language, 0, NumLanguages) + for i := 0; i < langNoIndexOffset; i++ { + // We included "und" already for the value 0. + if i != nonCanonicalUnd { + base = append(base, Language(i)) + } + } + i := langNoIndexOffset + for _, v := range langNoIndex { + for k := 0; k < 8; k++ { + if v&1 == 1 { + base = append(base, Language(i)) + } + v >>= 1 + i++ + } + } + return base +} diff --git a/vendor/golang.org/x/text/internal/language/gen.go b/vendor/golang.org/x/text/internal/language/gen.go new file mode 100644 index 0000000000..cdcc7febcb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/gen.go @@ -0,0 +1,1520 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +// Language tag table generator. +// Data read from the web. + +package main + +import ( + "bufio" + "flag" + "fmt" + "io" + "io/ioutil" + "log" + "math" + "reflect" + "regexp" + "sort" + "strconv" + "strings" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/tag" + "golang.org/x/text/unicode/cldr" +) + +var ( + test = flag.Bool("test", + false, + "test existing tables; can be used to compare web data with package data.") + outputFile = flag.String("output", + "tables.go", + "output file for generated tables") +) + +var comment = []string{ + ` +lang holds an alphabetically sorted list of ISO-639 language identifiers. +All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +For 2-byte language identifiers, the two successive bytes have the following meaning: + - if the first letter of the 2- and 3-letter ISO codes are the same: + the second and third letter of the 3-letter ISO code. + - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +For 3-byte language identifiers the 4th byte is 0.`, + ` +langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +in lookup tables. The language ids for these language codes are derived directly +from the letters and are not consecutive.`, + ` +altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +to 2-letter language codes that cannot be derived using the method described above. +Each 3-letter code is followed by its 1-byte langID.`, + ` +altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, + ` +AliasMap maps langIDs to their suggested replacements.`, + ` +script is an alphabetically sorted list of ISO 15924 codes. The index +of the script in the string, divided by 4, is the internal scriptID.`, + ` +isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +the UN.M49 codes used for groups.)`, + ` +regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +Each 2-letter codes is followed by two bytes with the following meaning: + - [A-Z}{2}: the first letter of the 2-letter code plus these two + letters form the 3-letter ISO code. + - 0, n: index into altRegionISO3.`, + ` +regionTypes defines the status of a region for various standards.`, + ` +m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +codes indicating collections of regions.`, + ` +m49Index gives indexes into fromM49 based on the three most significant bits +of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in + fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +The region code is stored in the 9 lsb of the indexed value.`, + ` +fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, + ` +altRegionISO3 holds a list of 3-letter region codes that cannot be +mapped to 2-letter codes using the default algorithm. This is a short list.`, + ` +altRegionIDs holds a list of regionIDs the positions of which match those +of the 3-letter ISO codes in altRegionISO3.`, + ` +variantNumSpecialized is the number of specialized variants in variants.`, + ` +suppressScript is an index from langID to the dominant script for that language, +if it exists. If a script is given, it should be suppressed from the language tag.`, + ` +likelyLang is a lookup table, indexed by langID, for the most likely +scripts and regions given incomplete information. If more entries exist for a +given language, region and script are the index and size respectively +of the list in likelyLangList.`, + ` +likelyLangList holds lists info associated with likelyLang.`, + ` +likelyRegion is a lookup table, indexed by regionID, for the most likely +languages and scripts given incomplete information. If more entries exist +for a given regionID, lang and script are the index and size respectively +of the list in likelyRegionList. +TODO: exclude containers and user-definable regions from the list.`, + ` +likelyRegionList holds lists info associated with likelyRegion.`, + ` +likelyScript is a lookup table, indexed by scriptID, for the most likely +languages and regions given a script.`, + ` +nRegionGroups is the number of region groups.`, + ` +regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +where each set holds all groupings that are directly connected in a region +containment graph.`, + ` +regionInclusionBits is an array of bit vectors where every vector represents +a set of region groupings. These sets are used to compute the distance +between two regions for the purpose of language matching.`, + ` +regionInclusionNext marks, for each entry in regionInclusionBits, the set of +all groups that are reachable from the groups set in the respective entry.`, +} + +// TODO: consider changing some of these structures to tries. This can reduce +// memory, but may increase the need for memory allocations. This could be +// mitigated if we can piggyback on language tags for common cases. + +func failOnError(e error) { + if e != nil { + log.Panic(e) + } +} + +type setType int + +const ( + Indexed setType = 1 + iota // all elements must be of same size + Linear +) + +type stringSet struct { + s []string + sorted, frozen bool + + // We often need to update values after the creation of an index is completed. + // We include a convenience map for keeping track of this. + update map[string]string + typ setType // used for checking. +} + +func (ss *stringSet) clone() stringSet { + c := *ss + c.s = append([]string(nil), c.s...) + return c +} + +func (ss *stringSet) setType(t setType) { + if ss.typ != t && ss.typ != 0 { + log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) + } +} + +// parse parses a whitespace-separated string and initializes ss with its +// components. +func (ss *stringSet) parse(s string) { + scan := bufio.NewScanner(strings.NewReader(s)) + scan.Split(bufio.ScanWords) + for scan.Scan() { + ss.add(scan.Text()) + } +} + +func (ss *stringSet) assertChangeable() { + if ss.frozen { + log.Panic("attempt to modify a frozen stringSet") + } +} + +func (ss *stringSet) add(s string) { + ss.assertChangeable() + ss.s = append(ss.s, s) + ss.sorted = ss.frozen +} + +func (ss *stringSet) freeze() { + ss.compact() + ss.frozen = true +} + +func (ss *stringSet) compact() { + if ss.sorted { + return + } + a := ss.s + sort.Strings(a) + k := 0 + for i := 1; i < len(a); i++ { + if a[k] != a[i] { + a[k+1] = a[i] + k++ + } + } + ss.s = a[:k+1] + ss.sorted = ss.frozen +} + +type funcSorter struct { + fn func(a, b string) bool + sort.StringSlice +} + +func (s funcSorter) Less(i, j int) bool { + return s.fn(s.StringSlice[i], s.StringSlice[j]) +} + +func (ss *stringSet) sortFunc(f func(a, b string) bool) { + ss.compact() + sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) +} + +func (ss *stringSet) remove(s string) { + ss.assertChangeable() + if i, ok := ss.find(s); ok { + copy(ss.s[i:], ss.s[i+1:]) + ss.s = ss.s[:len(ss.s)-1] + } +} + +func (ss *stringSet) replace(ol, nu string) { + ss.s[ss.index(ol)] = nu + ss.sorted = ss.frozen +} + +func (ss *stringSet) index(s string) int { + ss.setType(Indexed) + i, ok := ss.find(s) + if !ok { + if i < len(ss.s) { + log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) + } + log.Panicf("find: item %q is not in list", s) + + } + return i +} + +func (ss *stringSet) find(s string) (int, bool) { + ss.compact() + i := sort.SearchStrings(ss.s, s) + return i, i != len(ss.s) && ss.s[i] == s +} + +func (ss *stringSet) slice() []string { + ss.compact() + return ss.s +} + +func (ss *stringSet) updateLater(v, key string) { + if ss.update == nil { + ss.update = map[string]string{} + } + ss.update[v] = key +} + +// join joins the string and ensures that all entries are of the same length. +func (ss *stringSet) join() string { + ss.setType(Indexed) + n := len(ss.s[0]) + for _, s := range ss.s { + if len(s) != n { + log.Panicf("join: not all entries are of the same length: %q", s) + } + } + ss.s = append(ss.s, strings.Repeat("\xff", n)) + return strings.Join(ss.s, "") +} + +// ianaEntry holds information for an entry in the IANA Language Subtag Repository. +// All types use the same entry. +// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various +// fields. +type ianaEntry struct { + typ string + description []string + scope string + added string + preferred string + deprecated string + suppressScript string + macro string + prefix []string +} + +type builder struct { + w *gen.CodeWriter + hw io.Writer // MultiWriter for w and w.Hash + data *cldr.CLDR + supp *cldr.SupplementalData + + // indices + locale stringSet // common locales + lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data + langNoIndex stringSet // 3-letter ISO codes with no associated data + script stringSet // 4-letter ISO codes + region stringSet // 2-letter ISO or 3-digit UN M49 codes + variant stringSet // 4-8-alphanumeric variant code. + + // Region codes that are groups with their corresponding group IDs. + groups map[int]index + + // langInfo + registry map[string]*ianaEntry +} + +type index uint + +func newBuilder(w *gen.CodeWriter) *builder { + r := gen.OpenCLDRCoreZip() + defer r.Close() + d := &cldr.Decoder{} + data, err := d.DecodeZip(r) + failOnError(err) + b := builder{ + w: w, + hw: io.MultiWriter(w, w.Hash), + data: data, + supp: data.Supplemental(), + } + b.parseRegistry() + return &b +} + +func (b *builder) parseRegistry() { + r := gen.OpenIANAFile("assignments/language-subtag-registry") + defer r.Close() + b.registry = make(map[string]*ianaEntry) + + scan := bufio.NewScanner(r) + scan.Split(bufio.ScanWords) + var record *ianaEntry + for more := scan.Scan(); more; { + key := scan.Text() + more = scan.Scan() + value := scan.Text() + switch key { + case "Type:": + record = &ianaEntry{typ: value} + case "Subtag:", "Tag:": + if s := strings.SplitN(value, "..", 2); len(s) > 1 { + for a := s[0]; a <= s[1]; a = inc(a) { + b.addToRegistry(a, record) + } + } else { + b.addToRegistry(value, record) + } + case "Suppress-Script:": + record.suppressScript = value + case "Added:": + record.added = value + case "Deprecated:": + record.deprecated = value + case "Macrolanguage:": + record.macro = value + case "Preferred-Value:": + record.preferred = value + case "Prefix:": + record.prefix = append(record.prefix, value) + case "Scope:": + record.scope = value + case "Description:": + buf := []byte(value) + for more = scan.Scan(); more; more = scan.Scan() { + b := scan.Bytes() + if b[0] == '%' || b[len(b)-1] == ':' { + break + } + buf = append(buf, ' ') + buf = append(buf, b...) + } + record.description = append(record.description, string(buf)) + continue + default: + continue + } + more = scan.Scan() + } + if scan.Err() != nil { + log.Panic(scan.Err()) + } +} + +func (b *builder) addToRegistry(key string, entry *ianaEntry) { + if info, ok := b.registry[key]; ok { + if info.typ != "language" || entry.typ != "extlang" { + log.Fatalf("parseRegistry: tag %q already exists", key) + } + } else { + b.registry[key] = entry + } +} + +var commentIndex = make(map[string]string) + +func init() { + for _, s := range comment { + key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) + commentIndex[key] = s + } +} + +func (b *builder) comment(name string) { + if s := commentIndex[name]; len(s) > 0 { + b.w.WriteComment(s) + } else { + fmt.Fprintln(b.w) + } +} + +func (b *builder) pf(f string, x ...interface{}) { + fmt.Fprintf(b.hw, f, x...) + fmt.Fprint(b.hw, "\n") +} + +func (b *builder) p(x ...interface{}) { + fmt.Fprintln(b.hw, x...) +} + +func (b *builder) addSize(s int) { + b.w.Size += s + b.pf("// Size: %d bytes", s) +} + +func (b *builder) writeConst(name string, x interface{}) { + b.comment(name) + b.w.WriteConst(name, x) +} + +// writeConsts computes f(v) for all v in values and writes the results +// as constants named _v to a single constant block. +func (b *builder) writeConsts(f func(string) int, values ...string) { + b.pf("const (") + for _, v := range values { + b.pf("\t_%s = %v", v, f(v)) + } + b.pf(")") +} + +// writeType writes the type of the given value, which must be a struct. +func (b *builder) writeType(value interface{}) { + b.comment(reflect.TypeOf(value).Name()) + b.w.WriteType(value) +} + +func (b *builder) writeSlice(name string, ss interface{}) { + b.writeSliceAddSize(name, 0, ss) +} + +func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { + b.comment(name) + b.w.Size += extraSize + v := reflect.ValueOf(ss) + t := v.Type().Elem() + b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) + + fmt.Fprintf(b.w, "var %s = ", name) + b.w.WriteArray(ss) + b.p() +} + +type FromTo struct { + From, To uint16 +} + +func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { + ss.sortFunc(func(a, b string) bool { + return index(a) < index(b) + }) + m := []FromTo{} + for _, s := range ss.s { + m = append(m, FromTo{index(s), index(ss.update[s])}) + } + b.writeSlice(name, m) +} + +const base = 'z' - 'a' + 1 + +func strToInt(s string) uint { + v := uint(0) + for i := 0; i < len(s); i++ { + v *= base + v += uint(s[i] - 'a') + } + return v +} + +// converts the given integer to the original ASCII string passed to strToInt. +// len(s) must match the number of characters obtained. +func intToStr(v uint, s []byte) { + for i := len(s) - 1; i >= 0; i-- { + s[i] = byte(v%base) + 'a' + v /= base + } +} + +func (b *builder) writeBitVector(name string, ss []string) { + vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) + for _, s := range ss { + v := strToInt(s) + vec[v/8] |= 1 << (v % 8) + } + b.writeSlice(name, vec) +} + +// TODO: convert this type into a list or two-stage trie. +func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { + b.comment(name) + v := reflect.ValueOf(m) + sz := v.Len() * (2 + int(v.Type().Key().Size())) + for _, k := range m { + sz += len(k) + } + b.addSize(sz) + keys := []string{} + b.pf(`var %s = map[string]uint16{`, name) + for k := range m { + keys = append(keys, k) + } + sort.Strings(keys) + for _, k := range keys { + b.pf("\t%q: %v,", k, f(m[k])) + } + b.p("}") +} + +func (b *builder) writeMap(name string, m interface{}) { + b.comment(name) + v := reflect.ValueOf(m) + sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) + b.addSize(sz) + f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { + return strings.IndexRune("{}, ", r) != -1 + }) + sort.Strings(f[1:]) + b.pf(`var %s = %s{`, name, f[0]) + for _, kv := range f[1:] { + b.pf("\t%s,", kv) + } + b.p("}") +} + +func (b *builder) langIndex(s string) uint16 { + if s == "und" { + return 0 + } + if i, ok := b.lang.find(s); ok { + return uint16(i) + } + return uint16(strToInt(s)) + uint16(len(b.lang.s)) +} + +// inc advances the string to its lexicographical successor. +func inc(s string) string { + const maxTagLength = 4 + var buf [maxTagLength]byte + intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) + for i := 0; i < len(s); i++ { + if s[i] <= 'Z' { + buf[i] -= 'a' - 'A' + } + } + return string(buf[:len(s)]) +} + +func (b *builder) parseIndices() { + meta := b.supp.Metadata + + for k, v := range b.registry { + var ss *stringSet + switch v.typ { + case "language": + if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { + b.lang.add(k) + continue + } else { + ss = &b.langNoIndex + } + case "region": + ss = &b.region + case "script": + ss = &b.script + case "variant": + ss = &b.variant + default: + continue + } + ss.add(k) + } + // Include any language for which there is data. + for _, lang := range b.data.Locales() { + if x := b.data.RawLDML(lang); false || + x.LocaleDisplayNames != nil || + x.Characters != nil || + x.Delimiters != nil || + x.Measurement != nil || + x.Dates != nil || + x.Numbers != nil || + x.Units != nil || + x.ListPatterns != nil || + x.Collations != nil || + x.Segmentations != nil || + x.Rbnf != nil || + x.Annotations != nil || + x.Metadata != nil { + + from := strings.Split(lang, "_") + if lang := from[0]; lang != "root" { + b.lang.add(lang) + } + } + } + // Include locales for plural rules, which uses a different structure. + for _, plurals := range b.data.Supplemental().Plurals { + for _, rules := range plurals.PluralRules { + for _, lang := range strings.Split(rules.Locales, " ") { + if lang = strings.Split(lang, "_")[0]; lang != "root" { + b.lang.add(lang) + } + } + } + } + // Include languages in likely subtags. + for _, m := range b.supp.LikelySubtags.LikelySubtag { + from := strings.Split(m.From, "_") + b.lang.add(from[0]) + } + // Include ISO-639 alpha-3 bibliographic entries. + for _, a := range meta.Alias.LanguageAlias { + if a.Reason == "bibliographic" { + b.langNoIndex.add(a.Type) + } + } + // Include regions in territoryAlias (not all are in the IANA registry!) + for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { + if len(reg.Type) == 2 { + b.region.add(reg.Type) + } + } + + for _, s := range b.lang.s { + if len(s) == 3 { + b.langNoIndex.remove(s) + } + } + b.writeConst("NumLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) + b.writeConst("NumScripts", len(b.script.slice())) + b.writeConst("NumRegions", len(b.region.slice())) + + // Add dummy codes at the start of each list to represent "unspecified". + b.lang.add("---") + b.script.add("----") + b.region.add("---") + + // common locales + b.locale.parse(meta.DefaultContent.Locales) +} + +// TODO: region inclusion data will probably not be use used in future matchers. + +func (b *builder) computeRegionGroups() { + b.groups = make(map[int]index) + + // Create group indices. + for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. + b.groups[i] = index(len(b.groups)) + } + for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } + group := b.region.index(g.Type) + if _, ok := b.groups[group]; !ok { + b.groups[group] = index(len(b.groups)) + } + } + if len(b.groups) > 64 { + log.Fatalf("only 64 groups supported, found %d", len(b.groups)) + } + b.writeConst("nRegionGroups", len(b.groups)) +} + +var langConsts = []string{ + "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", + "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", + "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", + "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", + "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", + "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", + + // constants for grandfathered tags (if not already defined) + "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", + "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", +} + +// writeLanguage generates all tables needed for language canonicalization. +func (b *builder) writeLanguage() { + meta := b.supp.Metadata + + b.writeConst("nonCanonicalUnd", b.lang.index("und")) + b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) + b.writeConst("langPrivateStart", b.langIndex("qaa")) + b.writeConst("langPrivateEnd", b.langIndex("qtz")) + + // Get language codes that need to be mapped (overlong 3-letter codes, + // deprecated 2-letter codes, legacy and grandfathered tags.) + langAliasMap := stringSet{} + aliasTypeMap := map[string]AliasType{} + + // altLangISO3 get the alternative ISO3 names that need to be mapped. + altLangISO3 := stringSet{} + // Add dummy start to avoid the use of index 0. + altLangISO3.add("---") + altLangISO3.updateLater("---", "aa") + + lang := b.lang.clone() + for _, a := range meta.Alias.LanguageAlias { + if a.Replacement == "" { + a.Replacement = "und" + } + // TODO: support mapping to tags + repl := strings.SplitN(a.Replacement, "_", 2)[0] + if a.Reason == "overlong" { + if len(a.Replacement) == 2 && len(a.Type) == 3 { + lang.updateLater(a.Replacement, a.Type) + } + } else if len(a.Type) <= 3 { + switch a.Reason { + case "macrolanguage": + aliasTypeMap[a.Type] = Macro + case "deprecated": + // handled elsewhere + continue + case "bibliographic", "legacy": + if a.Type == "no" { + continue + } + aliasTypeMap[a.Type] = Legacy + default: + log.Fatalf("new %s alias: %s", a.Reason, a.Type) + } + langAliasMap.add(a.Type) + langAliasMap.updateLater(a.Type, repl) + } + } + // Manually add the mapping of "nb" (Norwegian) to its macro language. + // This can be removed if CLDR adopts this change. + langAliasMap.add("nb") + langAliasMap.updateLater("nb", "no") + aliasTypeMap["nb"] = Macro + + for k, v := range b.registry { + // Also add deprecated values for 3-letter ISO codes, which CLDR omits. + if v.typ == "language" && v.deprecated != "" && v.preferred != "" { + langAliasMap.add(k) + langAliasMap.updateLater(k, v.preferred) + aliasTypeMap[k] = Deprecated + } + } + // Fix CLDR mappings. + lang.updateLater("tl", "tgl") + lang.updateLater("sh", "hbs") + lang.updateLater("mo", "mol") + lang.updateLater("no", "nor") + lang.updateLater("tw", "twi") + lang.updateLater("nb", "nob") + lang.updateLater("ak", "aka") + lang.updateLater("bh", "bih") + + // Ensure that each 2-letter code is matched with a 3-letter code. + for _, v := range lang.s[1:] { + s, ok := lang.update[v] + if !ok { + if s, ok = lang.update[langAliasMap.update[v]]; !ok { + continue + } + lang.update[v] = s + } + if v[0] != s[0] { + altLangISO3.add(s) + altLangISO3.updateLater(s, v) + } + } + + // Complete canonicalized language tags. + lang.freeze() + for i, v := range lang.s { + // We can avoid these manual entries by using the IANA registry directly. + // Seems easier to update the list manually, as changes are rare. + // The panic in this loop will trigger if we miss an entry. + add := "" + if s, ok := lang.update[v]; ok { + if s[0] == v[0] { + add = s[1:] + } else { + add = string([]byte{0, byte(altLangISO3.index(s))}) + } + } else if len(v) == 3 { + add = "\x00" + } else { + log.Panicf("no data for long form of %q", v) + } + lang.s[i] += add + } + b.writeConst("lang", tag.Index(lang.join())) + + b.writeConst("langNoIndexOffset", len(b.lang.s)) + + // space of all valid 3-letter language identifiers. + b.writeBitVector("langNoIndex", b.langNoIndex.slice()) + + altLangIndex := []uint16{} + for i, s := range altLangISO3.slice() { + altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) + if i > 0 { + idx := b.lang.index(altLangISO3.update[s]) + altLangIndex = append(altLangIndex, uint16(idx)) + } + } + b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) + b.writeSlice("altLangIndex", altLangIndex) + + b.writeSortedMap("AliasMap", &langAliasMap, b.langIndex) + types := make([]AliasType, len(langAliasMap.s)) + for i, s := range langAliasMap.s { + types[i] = aliasTypeMap[s] + } + b.writeSlice("AliasTypes", types) +} + +var scriptConsts = []string{ + "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy", + "Zzzz", +} + +func (b *builder) writeScript() { + b.writeConsts(b.script.index, scriptConsts...) + b.writeConst("script", tag.Index(b.script.join())) + + supp := make([]uint8, len(b.lang.slice())) + for i, v := range b.lang.slice()[1:] { + if sc := b.registry[v].suppressScript; sc != "" { + supp[i+1] = uint8(b.script.index(sc)) + } + } + b.writeSlice("suppressScript", supp) + + // There is only one deprecated script in CLDR. This value is hard-coded. + // We check here if the code must be updated. + for _, a := range b.supp.Metadata.Alias.ScriptAlias { + if a.Type != "Qaai" { + log.Panicf("unexpected deprecated stript %q", a.Type) + } + } +} + +func parseM49(s string) int16 { + if len(s) == 0 { + return 0 + } + v, err := strconv.ParseUint(s, 10, 10) + failOnError(err) + return int16(v) +} + +var regionConsts = []string{ + "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", + "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. +} + +func (b *builder) writeRegion() { + b.writeConsts(b.region.index, regionConsts...) + + isoOffset := b.region.index("AA") + m49map := make([]int16, len(b.region.slice())) + fromM49map := make(map[int16]int) + altRegionISO3 := "" + altRegionIDs := []uint16{} + + b.writeConst("isoRegionOffset", isoOffset) + + // 2-letter region lookup and mapping to numeric codes. + regionISO := b.region.clone() + regionISO.s = regionISO.s[isoOffset:] + regionISO.sorted = false + + regionTypes := make([]byte, len(b.region.s)) + + // Is the region valid BCP 47? + for s, e := range b.registry { + if len(s) == 2 && s == strings.ToUpper(s) { + i := b.region.index(s) + for _, d := range e.description { + if strings.Contains(d, "Private use") { + regionTypes[i] = iso3166UserAssigned + } + } + regionTypes[i] |= bcp47Region + } + } + + // Is the region a valid ccTLD? + r := gen.OpenIANAFile("domains/root/db") + defer r.Close() + + buf, err := ioutil.ReadAll(r) + failOnError(err) + re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) + for _, m := range re.FindAllSubmatch(buf, -1) { + i := b.region.index(strings.ToUpper(string(m[1]))) + regionTypes[i] |= ccTLD + } + + b.writeSlice("regionTypes", regionTypes) + + iso3Set := make(map[string]int) + update := func(iso2, iso3 string) { + i := regionISO.index(iso2) + if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { + regionISO.s[i] += iso3[1:] + iso3Set[iso3] = -1 + } else { + if ok && j >= 0 { + regionISO.s[i] += string([]byte{0, byte(j)}) + } else { + iso3Set[iso3] = len(altRegionISO3) + regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) + altRegionISO3 += iso3 + altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) + } + } + } + for _, tc := range b.supp.CodeMappings.TerritoryCodes { + i := regionISO.index(tc.Type) + isoOffset + if d := m49map[i]; d != 0 { + log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) + } + m49 := parseM49(tc.Numeric) + m49map[i] = m49 + if r := fromM49map[m49]; r == 0 { + fromM49map[m49] = i + } else if r != i { + dep := b.registry[regionISO.s[r-isoOffset]].deprecated + if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { + fromM49map[m49] = i + } + } + } + for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { + if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { + from := parseM49(ta.Type) + if r := fromM49map[from]; r == 0 { + fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset + } + } + } + for _, tc := range b.supp.CodeMappings.TerritoryCodes { + if len(tc.Alpha3) == 3 { + update(tc.Type, tc.Alpha3) + } + } + // This entries are not included in territoryCodes. Mostly 3-letter variants + // of deleted codes and an entry for QU. + for _, m := range []struct{ iso2, iso3 string }{ + {"CT", "CTE"}, + {"DY", "DHY"}, + {"HV", "HVO"}, + {"JT", "JTN"}, + {"MI", "MID"}, + {"NH", "NHB"}, + {"NQ", "ATN"}, + {"PC", "PCI"}, + {"PU", "PUS"}, + {"PZ", "PCZ"}, + {"RH", "RHO"}, + {"VD", "VDR"}, + {"WK", "WAK"}, + // These three-letter codes are used for others as well. + {"FQ", "ATF"}, + } { + update(m.iso2, m.iso3) + } + for i, s := range regionISO.s { + if len(s) != 4 { + regionISO.s[i] = s + " " + } + } + b.writeConst("regionISO", tag.Index(regionISO.join())) + b.writeConst("altRegionISO3", altRegionISO3) + b.writeSlice("altRegionIDs", altRegionIDs) + + // Create list of deprecated regions. + // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only + // Transitionally-reserved mapping not included. + regionOldMap := stringSet{} + // Include regions in territoryAlias (not all are in the IANA registry!) + for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { + if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { + regionOldMap.add(reg.Type) + regionOldMap.updateLater(reg.Type, reg.Replacement) + i, _ := regionISO.find(reg.Type) + j, _ := regionISO.find(reg.Replacement) + if k := m49map[i+isoOffset]; k == 0 { + m49map[i+isoOffset] = m49map[j+isoOffset] + } + } + } + b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { + return uint16(b.region.index(s)) + }) + // 3-digit region lookup, groupings. + for i := 1; i < isoOffset; i++ { + m := parseM49(b.region.s[i]) + m49map[i] = m + fromM49map[m] = i + } + b.writeSlice("m49", m49map) + + const ( + searchBits = 7 + regionBits = 9 + ) + if len(m49map) >= 1<<regionBits { + log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits) + } + m49Index := [9]int16{} + fromM49 := []uint16{} + m49 := []int{} + for k, _ := range fromM49map { + m49 = append(m49, int(k)) + } + sort.Ints(m49) + for _, k := range m49[1:] { + val := (k & (1<<searchBits - 1)) << regionBits + fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)])) + m49Index[1:][k>>searchBits] = int16(len(fromM49)) + } + b.writeSlice("m49Index", m49Index) + b.writeSlice("fromM49", fromM49) +} + +const ( + // TODO: put these lists in regionTypes as user data? Could be used for + // various optimizations and refinements and could be exposed in the API. + iso3166Except = "AC CP DG EA EU FX IC SU TA UK" + iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. + // DY and RH are actually not deleted, but indeterminately reserved. + iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" +) + +const ( + iso3166UserAssigned = 1 << iota + ccTLD + bcp47Region +) + +func find(list []string, s string) int { + for i, t := range list { + if t == s { + return i + } + } + return -1 +} + +// writeVariants generates per-variant information and creates a map from variant +// name to index value. We assign index values such that sorting multiple +// variants by index value will result in the correct order. +// There are two types of variants: specialized and general. Specialized variants +// are only applicable to certain language or language-script pairs. Generalized +// variants apply to any language. Generalized variants always sort after +// specialized variants. We will therefore always assign a higher index value +// to a generalized variant than any other variant. Generalized variants are +// sorted alphabetically among themselves. +// Specialized variants may also sort after other specialized variants. Such +// variants will be ordered after any of the variants they may follow. +// We assume that if a variant x is followed by a variant y, then for any prefix +// p of x, p-x is a prefix of y. This allows us to order tags based on the +// maximum of the length of any of its prefixes. +// TODO: it is possible to define a set of Prefix values on variants such that +// a total order cannot be defined to the point that this algorithm breaks. +// In other words, we cannot guarantee the same order of variants for the +// future using the same algorithm or for non-compliant combinations of +// variants. For this reason, consider using simple alphabetic sorting +// of variants and ignore Prefix restrictions altogether. +func (b *builder) writeVariant() { + generalized := stringSet{} + specialized := stringSet{} + specializedExtend := stringSet{} + // Collate the variants by type and check assumptions. + for _, v := range b.variant.slice() { + e := b.registry[v] + if len(e.prefix) == 0 { + generalized.add(v) + continue + } + c := strings.Split(e.prefix[0], "-") + hasScriptOrRegion := false + if len(c) > 1 { + _, hasScriptOrRegion = b.script.find(c[1]) + if !hasScriptOrRegion { + _, hasScriptOrRegion = b.region.find(c[1]) + + } + } + if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { + // Variant is preceded by a language. + specialized.add(v) + continue + } + // Variant is preceded by another variant. + specializedExtend.add(v) + prefix := c[0] + "-" + if hasScriptOrRegion { + prefix += c[1] + } + for _, p := range e.prefix { + // Verify that the prefix minus the last element is a prefix of the + // predecessor element. + i := strings.LastIndex(p, "-") + pred := b.registry[p[i+1:]] + if find(pred.prefix, p[:i]) < 0 { + log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) + } + // The sorting used below does not work in the general case. It works + // if we assume that variants that may be followed by others only have + // prefixes of the same length. Verify this. + count := strings.Count(p[:i], "-") + for _, q := range pred.prefix { + if c := strings.Count(q, "-"); c != count { + log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) + } + } + if !strings.HasPrefix(p, prefix) { + log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) + } + } + } + + // Sort extended variants. + a := specializedExtend.s + less := func(v, w string) bool { + // Sort by the maximum number of elements. + maxCount := func(s string) (max int) { + for _, p := range b.registry[s].prefix { + if c := strings.Count(p, "-"); c > max { + max = c + } + } + return + } + if cv, cw := maxCount(v), maxCount(w); cv != cw { + return cv < cw + } + // Sort by name as tie breaker. + return v < w + } + sort.Sort(funcSorter{less, sort.StringSlice(a)}) + specializedExtend.frozen = true + + // Create index from variant name to index. + variantIndex := make(map[string]uint8) + add := func(s []string) { + for _, v := range s { + variantIndex[v] = uint8(len(variantIndex)) + } + } + add(specialized.slice()) + add(specializedExtend.s) + numSpecialized := len(variantIndex) + add(generalized.slice()) + if n := len(variantIndex); n > 255 { + log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) + } + b.writeMap("variantIndex", variantIndex) + b.writeConst("variantNumSpecialized", numSpecialized) +} + +func (b *builder) writeLanguageInfo() { +} + +// writeLikelyData writes tables that are used both for finding parent relations and for +// language matching. Each entry contains additional bits to indicate the status of the +// data to know when it cannot be used for parent relations. +func (b *builder) writeLikelyData() { + const ( + isList = 1 << iota + scriptInFrom + regionInFrom + ) + type ( // generated types + likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 + } + likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 + } + likelyLangRegion struct { + lang uint16 + region uint16 + } + // likelyTag is used for getting likely tags for group regions, where + // the likely region might be a region contained in the group. + likelyTag struct { + lang uint16 + region uint16 + script uint8 + } + ) + var ( // generated variables + likelyRegionGroup = make([]likelyTag, len(b.groups)) + likelyLang = make([]likelyScriptRegion, len(b.lang.s)) + likelyRegion = make([]likelyLangScript, len(b.region.s)) + likelyScript = make([]likelyLangRegion, len(b.script.s)) + likelyLangList = []likelyScriptRegion{} + likelyRegionList = []likelyLangScript{} + ) + type fromTo struct { + from, to []string + } + langToOther := map[int][]fromTo{} + regionToOther := map[int][]fromTo{} + for _, m := range b.supp.LikelySubtags.LikelySubtag { + from := strings.Split(m.From, "_") + to := strings.Split(m.To, "_") + if len(to) != 3 { + log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) + } + if len(from) > 3 { + log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) + } + if from[0] != to[0] && from[0] != "und" { + log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) + } + if len(from) == 3 { + if from[2] != to[2] { + log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) + } + if from[0] != "und" { + log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) + } + } + if len(from) == 1 || from[0] != "und" { + id := 0 + if from[0] != "und" { + id = b.lang.index(from[0]) + } + langToOther[id] = append(langToOther[id], fromTo{from, to}) + } else if len(from) == 2 && len(from[1]) == 4 { + sid := b.script.index(from[1]) + likelyScript[sid].lang = uint16(b.langIndex(to[0])) + likelyScript[sid].region = uint16(b.region.index(to[2])) + } else { + r := b.region.index(from[len(from)-1]) + if id, ok := b.groups[r]; ok { + if from[0] != "und" { + log.Fatalf("region changed unexpectedly: %s -> %s", from, to) + } + likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) + likelyRegionGroup[id].script = uint8(b.script.index(to[1])) + likelyRegionGroup[id].region = uint16(b.region.index(to[2])) + } else { + regionToOther[r] = append(regionToOther[r], fromTo{from, to}) + } + } + } + b.writeType(likelyLangRegion{}) + b.writeSlice("likelyScript", likelyScript) + + for id := range b.lang.s { + list := langToOther[id] + if len(list) == 1 { + likelyLang[id].region = uint16(b.region.index(list[0].to[2])) + likelyLang[id].script = uint8(b.script.index(list[0].to[1])) + } else if len(list) > 1 { + likelyLang[id].flags = isList + likelyLang[id].region = uint16(len(likelyLangList)) + likelyLang[id].script = uint8(len(list)) + for _, x := range list { + flags := uint8(0) + if len(x.from) > 1 { + if x.from[1] == x.to[2] { + flags = regionInFrom + } else { + flags = scriptInFrom + } + } + likelyLangList = append(likelyLangList, likelyScriptRegion{ + region: uint16(b.region.index(x.to[2])), + script: uint8(b.script.index(x.to[1])), + flags: flags, + }) + } + } + } + // TODO: merge suppressScript data with this table. + b.writeType(likelyScriptRegion{}) + b.writeSlice("likelyLang", likelyLang) + b.writeSlice("likelyLangList", likelyLangList) + + for id := range b.region.s { + list := regionToOther[id] + if len(list) == 1 { + likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) + likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) + if len(list[0].from) > 2 { + likelyRegion[id].flags = scriptInFrom + } + } else if len(list) > 1 { + likelyRegion[id].flags = isList + likelyRegion[id].lang = uint16(len(likelyRegionList)) + likelyRegion[id].script = uint8(len(list)) + for i, x := range list { + if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { + log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) + } + x := likelyLangScript{ + lang: uint16(b.langIndex(x.to[0])), + script: uint8(b.script.index(x.to[1])), + } + if len(list[0].from) > 2 { + x.flags = scriptInFrom + } + likelyRegionList = append(likelyRegionList, x) + } + } + } + b.writeType(likelyLangScript{}) + b.writeSlice("likelyRegion", likelyRegion) + b.writeSlice("likelyRegionList", likelyRegionList) + + b.writeType(likelyTag{}) + b.writeSlice("likelyRegionGroup", likelyRegionGroup) +} + +func (b *builder) writeRegionInclusionData() { + var ( + // mm holds for each group the set of groups with a distance of 1. + mm = make(map[int][]index) + + // containment holds for each group the transitive closure of + // containment of other groups. + containment = make(map[index][]index) + ) + for _, g := range b.supp.TerritoryContainment.Group { + // Skip UN and EURO zone as they are flattening the containment + // relationship. + if g.Type == "EZ" || g.Type == "UN" { + continue + } + group := b.region.index(g.Type) + groupIdx := b.groups[group] + for _, mem := range strings.Split(g.Contains, " ") { + r := b.region.index(mem) + mm[r] = append(mm[r], groupIdx) + if g, ok := b.groups[r]; ok { + mm[group] = append(mm[group], g) + containment[groupIdx] = append(containment[groupIdx], g) + } + } + } + + regionContainment := make([]uint64, len(b.groups)) + for _, g := range b.groups { + l := containment[g] + + // Compute the transitive closure of containment. + for i := 0; i < len(l); i++ { + l = append(l, containment[l[i]]...) + } + + // Compute the bitmask. + regionContainment[g] = 1 << g + for _, v := range l { + regionContainment[g] |= 1 << v + } + } + b.writeSlice("regionContainment", regionContainment) + + regionInclusion := make([]uint8, len(b.region.s)) + bvs := make(map[uint64]index) + // Make the first bitvector positions correspond with the groups. + for r, i := range b.groups { + bv := uint64(1 << i) + for _, g := range mm[r] { + bv |= 1 << g + } + bvs[bv] = i + regionInclusion[r] = uint8(bvs[bv]) + } + for r := 1; r < len(b.region.s); r++ { + if _, ok := b.groups[r]; !ok { + bv := uint64(0) + for _, g := range mm[r] { + bv |= 1 << g + } + if bv == 0 { + // Pick the world for unspecified regions. + bv = 1 << b.groups[b.region.index("001")] + } + if _, ok := bvs[bv]; !ok { + bvs[bv] = index(len(bvs)) + } + regionInclusion[r] = uint8(bvs[bv]) + } + } + b.writeSlice("regionInclusion", regionInclusion) + regionInclusionBits := make([]uint64, len(bvs)) + for k, v := range bvs { + regionInclusionBits[v] = uint64(k) + } + // Add bit vectors for increasingly large distances until a fixed point is reached. + regionInclusionNext := []uint8{} + for i := 0; i < len(regionInclusionBits); i++ { + bits := regionInclusionBits[i] + next := bits + for i := uint(0); i < uint(len(b.groups)); i++ { + if bits&(1<<i) != 0 { + next |= regionInclusionBits[i] + } + } + if _, ok := bvs[next]; !ok { + bvs[next] = index(len(bvs)) + regionInclusionBits = append(regionInclusionBits, next) + } + regionInclusionNext = append(regionInclusionNext, uint8(bvs[next])) + } + b.writeSlice("regionInclusionBits", regionInclusionBits) + b.writeSlice("regionInclusionNext", regionInclusionNext) +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +func (b *builder) writeParents() { + b.writeType(parentRel{}) + + parents := []parentRel{} + + // Construct parent overrides. + n := 0 + for _, p := range b.data.Supplemental().ParentLocales.ParentLocale { + // Skipping non-standard scripts to root is implemented using addTags. + if p.Parent == "root" { + continue + } + + sub := strings.Split(p.Parent, "_") + parent := parentRel{lang: b.langIndex(sub[0])} + if len(sub) == 2 { + // TODO: check that all undefined scripts are indeed Latn in these + // cases. + parent.maxScript = uint8(b.script.index("Latn")) + parent.toRegion = uint16(b.region.index(sub[1])) + } else { + parent.script = uint8(b.script.index(sub[1])) + parent.maxScript = parent.script + parent.toRegion = uint16(b.region.index(sub[2])) + } + for _, c := range strings.Split(p.Locales, " ") { + region := b.region.index(c[strings.LastIndex(c, "_")+1:]) + parent.fromRegion = append(parent.fromRegion, uint16(region)) + } + parents = append(parents, parent) + n += len(parent.fromRegion) + } + b.writeSliceAddSize("parents", n*2, parents) +} + +func main() { + gen.Init() + + gen.Repackage("gen_common.go", "common.go", "language") + + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "language") + + fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`) + + b := newBuilder(w) + gen.WriteCLDRVersion(w) + + b.parseIndices() + b.writeType(FromTo{}) + b.writeLanguage() + b.writeScript() + b.writeRegion() + b.writeVariant() + // TODO: b.writeLocale() + b.computeRegionGroups() + b.writeLikelyData() + b.writeRegionInclusionData() + b.writeParents() +} diff --git a/vendor/golang.org/x/text/language/gen_common.go b/vendor/golang.org/x/text/internal/language/gen_common.go index 83ce180133..c419ceeb19 100644 --- a/vendor/golang.org/x/text/language/gen_common.go +++ b/vendor/golang.org/x/text/internal/language/gen_common.go @@ -8,13 +8,13 @@ package main // This file contains code common to the maketables.go and the package code. -// langAliasType is the type of an alias in langAliasMap. -type langAliasType int8 +// AliasType is the type of an alias in AliasMap. +type AliasType int8 const ( - langDeprecated langAliasType = iota - langMacro - langLegacy + Deprecated AliasType = iota + Macro + Legacy - langAliasTypeUnknown langAliasType = -1 + AliasTypeUnknown AliasType = -1 ) diff --git a/vendor/golang.org/x/text/internal/language/language.go b/vendor/golang.org/x/text/internal/language/language.go new file mode 100644 index 0000000000..1e74d1affd --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/language.go @@ -0,0 +1,596 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_common.go -output tables.go + +package language // import "golang.org/x/text/internal/language" + +// TODO: Remove above NOTE after: +// - verifying that tables are dropped correctly (most notably matcher tables). + +import ( + "errors" + "fmt" + "strings" +) + +const ( + // maxCoreSize is the maximum size of a BCP 47 tag without variants and + // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. + maxCoreSize = 12 + + // max99thPercentileSize is a somewhat arbitrary buffer size that presumably + // is large enough to hold at least 99% of the BCP 47 tags. + max99thPercentileSize = 32 + + // maxSimpleUExtensionSize is the maximum size of a -u extension with one + // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). + maxSimpleUExtensionSize = 14 +) + +// Tag represents a BCP 47 language tag. It is used to specify an instance of a +// specific language or locale. All language tag values are guaranteed to be +// well-formed. The zero value of Tag is Und. +type Tag struct { + // TODO: the following fields have the form TagTypeID. This name is chosen + // to allow refactoring the public package without conflicting with its + // Base, Script, and Region methods. Once the transition is fully completed + // the ID can be stripped from the name. + + LangID Language + RegionID Region + // TODO: we will soon run out of positions for ScriptID. Idea: instead of + // storing lang, region, and ScriptID codes, store only the compact index and + // have a lookup table from this code to its expansion. This greatly speeds + // up table lookup, speed up common variant cases. + // This will also immediately free up 3 extra bytes. Also, the pVariant + // field can now be moved to the lookup table, as the compact index uniquely + // determines the offset of a possible variant. + ScriptID Script + pVariant byte // offset in str, includes preceding '-' + pExt uint16 // offset of first extension, includes preceding '-' + + // str is the string representation of the Tag. It will only be used if the + // tag has variants or extensions. + str string +} + +// Make is a convenience wrapper for Parse that omits the error. +// In case of an error, a sensible default is returned. +func Make(s string) Tag { + t, _ := Parse(s) + return t +} + +// Raw returns the raw base language, script and region, without making an +// attempt to infer their values. +// TODO: consider removing +func (t Tag) Raw() (b Language, s Script, r Region) { + return t.LangID, t.ScriptID, t.RegionID +} + +// equalTags compares language, script and region subtags only. +func (t Tag) equalTags(a Tag) bool { + return t.LangID == a.LangID && t.ScriptID == a.ScriptID && t.RegionID == a.RegionID +} + +// IsRoot returns true if t is equal to language "und". +func (t Tag) IsRoot() bool { + if int(t.pVariant) < len(t.str) { + return false + } + return t.equalTags(Und) +} + +// IsPrivateUse reports whether the Tag consists solely of an IsPrivateUse use +// tag. +func (t Tag) IsPrivateUse() bool { + return t.str != "" && t.pVariant == 0 +} + +// RemakeString is used to update t.str in case lang, script or region changed. +// It is assumed that pExt and pVariant still point to the start of the +// respective parts. +func (t *Tag) RemakeString() { + if t.str == "" { + return + } + extra := t.str[t.pVariant:] + if t.pVariant > 0 { + extra = extra[1:] + } + if t.equalTags(Und) && strings.HasPrefix(extra, "x-") { + t.str = extra + t.pVariant = 0 + t.pExt = 0 + return + } + var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. + b := buf[:t.genCoreBytes(buf[:])] + if extra != "" { + diff := len(b) - int(t.pVariant) + b = append(b, '-') + b = append(b, extra...) + t.pVariant = uint8(int(t.pVariant) + diff) + t.pExt = uint16(int(t.pExt) + diff) + } else { + t.pVariant = uint8(len(b)) + t.pExt = uint16(len(b)) + } + t.str = string(b) +} + +// genCoreBytes writes a string for the base languages, script and region tags +// to the given buffer and returns the number of bytes written. It will never +// write more than maxCoreSize bytes. +func (t *Tag) genCoreBytes(buf []byte) int { + n := t.LangID.StringToBuf(buf[:]) + if t.ScriptID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.ScriptID.String()) + } + if t.RegionID != 0 { + n += copy(buf[n:], "-") + n += copy(buf[n:], t.RegionID.String()) + } + return n +} + +// String returns the canonical string representation of the language tag. +func (t Tag) String() string { + if t.str != "" { + return t.str + } + if t.ScriptID == 0 && t.RegionID == 0 { + return t.LangID.String() + } + buf := [maxCoreSize]byte{} + return string(buf[:t.genCoreBytes(buf[:])]) +} + +// MarshalText implements encoding.TextMarshaler. +func (t Tag) MarshalText() (text []byte, err error) { + if t.str != "" { + text = append(text, t.str...) + } else if t.ScriptID == 0 && t.RegionID == 0 { + text = append(text, t.LangID.String()...) + } else { + buf := [maxCoreSize]byte{} + text = buf[:t.genCoreBytes(buf[:])] + } + return text, nil +} + +// UnmarshalText implements encoding.TextUnmarshaler. +func (t *Tag) UnmarshalText(text []byte) error { + tag, err := Parse(string(text)) + *t = tag + return err +} + +// Variants returns the part of the tag holding all variants or the empty string +// if there are no variants defined. +func (t Tag) Variants() string { + if t.pVariant == 0 { + return "" + } + return t.str[t.pVariant:t.pExt] +} + +// VariantOrPrivateUseTags returns variants or private use tags. +func (t Tag) VariantOrPrivateUseTags() string { + if t.pExt > 0 { + return t.str[t.pVariant:t.pExt] + } + return t.str[t.pVariant:] +} + +// HasString reports whether this tag defines more than just the raw +// components. +func (t Tag) HasString() bool { + return t.str != "" +} + +// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a +// specific language are substituted with fields from the parent language. +// The parent for a language may change for newer versions of CLDR. +func (t Tag) Parent() Tag { + if t.str != "" { + // Strip the variants and extensions. + b, s, r := t.Raw() + t = Tag{LangID: b, ScriptID: s, RegionID: r} + if t.RegionID == 0 && t.ScriptID != 0 && t.LangID != 0 { + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID == t.ScriptID { + return Tag{LangID: t.LangID} + } + } + return t + } + if t.LangID != 0 { + if t.RegionID != 0 { + maxScript := t.ScriptID + if maxScript == 0 { + max, _ := addTags(t) + maxScript = max.ScriptID + } + + for i := range parents { + if Language(parents[i].lang) == t.LangID && Script(parents[i].maxScript) == maxScript { + for _, r := range parents[i].fromRegion { + if Region(r) == t.RegionID { + return Tag{ + LangID: t.LangID, + ScriptID: Script(parents[i].script), + RegionID: Region(parents[i].toRegion), + } + } + } + } + } + + // Strip the script if it is the default one. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != maxScript { + return Tag{LangID: t.LangID, ScriptID: maxScript} + } + return Tag{LangID: t.LangID} + } else if t.ScriptID != 0 { + // The parent for an base-script pair with a non-default script is + // "und" instead of the base language. + base, _ := addTags(Tag{LangID: t.LangID}) + if base.ScriptID != t.ScriptID { + return Und + } + return Tag{LangID: t.LangID} + } + } + return Und +} + +// ParseExtension parses s as an extension and returns it on success. +func ParseExtension(s string) (ext string, err error) { + scan := makeScannerString(s) + var end int + if n := len(scan.token); n != 1 { + return "", ErrSyntax + } + scan.toLower(0, len(scan.b)) + end = parseExtension(&scan) + if end != len(s) { + return "", ErrSyntax + } + return string(scan.b), nil +} + +// HasVariants reports whether t has variants. +func (t Tag) HasVariants() bool { + return uint16(t.pVariant) < t.pExt +} + +// HasExtensions reports whether t has extensions. +func (t Tag) HasExtensions() bool { + return int(t.pExt) < len(t.str) +} + +// Extension returns the extension of type x for tag t. It will return +// false for ok if t does not have the requested extension. The returned +// extension will be invalid in this case. +func (t Tag) Extension(x byte) (ext string, ok bool) { + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + if ext[0] == x { + return ext, true + } + } + return "", false +} + +// Extensions returns all extensions of t. +func (t Tag) Extensions() []string { + e := []string{} + for i := int(t.pExt); i < len(t.str)-1; { + var ext string + i, ext = getExtension(t.str, i) + e = append(e, ext) + } + return e +} + +// TypeForKey returns the type associated with the given key, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// TypeForKey will traverse the inheritance chain to get the correct value. +func (t Tag) TypeForKey(key string) string { + if start, end, _ := t.findTypeForKey(key); end != start { + return t.str[start:end] + } + return "" +} + +var ( + errPrivateUse = errors.New("cannot set a key on a private use tag") + errInvalidArguments = errors.New("invalid key or type") +) + +// SetTypeForKey returns a new Tag with the key set to type, where key and type +// are of the allowed values defined for the Unicode locale extension ('u') in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// An empty value removes an existing pair with the same key. +func (t Tag) SetTypeForKey(key, value string) (Tag, error) { + if t.IsPrivateUse() { + return t, errPrivateUse + } + if len(key) != 2 { + return t, errInvalidArguments + } + + // Remove the setting if value is "". + if value == "" { + start, end, _ := t.findTypeForKey(key) + if start != end { + // Remove key tag and leading '-'. + start -= 4 + + // Remove a possible empty extension. + if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { + start -= 2 + } + if start == int(t.pVariant) && end == len(t.str) { + t.str = "" + t.pVariant, t.pExt = 0, 0 + } else { + t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) + } + } + return t, nil + } + + if len(value) < 3 || len(value) > 8 { + return t, errInvalidArguments + } + + var ( + buf [maxCoreSize + maxSimpleUExtensionSize]byte + uStart int // start of the -u extension. + ) + + // Generate the tag string if needed. + if t.str == "" { + uStart = t.genCoreBytes(buf[:]) + buf[uStart] = '-' + uStart++ + } + + // Create new key-type pair and parse it to verify. + b := buf[uStart:] + copy(b, "u-") + copy(b[2:], key) + b[4] = '-' + b = b[:5+copy(b[5:], value)] + scan := makeScanner(b) + if parseExtensions(&scan); scan.err != nil { + return t, scan.err + } + + // Assemble the replacement string. + if t.str == "" { + t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) + t.str = string(buf[:uStart+len(b)]) + } else { + s := t.str + start, end, hasExt := t.findTypeForKey(key) + if start == end { + if hasExt { + b = b[2:] + } + t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) + } else { + t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) + } + } + return t, nil +} + +// findKeyAndType returns the start and end position for the type corresponding +// to key or the point at which to insert the key-value pair if the type +// wasn't found. The hasExt return value reports whether an -u extension was present. +// Note: the extensions are typically very small and are likely to contain +// only one key-type pair. +func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { + p := int(t.pExt) + if len(key) != 2 || p == len(t.str) || p == 0 { + return p, p, false + } + s := t.str + + // Find the correct extension. + for p++; s[p] != 'u'; p++ { + if s[p] > 'u' { + p-- + return p, p, false + } + if p = nextExtension(s, p); p == len(s) { + return len(s), len(s), false + } + } + // Proceed to the hyphen following the extension name. + p++ + + // curKey is the key currently being processed. + curKey := "" + + // Iterate over keys until we get the end of a section. + for { + // p points to the hyphen preceding the current token. + if p3 := p + 3; s[p3] == '-' { + // Found a key. + // Check whether we just processed the key that was requested. + if curKey == key { + return start, p, true + } + // Set to the next key and continue scanning type tokens. + curKey = s[p+1 : p3] + if curKey > key { + return p, p, true + } + // Start of the type token sequence. + start = p + 4 + // A type is at least 3 characters long. + p += 7 // 4 + 3 + } else { + // Attribute or type, which is at least 3 characters long. + p += 4 + } + // p points past the third character of a type or attribute. + max := p + 5 // maximum length of token plus hyphen. + if len(s) < max { + max = len(s) + } + for ; p < max && s[p] != '-'; p++ { + } + // Bail if we have exhausted all tokens or if the next token starts + // a new extension. + if p == len(s) || s[p+2] == '-' { + if curKey == key { + return start, p, true + } + return p, p, true + } + } +} + +// ParseBase parses a 2- or 3-letter ISO 639 code. +// It returns a ValueError if s is a well-formed but unknown language identifier +// or another error if another error occurred. +func ParseBase(s string) (Language, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getLangID(buf[:copy(buf[:], s)]) +} + +// ParseScript parses a 4-letter ISO 15924 code. +// It returns a ValueError if s is a well-formed but unknown script identifier +// or another error if another error occurred. +func ParseScript(s string) (Script, error) { + if len(s) != 4 { + return 0, ErrSyntax + } + var buf [4]byte + return getScriptID(script, buf[:copy(buf[:], s)]) +} + +// EncodeM49 returns the Region for the given UN M.49 code. +// It returns an error if r is not a valid code. +func EncodeM49(r int) (Region, error) { + return getRegionM49(r) +} + +// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. +// It returns a ValueError if s is a well-formed but unknown region identifier +// or another error if another error occurred. +func ParseRegion(s string) (Region, error) { + if n := len(s); n < 2 || 3 < n { + return 0, ErrSyntax + } + var buf [3]byte + return getRegionID(buf[:copy(buf[:], s)]) +} + +// IsCountry returns whether this region is a country or autonomous area. This +// includes non-standard definitions from CLDR. +func (r Region) IsCountry() bool { + if r == 0 || r.IsGroup() || r.IsPrivateUse() && r != _XK { + return false + } + return true +} + +// IsGroup returns whether this region defines a collection of regions. This +// includes non-standard definitions from CLDR. +func (r Region) IsGroup() bool { + if r == 0 { + return false + } + return int(regionInclusion[r]) < len(regionContainment) +} + +// Contains returns whether Region c is contained by Region r. It returns true +// if c == r. +func (r Region) Contains(c Region) bool { + if r == c { + return true + } + g := regionInclusion[r] + if g >= nRegionGroups { + return false + } + m := regionContainment[g] + + d := regionInclusion[c] + b := regionInclusionBits[d] + + // A contained country may belong to multiple disjoint groups. Matching any + // of these indicates containment. If the contained region is a group, it + // must strictly be a subset. + if d >= nRegionGroups { + return b&m != 0 + } + return b&^m == 0 +} + +var errNoTLD = errors.New("language: region is not a valid ccTLD") + +// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. +// In all other cases it returns either the region itself or an error. +// +// This method may return an error for a region for which there exists a +// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The +// region will already be canonicalized it was obtained from a Tag that was +// obtained using any of the default methods. +func (r Region) TLD() (Region, error) { + // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the + // difference between ISO 3166-1 and IANA ccTLD. + if r == _GB { + r = _UK + } + if (r.typ() & ccTLD) == 0 { + return 0, errNoTLD + } + return r, nil +} + +// Canonicalize returns the region or a possible replacement if the region is +// deprecated. It will not return a replacement for deprecated regions that +// are split into multiple regions. +func (r Region) Canonicalize() Region { + if cr := normRegion(r); cr != 0 { + return cr + } + return r +} + +// Variant represents a registered variant of a language as defined by BCP 47. +type Variant struct { + ID uint8 + str string +} + +// ParseVariant parses and returns a Variant. An error is returned if s is not +// a valid variant. +func ParseVariant(s string) (Variant, error) { + s = strings.ToLower(s) + if id, ok := variantIndex[s]; ok { + return Variant{id, s}, nil + } + return Variant{}, NewValueError([]byte(s)) +} + +// String returns the string representation of the variant. +func (v Variant) String() string { + return v.str +} diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/internal/language/lookup.go index 1d80ac3708..6294b81524 100644 --- a/vendor/golang.org/x/text/language/lookup.go +++ b/vendor/golang.org/x/text/internal/language/lookup.go @@ -17,11 +17,11 @@ import ( // if it could not be found. func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { if !tag.FixCase(form, key) { - return 0, errSyntax + return 0, ErrSyntax } i := idx.Index(key) if i == -1 { - return 0, mkErrInvalid(key) + return 0, NewValueError(key) } return i, nil } @@ -32,38 +32,45 @@ func searchUint(imap []uint16, key uint16) int { }) } -type langID uint16 +type Language uint16 // getLangID returns the langID of s if s is a canonical subtag // or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (langID, error) { +func getLangID(s []byte) (Language, error) { if len(s) == 2 { return getLangISO2(s) } return getLangISO3(s) } +// TODO language normalization as well as the AliasMaps could be moved to the +// higher level package, but it is a bit tricky to separate the generation. + +func (id Language) Canonicalize() (Language, AliasType) { + return normLang(id) +} + // mapLang returns the mapped langID of id according to mapping m. -func normLang(id langID) (langID, langAliasType) { - k := sort.Search(len(langAliasMap), func(i int) bool { - return langAliasMap[i].from >= uint16(id) +func normLang(id Language) (Language, AliasType) { + k := sort.Search(len(AliasMap), func(i int) bool { + return AliasMap[i].From >= uint16(id) }) - if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) { - return langID(langAliasMap[k].to), langAliasTypes[k] + if k < len(AliasMap) && AliasMap[k].From == uint16(id) { + return Language(AliasMap[k].To), AliasTypes[k] } - return id, langAliasTypeUnknown + return id, AliasTypeUnknown } // getLangISO2 returns the langID for the given 2-letter ISO language code // or unknownLang if this does not exist. -func getLangISO2(s []byte) (langID, error) { +func getLangISO2(s []byte) (Language, error) { if !tag.FixCase("zz", s) { - return 0, errSyntax + return 0, ErrSyntax } if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return langID(i), nil + return Language(i), nil } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } const base = 'z' - 'a' + 1 @@ -88,7 +95,7 @@ func intToStr(v uint, s []byte) { // getLangISO3 returns the langID for the given 3-letter ISO language code // or unknownLang if this does not exist. -func getLangISO3(s []byte) (langID, error) { +func getLangISO3(s []byte) (Language, error) { if tag.FixCase("und", s) { // first try to match canonical 3-letter entries for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { @@ -96,7 +103,7 @@ func getLangISO3(s []byte) (langID, error) { // We treat "und" as special and always translate it to "unspecified". // Note that ZZ and Zzzz are private use and are not treated as // unspecified by default. - id := langID(i) + id := Language(i) if id == nonCanonicalUnd { return 0, nil } @@ -104,26 +111,26 @@ func getLangISO3(s []byte) (langID, error) { } } if i := altLangISO3.Index(s); i != -1 { - return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil + return Language(altLangIndex[altLangISO3.Elem(i)[3]]), nil } n := strToInt(s) if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return langID(n) + langNoIndexOffset, nil + return Language(n) + langNoIndexOffset, nil } // Check for non-canonical uses of ISO3. for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return langID(i), nil + return Language(i), nil } } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } - return 0, errSyntax + return 0, ErrSyntax } -// stringToBuf writes the string to b and returns the number of bytes +// StringToBuf writes the string to b and returns the number of bytes // written. cap(b) must be >= 3. -func (id langID) stringToBuf(b []byte) int { +func (id Language) StringToBuf(b []byte) int { if id >= langNoIndexOffset { intToStr(uint(id)-langNoIndexOffset, b[:3]) return 3 @@ -140,7 +147,7 @@ func (id langID) stringToBuf(b []byte) int { // String returns the BCP 47 representation of the langID. // Use b as variable name, instead of id, to ensure the variable // used is consistent with that of Base in which this type is embedded. -func (b langID) String() string { +func (b Language) String() string { if b == 0 { return "und" } else if b >= langNoIndexOffset { @@ -157,7 +164,7 @@ func (b langID) String() string { } // ISO3 returns the ISO 639-3 language code. -func (b langID) ISO3() string { +func (b Language) ISO3() string { if b == 0 || b >= langNoIndexOffset { return b.String() } @@ -173,15 +180,24 @@ func (b langID) ISO3() string { } // IsPrivateUse reports whether this language code is reserved for private use. -func (b langID) IsPrivateUse() bool { +func (b Language) IsPrivateUse() bool { return langPrivateStart <= b && b <= langPrivateEnd } -type regionID uint16 +// SuppressScript returns the script marked as SuppressScript in the IANA +// language tag repository, or 0 if there is no such script. +func (b Language) SuppressScript() Script { + if b < langNoIndexOffset { + return Script(suppressScript[b]) + } + return 0 +} + +type Region uint16 // getRegionID returns the region id for s if s is a valid 2-letter region code // or unknownRegion. -func getRegionID(s []byte) (regionID, error) { +func getRegionID(s []byte) (Region, error) { if len(s) == 3 { if isAlpha(s[0]) { return getRegionISO3(s) @@ -195,34 +211,34 @@ func getRegionID(s []byte) (regionID, error) { // getRegionISO2 returns the regionID for the given 2-letter ISO country code // or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (regionID, error) { +func getRegionISO2(s []byte) (Region, error) { i, err := findIndex(regionISO, s, "ZZ") if err != nil { return 0, err } - return regionID(i) + isoRegionOffset, nil + return Region(i) + isoRegionOffset, nil } // getRegionISO3 returns the regionID for the given 3-letter ISO country code // or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (regionID, error) { +func getRegionISO3(s []byte) (Region, error) { if tag.FixCase("ZZZ", s) { for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return regionID(i) + isoRegionOffset, nil + return Region(i) + isoRegionOffset, nil } } for i := 0; i < len(altRegionISO3); i += 3 { if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return regionID(altRegionIDs[i/3]), nil + return Region(altRegionIDs[i/3]), nil } } - return 0, mkErrInvalid(s) + return 0, NewValueError(s) } - return 0, errSyntax + return 0, ErrSyntax } -func getRegionM49(n int) (regionID, error) { +func getRegionM49(n int) (Region, error) { if 0 < n && n <= 999 { const ( searchBits = 7 @@ -236,7 +252,7 @@ func getRegionM49(n int) (regionID, error) { return buf[i] >= val }) if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return regionID(r & regionMask), nil + return Region(r & regionMask), nil } } var e ValueError @@ -247,13 +263,13 @@ func getRegionM49(n int) (regionID, error) { // normRegion returns a region if r is deprecated or 0 otherwise. // TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). // TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r regionID) regionID { +func normRegion(r Region) Region { m := regionOldMap k := sort.Search(len(m), func(i int) bool { - return m[i].from >= uint16(r) + return m[i].From >= uint16(r) }) - if k < len(m) && m[k].from == uint16(r) { - return regionID(m[k].to) + if k < len(m) && m[k].From == uint16(r) { + return Region(m[k].To) } return 0 } @@ -264,13 +280,13 @@ const ( bcp47Region ) -func (r regionID) typ() byte { +func (r Region) typ() byte { return regionTypes[r] } // String returns the BCP 47 representation for the region. // It returns "ZZ" for an unspecified region. -func (r regionID) String() string { +func (r Region) String() string { if r < isoRegionOffset { if r == 0 { return "ZZ" @@ -284,7 +300,7 @@ func (r regionID) String() string { // ISO3 returns the 3-letter ISO code of r. // Note that not all regions have a 3-letter ISO code. // In such cases this method returns "ZZZ". -func (r regionID) ISO3() string { +func (r Region) ISO3() string { if r < isoRegionOffset { return "ZZZ" } @@ -301,29 +317,29 @@ func (r regionID) ISO3() string { // M49 returns the UN M.49 encoding of r, or 0 if this encoding // is not defined for r. -func (r regionID) M49() int { +func (r Region) M49() int { return int(m49[r]) } // IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This // may include private-use tags that are assigned by CLDR and used in this // implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r regionID) IsPrivateUse() bool { +func (r Region) IsPrivateUse() bool { return r.typ()&iso3166UserAssigned != 0 } -type scriptID uint8 +type Script uint8 // getScriptID returns the script id for string s. It assumes that s // is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (scriptID, error) { +func getScriptID(idx tag.Index, s []byte) (Script, error) { i, err := findIndex(idx, s, "Zzzz") - return scriptID(i), err + return Script(i), err } // String returns the script code in title case. // It returns "Zzzz" for an unspecified script. -func (s scriptID) String() string { +func (s Script) String() string { if s == 0 { return "Zzzz" } @@ -331,7 +347,7 @@ func (s scriptID) String() string { } // IsPrivateUse reports whether this script code is reserved for private use. -func (s scriptID) IsPrivateUse() bool { +func (s Script) IsPrivateUse() bool { return _Qaaa <= s && s <= _Qabx } @@ -389,7 +405,7 @@ func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { if v < 0 { return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true } - t.lang = langID(v) + t.LangID = Language(v) return t, true } return t, false diff --git a/vendor/golang.org/x/text/internal/language/match.go b/vendor/golang.org/x/text/internal/language/match.go new file mode 100644 index 0000000000..75a2dbca76 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/match.go @@ -0,0 +1,226 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import "errors" + +type scriptRegionFlags uint8 + +const ( + isList = 1 << iota + scriptInFrom + regionInFrom +) + +func (t *Tag) setUndefinedLang(id Language) { + if t.LangID == 0 { + t.LangID = id + } +} + +func (t *Tag) setUndefinedScript(id Script) { + if t.ScriptID == 0 { + t.ScriptID = id + } +} + +func (t *Tag) setUndefinedRegion(id Region) { + if t.RegionID == 0 || t.RegionID.Contains(id) { + t.RegionID = id + } +} + +// ErrMissingLikelyTagsData indicates no information was available +// to compute likely values of missing tags. +var ErrMissingLikelyTagsData = errors.New("missing likely tags data") + +// addLikelySubtags sets subtags to their most likely value, given the locale. +// In most cases this means setting fields for unknown values, but in some +// cases it may alter a value. It returns an ErrMissingLikelyTagsData error +// if the given locale cannot be expanded. +func (t Tag) addLikelySubtags() (Tag, error) { + id, err := addTags(t) + if err != nil { + return t, err + } else if id.equalTags(t) { + return t, nil + } + id.RemakeString() + return id, nil +} + +// specializeRegion attempts to specialize a group region. +func specializeRegion(t *Tag) bool { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if Language(x.lang) == t.LangID && Script(x.script) == t.ScriptID { + t.RegionID = Region(x.region) + } + return true + } + return false +} + +// Maximize returns a new tag with missing tags filled in. +func (t Tag) Maximize() (Tag, error) { + return addTags(t) +} + +func addTags(t Tag) (Tag, error) { + // We leave private use identifiers alone. + if t.IsPrivateUse() { + return t, nil + } + if t.ScriptID != 0 && t.RegionID != 0 { + if t.LangID != 0 { + // already fully specified + specializeRegion(&t) + return t, nil + } + // Search matches for und-script-region. Note that for these cases + // region will never be a group so there is no need to check for this. + list := likelyRegion[t.RegionID : t.RegionID+1] + if x := list[0]; x.flags&isList != 0 { + list = likelyRegionList[x.lang : x.lang+uint16(x.script)] + } + for _, x := range list { + // Deviating from the spec. See match_test.go for details. + if Script(x.script) == t.ScriptID { + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + } + if t.LangID != 0 { + // Search matches for lang-script and lang-region, where lang != und. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + list := likelyLangList[x.region : x.region+uint16(x.script)] + if t.ScriptID != 0 { + for _, x := range list { + if Script(x.script) == t.ScriptID && x.flags&scriptInFrom != 0 { + t.setUndefinedRegion(Region(x.region)) + return t, nil + } + } + } else if t.RegionID != 0 { + count := 0 + goodScript := true + tt := t + for _, x := range list { + // We visit all entries for which the script was not + // defined, including the ones where the region was not + // defined. This allows for proper disambiguation within + // regions. + if x.flags&scriptInFrom == 0 && t.RegionID.Contains(Region(x.region)) { + tt.RegionID = Region(x.region) + tt.setUndefinedScript(Script(x.script)) + goodScript = goodScript && tt.ScriptID == Script(x.script) + count++ + } + } + if count == 1 { + return tt, nil + } + // Even if we fail to find a unique Region, we might have + // an unambiguous script. + if goodScript { + t.ScriptID = tt.ScriptID + } + } + } + } + } else { + // Search matches for und-script. + if t.ScriptID != 0 { + x := likelyScript[t.ScriptID] + if x.region != 0 { + t.setUndefinedRegion(Region(x.region)) + t.setUndefinedLang(Language(x.lang)) + return t, nil + } + } + // Search matches for und-region. If und-script-region exists, it would + // have been found earlier. + if t.RegionID != 0 { + if i := regionInclusion[t.RegionID]; i < nRegionGroups { + x := likelyRegionGroup[i] + if x.region != 0 { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + t.RegionID = Region(x.region) + } + } else { + x := likelyRegion[t.RegionID] + if x.flags&isList != 0 { + x = likelyRegionList[x.lang] + } + if x.script != 0 && x.flags != scriptInFrom { + t.setUndefinedLang(Language(x.lang)) + t.setUndefinedScript(Script(x.script)) + return t, nil + } + } + } + } + + // Search matches for lang. + if t.LangID < langNoIndexOffset { + x := likelyLang[t.LangID] + if x.flags&isList != 0 { + x = likelyLangList[x.region] + } + if x.region != 0 { + t.setUndefinedScript(Script(x.script)) + t.setUndefinedRegion(Region(x.region)) + } + specializeRegion(&t) + if t.LangID == 0 { + t.LangID = _en // default language + } + return t, nil + } + return t, ErrMissingLikelyTagsData +} + +func (t *Tag) setTagsFrom(id Tag) { + t.LangID = id.LangID + t.ScriptID = id.ScriptID + t.RegionID = id.RegionID +} + +// minimize removes the region or script subtags from t such that +// t.addLikelySubtags() == t.minimize().addLikelySubtags(). +func (t Tag) minimize() (Tag, error) { + t, err := minimizeTags(t) + if err != nil { + return t, err + } + t.RemakeString() + return t, nil +} + +// minimizeTags mimics the behavior of the ICU 51 C implementation. +func minimizeTags(t Tag) (Tag, error) { + if t.equalTags(Und) { + return t, nil + } + max, err := addTags(t) + if err != nil { + return t, err + } + for _, id := range [...]Tag{ + {LangID: t.LangID}, + {LangID: t.LangID, RegionID: t.RegionID}, + {LangID: t.LangID, ScriptID: t.ScriptID}, + } { + if x, err := addTags(id); err == nil && max.equalTags(x) { + t.setTagsFrom(id) + break + } + } + return t, nil +} diff --git a/vendor/golang.org/x/text/internal/language/parse.go b/vendor/golang.org/x/text/internal/language/parse.go new file mode 100644 index 0000000000..2be83e1da5 --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/parse.go @@ -0,0 +1,594 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +import ( + "bytes" + "errors" + "fmt" + "sort" + + "golang.org/x/text/internal/tag" +) + +// isAlpha returns true if the byte is not a digit. +// b must be an ASCII letter or digit. +func isAlpha(b byte) bool { + return b > '9' +} + +// isAlphaNum returns true if the string contains only ASCII letters or digits. +func isAlphaNum(s []byte) bool { + for _, c := range s { + if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { + return false + } + } + return true +} + +// ErrSyntax is returned by any of the parsing functions when the +// input is not well-formed, according to BCP 47. +// TODO: return the position at which the syntax error occurred? +var ErrSyntax = errors.New("language: tag is not well-formed") + +// ErrDuplicateKey is returned when a tag contains the same key twice with +// different values in the -u section. +var ErrDuplicateKey = errors.New("language: different values for same key in -u extension") + +// ValueError is returned by any of the parsing functions when the +// input is well-formed but the respective subtag is not recognized +// as a valid value. +type ValueError struct { + v [8]byte +} + +// NewValueError creates a new ValueError. +func NewValueError(tag []byte) ValueError { + var e ValueError + copy(e.v[:], tag) + return e +} + +func (e ValueError) tag() []byte { + n := bytes.IndexByte(e.v[:], 0) + if n == -1 { + n = 8 + } + return e.v[:n] +} + +// Error implements the error interface. +func (e ValueError) Error() string { + return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) +} + +// Subtag returns the subtag for which the error occurred. +func (e ValueError) Subtag() string { + return string(e.tag()) +} + +// scanner is used to scan BCP 47 tokens, which are separated by _ or -. +type scanner struct { + b []byte + bytes [max99thPercentileSize]byte + token []byte + start int // start position of the current token + end int // end position of the current token + next int // next point for scan + err error + done bool +} + +func makeScannerString(s string) scanner { + scan := scanner{} + if len(s) <= len(scan.bytes) { + scan.b = scan.bytes[:copy(scan.bytes[:], s)] + } else { + scan.b = []byte(s) + } + scan.init() + return scan +} + +// makeScanner returns a scanner using b as the input buffer. +// b is not copied and may be modified by the scanner routines. +func makeScanner(b []byte) scanner { + scan := scanner{b: b} + scan.init() + return scan +} + +func (s *scanner) init() { + for i, c := range s.b { + if c == '_' { + s.b[i] = '-' + } + } + s.scan() +} + +// restToLower converts the string between start and end to lower case. +func (s *scanner) toLower(start, end int) { + for i := start; i < end; i++ { + c := s.b[i] + if 'A' <= c && c <= 'Z' { + s.b[i] += 'a' - 'A' + } + } +} + +func (s *scanner) setError(e error) { + if s.err == nil || (e == ErrSyntax && s.err != ErrSyntax) { + s.err = e + } +} + +// resizeRange shrinks or grows the array at position oldStart such that +// a new string of size newSize can fit between oldStart and oldEnd. +// Sets the scan point to after the resized range. +func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { + s.start = oldStart + if end := oldStart + newSize; end != oldEnd { + diff := end - oldEnd + if end < cap(s.b) { + b := make([]byte, len(s.b)+diff) + copy(b, s.b[:oldStart]) + copy(b[end:], s.b[oldEnd:]) + s.b = b + } else { + s.b = append(s.b[end:], s.b[oldEnd:]...) + } + s.next = end + (s.next - s.end) + s.end = end + } +} + +// replace replaces the current token with repl. +func (s *scanner) replace(repl string) { + s.resizeRange(s.start, s.end, len(repl)) + copy(s.b[s.start:], repl) +} + +// gobble removes the current token from the input. +// Caller must call scan after calling gobble. +func (s *scanner) gobble(e error) { + s.setError(e) + if s.start == 0 { + s.b = s.b[:+copy(s.b, s.b[s.next:])] + s.end = 0 + } else { + s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] + s.end = s.start - 1 + } + s.next = s.start +} + +// deleteRange removes the given range from s.b before the current token. +func (s *scanner) deleteRange(start, end int) { + s.b = s.b[:start+copy(s.b[start:], s.b[end:])] + diff := end - start + s.next -= diff + s.start -= diff + s.end -= diff +} + +// scan parses the next token of a BCP 47 string. Tokens that are larger +// than 8 characters or include non-alphanumeric characters result in an error +// and are gobbled and removed from the output. +// It returns the end position of the last token consumed. +func (s *scanner) scan() (end int) { + end = s.end + s.token = nil + for s.start = s.next; s.next < len(s.b); { + i := bytes.IndexByte(s.b[s.next:], '-') + if i == -1 { + s.end = len(s.b) + s.next = len(s.b) + i = s.end - s.start + } else { + s.end = s.next + i + s.next = s.end + 1 + } + token := s.b[s.start:s.end] + if i < 1 || i > 8 || !isAlphaNum(token) { + s.gobble(ErrSyntax) + continue + } + s.token = token + return end + } + if n := len(s.b); n > 0 && s.b[n-1] == '-' { + s.setError(ErrSyntax) + s.b = s.b[:len(s.b)-1] + } + s.done = true + return end +} + +// acceptMinSize parses multiple tokens of the given size or greater. +// It returns the end position of the last token consumed. +func (s *scanner) acceptMinSize(min int) (end int) { + end = s.end + s.scan() + for ; len(s.token) >= min; s.scan() { + end = s.end + } + return end +} + +// Parse parses the given BCP 47 string and returns a valid Tag. If parsing +// failed it returns an error and any part of the tag that could be parsed. +// If parsing succeeded but an unknown value was found, it returns +// ValueError. The Tag returned in this case is just stripped of the unknown +// value. All other values are preserved. It accepts tags in the BCP 47 format +// and extensions to this standard defined in +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +func Parse(s string) (t Tag, err error) { + // TODO: consider supporting old-style locale key-value pairs. + if s == "" { + return Und, ErrSyntax + } + if len(s) <= maxAltTaglen { + b := [maxAltTaglen]byte{} + for i, c := range s { + // Generating invalid UTF-8 is okay as it won't match. + if 'A' <= c && c <= 'Z' { + c += 'a' - 'A' + } else if c == '_' { + c = '-' + } + b[i] = byte(c) + } + if t, ok := grandfathered(b); ok { + return t, nil + } + } + scan := makeScannerString(s) + return parse(&scan, s) +} + +func parse(scan *scanner, s string) (t Tag, err error) { + t = Und + var end int + if n := len(scan.token); n <= 1 { + scan.toLower(0, len(scan.b)) + if n == 0 || scan.token[0] != 'x' { + return t, ErrSyntax + } + end = parseExtensions(scan) + } else if n >= 4 { + return Und, ErrSyntax + } else { // the usual case + t, end = parseTag(scan) + if n := len(scan.token); n == 1 { + t.pExt = uint16(end) + end = parseExtensions(scan) + } else if end < len(scan.b) { + scan.setError(ErrSyntax) + scan.b = scan.b[:end] + } + } + if int(t.pVariant) < len(scan.b) { + if end < len(s) { + s = s[:end] + } + if len(s) > 0 && tag.Compare(s, scan.b) == 0 { + t.str = s + } else { + t.str = string(scan.b) + } + } else { + t.pVariant, t.pExt = 0, 0 + } + return t, scan.err +} + +// parseTag parses language, script, region and variants. +// It returns a Tag and the end position in the input that was parsed. +func parseTag(scan *scanner) (t Tag, end int) { + var e error + // TODO: set an error if an unknown lang, script or region is encountered. + t.LangID, e = getLangID(scan.token) + scan.setError(e) + scan.replace(t.LangID.String()) + langStart := scan.start + end = scan.scan() + for len(scan.token) == 3 && isAlpha(scan.token[0]) { + // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent + // to a tag of the form <extlang>. + lang, e := getLangID(scan.token) + if lang != 0 { + t.LangID = lang + copy(scan.b[langStart:], lang.String()) + scan.b[langStart+3] = '-' + scan.start = langStart + 4 + } + scan.gobble(e) + end = scan.scan() + } + if len(scan.token) == 4 && isAlpha(scan.token[0]) { + t.ScriptID, e = getScriptID(script, scan.token) + if t.ScriptID == 0 { + scan.gobble(e) + } + end = scan.scan() + } + if n := len(scan.token); n >= 2 && n <= 3 { + t.RegionID, e = getRegionID(scan.token) + if t.RegionID == 0 { + scan.gobble(e) + } else { + scan.replace(t.RegionID.String()) + } + end = scan.scan() + } + scan.toLower(scan.start, len(scan.b)) + t.pVariant = byte(end) + end = parseVariants(scan, end, t) + t.pExt = uint16(end) + return t, end +} + +var separator = []byte{'-'} + +// parseVariants scans tokens as long as each token is a valid variant string. +// Duplicate variants are removed. +func parseVariants(scan *scanner, end int, t Tag) int { + start := scan.start + varIDBuf := [4]uint8{} + variantBuf := [4][]byte{} + varID := varIDBuf[:0] + variant := variantBuf[:0] + last := -1 + needSort := false + for ; len(scan.token) >= 4; scan.scan() { + // TODO: measure the impact of needing this conversion and redesign + // the data structure if there is an issue. + v, ok := variantIndex[string(scan.token)] + if !ok { + // unknown variant + // TODO: allow user-defined variants? + scan.gobble(NewValueError(scan.token)) + continue + } + varID = append(varID, v) + variant = append(variant, scan.token) + if !needSort { + if last < int(v) { + last = int(v) + } else { + needSort = true + // There is no legal combinations of more than 7 variants + // (and this is by no means a useful sequence). + const maxVariants = 8 + if len(varID) > maxVariants { + break + } + } + } + end = scan.end + } + if needSort { + sort.Sort(variantsSort{varID, variant}) + k, l := 0, -1 + for i, v := range varID { + w := int(v) + if l == w { + // Remove duplicates. + continue + } + varID[k] = varID[i] + variant[k] = variant[i] + k++ + l = w + } + if str := bytes.Join(variant[:k], separator); len(str) == 0 { + end = start - 1 + } else { + scan.resizeRange(start, end, len(str)) + copy(scan.b[scan.start:], str) + end = scan.end + } + } + return end +} + +type variantsSort struct { + i []uint8 + v [][]byte +} + +func (s variantsSort) Len() int { + return len(s.i) +} + +func (s variantsSort) Swap(i, j int) { + s.i[i], s.i[j] = s.i[j], s.i[i] + s.v[i], s.v[j] = s.v[j], s.v[i] +} + +func (s variantsSort) Less(i, j int) bool { + return s.i[i] < s.i[j] +} + +type bytesSort struct { + b [][]byte + n int // first n bytes to compare +} + +func (b bytesSort) Len() int { + return len(b.b) +} + +func (b bytesSort) Swap(i, j int) { + b.b[i], b.b[j] = b.b[j], b.b[i] +} + +func (b bytesSort) Less(i, j int) bool { + for k := 0; k < b.n; k++ { + if b.b[i][k] == b.b[j][k] { + continue + } + return b.b[i][k] < b.b[j][k] + } + return false +} + +// parseExtensions parses and normalizes the extensions in the buffer. +// It returns the last position of scan.b that is part of any extension. +// It also trims scan.b to remove excess parts accordingly. +func parseExtensions(scan *scanner) int { + start := scan.start + exts := [][]byte{} + private := []byte{} + end := scan.end + for len(scan.token) == 1 { + extStart := scan.start + ext := scan.token[0] + end = parseExtension(scan) + extension := scan.b[extStart:end] + if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { + scan.setError(ErrSyntax) + end = extStart + continue + } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { + scan.b = scan.b[:end] + return end + } else if ext == 'x' { + private = extension + break + } + exts = append(exts, extension) + } + sort.Sort(bytesSort{exts, 1}) + if len(private) > 0 { + exts = append(exts, private) + } + scan.b = scan.b[:start] + if len(exts) > 0 { + scan.b = append(scan.b, bytes.Join(exts, separator)...) + } else if start > 0 { + // Strip trailing '-'. + scan.b = scan.b[:start-1] + } + return end +} + +// parseExtension parses a single extension and returns the position of +// the extension end. +func parseExtension(scan *scanner) int { + start, end := scan.start, scan.end + switch scan.token[0] { + case 'u': + attrStart := end + scan.scan() + for last := []byte{}; len(scan.token) > 2; scan.scan() { + if bytes.Compare(scan.token, last) != -1 { + // Attributes are unsorted. Start over from scratch. + p := attrStart + 1 + scan.next = p + attrs := [][]byte{} + for scan.scan(); len(scan.token) > 2; scan.scan() { + attrs = append(attrs, scan.token) + end = scan.end + } + sort.Sort(bytesSort{attrs, 3}) + copy(scan.b[p:], bytes.Join(attrs, separator)) + break + } + last = scan.token + end = scan.end + } + var last, key []byte + for attrEnd := end; len(scan.token) == 2; last = key { + key = scan.token + keyEnd := scan.end + end = scan.acceptMinSize(3) + // TODO: check key value validity + if keyEnd == end || bytes.Compare(key, last) != 1 { + // We have an invalid key or the keys are not sorted. + // Start scanning keys from scratch and reorder. + p := attrEnd + 1 + scan.next = p + keys := [][]byte{} + for scan.scan(); len(scan.token) == 2; { + keyStart, keyEnd := scan.start, scan.end + end = scan.acceptMinSize(3) + if keyEnd != end { + keys = append(keys, scan.b[keyStart:end]) + } else { + scan.setError(ErrSyntax) + end = keyStart + } + } + sort.Stable(bytesSort{keys, 2}) + if n := len(keys); n > 0 { + k := 0 + for i := 1; i < n; i++ { + if !bytes.Equal(keys[k][:2], keys[i][:2]) { + k++ + keys[k] = keys[i] + } else if !bytes.Equal(keys[k], keys[i]) { + scan.setError(ErrDuplicateKey) + } + } + keys = keys[:k+1] + } + reordered := bytes.Join(keys, separator) + if e := p + len(reordered); e < end { + scan.deleteRange(e, end) + end = e + } + copy(scan.b[p:], reordered) + break + } + } + case 't': + scan.scan() + if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { + _, end = parseTag(scan) + scan.toLower(start, end) + } + for len(scan.token) == 2 && !isAlpha(scan.token[1]) { + end = scan.acceptMinSize(3) + } + case 'x': + end = scan.acceptMinSize(1) + default: + end = scan.acceptMinSize(2) + } + return end +} + +// getExtension returns the name, body and end position of the extension. +func getExtension(s string, p int) (end int, ext string) { + if s[p] == '-' { + p++ + } + if s[p] == 'x' { + return len(s), s[p:] + } + end = nextExtension(s, p) + return end, s[p:end] +} + +// nextExtension finds the next extension within the string, searching +// for the -<char>- pattern from position p. +// In the fast majority of cases, language tags will have at most +// one extension and extensions tend to be small. +func nextExtension(s string, p int) int { + for n := len(s) - 3; p < n; { + if s[p] == '-' { + if s[p+2] == '-' { + return p + } + p += 3 + } else { + p++ + } + } + return len(s) +} diff --git a/vendor/golang.org/x/text/internal/language/tables.go b/vendor/golang.org/x/text/internal/language/tables.go new file mode 100644 index 0000000000..239e2d29eb --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tables.go @@ -0,0 +1,3431 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package language + +import "golang.org/x/text/internal/tag" + +// CLDRVersion is the CLDR version from which the tables in this package are derived. +const CLDRVersion = "32" + +const NumLanguages = 8665 + +const NumScripts = 242 + +const NumRegions = 357 + +type FromTo struct { + From uint16 + To uint16 +} + +const nonCanonicalUnd = 1201 +const ( + _af = 22 + _am = 39 + _ar = 58 + _az = 88 + _bg = 126 + _bn = 165 + _ca = 215 + _cs = 250 + _da = 257 + _de = 269 + _el = 310 + _en = 313 + _es = 318 + _et = 320 + _fa = 328 + _fi = 337 + _fil = 339 + _fr = 350 + _gu = 420 + _he = 444 + _hi = 446 + _hr = 465 + _hu = 469 + _hy = 471 + _id = 481 + _is = 504 + _it = 505 + _ja = 512 + _ka = 528 + _kk = 578 + _km = 586 + _kn = 593 + _ko = 596 + _ky = 650 + _lo = 696 + _lt = 704 + _lv = 711 + _mk = 767 + _ml = 772 + _mn = 779 + _mo = 784 + _mr = 795 + _ms = 799 + _mul = 806 + _my = 817 + _nb = 839 + _ne = 849 + _nl = 871 + _no = 879 + _pa = 925 + _pl = 947 + _pt = 960 + _ro = 988 + _ru = 994 + _sh = 1031 + _si = 1036 + _sk = 1042 + _sl = 1046 + _sq = 1073 + _sr = 1074 + _sv = 1092 + _sw = 1093 + _ta = 1104 + _te = 1121 + _th = 1131 + _tl = 1146 + _tn = 1152 + _tr = 1162 + _uk = 1198 + _ur = 1204 + _uz = 1212 + _vi = 1219 + _zh = 1321 + _zu = 1327 + _jbo = 515 + _ami = 1650 + _bnn = 2357 + _hak = 438 + _tlh = 14467 + _lb = 661 + _nv = 899 + _pwn = 12055 + _tao = 14188 + _tay = 14198 + _tsu = 14662 + _nn = 874 + _sfb = 13629 + _vgt = 15701 + _sgg = 13660 + _cmn = 3007 + _nan = 835 + _hsn = 467 +) + +const langPrivateStart = 0x2f72 + +const langPrivateEnd = 0x3179 + +// lang holds an alphabetically sorted list of ISO-639 language identifiers. +// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. +// For 2-byte language identifiers, the two successive bytes have the following meaning: +// - if the first letter of the 2- and 3-letter ISO codes are the same: +// the second and third letter of the 3-letter ISO code. +// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. +// For 3-byte language identifiers the 4th byte is 0. +const lang tag.Index = "" + // Size: 5324 bytes + "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + + "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + + "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + + "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + + "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + + "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + + "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + + "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + + "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + + "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + + "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + + "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + + "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + + "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + + "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + + "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + + "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + + "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + + "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + + "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + + "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + + "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + + "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + + "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + + "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + + "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + + "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + + "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + + "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + + "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + + "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + + "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + + "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + + "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + + "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + + "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + + "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + + "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + + "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + + "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + + "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + + "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + + "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + + "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + + "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + + "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + + "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + + "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + + "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + + "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + + "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + + "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + + "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + + "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + + "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + + "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + + "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + + "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + + "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + + "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + + "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + + "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + + "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + + "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + + "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + + "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + + "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + + "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + + "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + + "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + + "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + + "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + + "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + + "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + + "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + + "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + + "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + + "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + + "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + + "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + + "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + + "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + + "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + + "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + + "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + + "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + + "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + + "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + + "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + + "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + + "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + + "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + + "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + + "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + + "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + + "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + + "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + + "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + + "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + + "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + + "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + + "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + + "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + + "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + + "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + + "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + + "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + + "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + + "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + + "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + + "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + + "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + + "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + + "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + + "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + + "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + + "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + + "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + + "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + + "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + + "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + + "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + + "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + + "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" + +const langNoIndexOffset = 1330 + +// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index +// in lookup tables. The language ids for these language codes are derived directly +// from the letters and are not consecutive. +// Size: 2197 bytes, 2197 elements +var langNoIndex = [2197]uint8{ + // Entry 0 - 3F + 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, + 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, + 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, + 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, + 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, + 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, + 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, + 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, + // Entry 40 - 7F + 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, + 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, + 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, + 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, + 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, + 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, + 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, + 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, + // Entry 80 - BF + 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, + 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, + 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, + 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, + 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, + 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, + 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, + 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, + // Entry C0 - FF + 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, + 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, + 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, + 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, + 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, + 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, + 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, + 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, + // Entry 100 - 13F + 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, + 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, + 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, + 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, + 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, + 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, + 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, + 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, + // Entry 140 - 17F + 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, + 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, + 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, + 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, + 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, + 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, + 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, + 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, + // Entry 180 - 1BF + 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, + 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, + 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, + 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, + 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, + 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, + 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, + // Entry 200 - 23F + 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, + 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, + 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, + 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, + 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, + 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, + 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, + 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, + // Entry 240 - 27F + 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, + 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, + 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, + 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, + 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, + 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, + 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, + // Entry 280 - 2BF + 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, + 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, + 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, + 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, + 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, + 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, + 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, + // Entry 2C0 - 2FF + 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, + 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, + 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, + 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, + 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, + 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, + 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, + 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, + // Entry 300 - 33F + 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, + 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, + 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, + 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, + 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, + 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, + 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, + 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, + // Entry 340 - 37F + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, + 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, + 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, + 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, + 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, + 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, + 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, + 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, + // Entry 380 - 3BF + 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, + 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, + 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, + 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, + 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, + 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, + 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, + 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, + // Entry 3C0 - 3FF + 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, + 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, + 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, + 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, + 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, + 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, + 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, + 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, + // Entry 400 - 43F + 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, + 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, + 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, + 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, + 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, + 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, + 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, + 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, + // Entry 440 - 47F + 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, + 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, + 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, + 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, + 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, + 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, + 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, + 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, + // Entry 480 - 4BF + 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, + 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, + 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, + 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, + 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, + 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, + 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, + // Entry 4C0 - 4FF + 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, + 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, + 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, + 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, + 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, + 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, + 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, + // Entry 500 - 53F + 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, + 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, + 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, + 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, + 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, + 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, + 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, + 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, + // Entry 540 - 57F + 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + // Entry 580 - 5BF + 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, + 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, + 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, + 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, + 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, + 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, + 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, + 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, + // Entry 5C0 - 5FF + 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, + 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, + 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, + 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, + 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, + 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, + 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, + 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, + // Entry 600 - 63F + 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, + 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, + 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, + 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, + 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, + 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, + 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, + 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, + // Entry 640 - 67F + 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, + 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, + 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, + 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, + 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, + 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, + 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, + 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, + // Entry 680 - 6BF + 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, + 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, + 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, + 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, + 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, + 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, + 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, + 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, + // Entry 6C0 - 6FF + 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, + 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, + 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, + 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, + 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, + 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, + // Entry 700 - 73F + 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, + 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, + 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, + 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, + 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 740 - 77F + 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, + 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, + 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, + 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, + 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, + 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, + 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, + // Entry 780 - 7BF + 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, + 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, + 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, + 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, + 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, + 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, + 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, + 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, + // Entry 7C0 - 7FF + 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, + 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, + 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, + 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, + 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, + 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, + 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, + 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, + // Entry 800 - 83F + 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, + 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, + 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, + 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, + 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, + 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, + 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, + 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, + // Entry 840 - 87F + 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, + 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, + 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, + 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, + 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, + 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, + 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, + // Entry 880 - 8BF + 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, + 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, + 0x0a, 0x00, 0x80, 0x00, 0x00, +} + +// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives +// to 2-letter language codes that cannot be derived using the method described above. +// Each 3-letter code is followed by its 1-byte langID. +const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" + +// altLangIndex is used to convert indexes in altLangISO3 to langIDs. +// Size: 12 bytes, 6 elements +var altLangIndex = [6]uint16{ + 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, +} + +// AliasMap maps langIDs to their suggested replacements. +// Size: 656 bytes, 164 elements +var AliasMap = [164]FromTo{ + 0: {From: 0x82, To: 0x88}, + 1: {From: 0x187, To: 0x1ae}, + 2: {From: 0x1f3, To: 0x1e1}, + 3: {From: 0x1fb, To: 0x1bc}, + 4: {From: 0x208, To: 0x512}, + 5: {From: 0x20f, To: 0x20e}, + 6: {From: 0x310, To: 0x3dc}, + 7: {From: 0x347, To: 0x36f}, + 8: {From: 0x407, To: 0x432}, + 9: {From: 0x47a, To: 0x153}, + 10: {From: 0x490, To: 0x451}, + 11: {From: 0x4a2, To: 0x21}, + 12: {From: 0x53e, To: 0x544}, + 13: {From: 0x58f, To: 0x12d}, + 14: {From: 0x630, To: 0x1eb1}, + 15: {From: 0x651, To: 0x431}, + 16: {From: 0x662, To: 0x431}, + 17: {From: 0x6ed, To: 0x3a}, + 18: {From: 0x6f8, To: 0x1d7}, + 19: {From: 0x73e, To: 0x21a1}, + 20: {From: 0x7b3, To: 0x56}, + 21: {From: 0x7b9, To: 0x299b}, + 22: {From: 0x7c5, To: 0x58}, + 23: {From: 0x7e6, To: 0x145}, + 24: {From: 0x80c, To: 0x5a}, + 25: {From: 0x815, To: 0x8d}, + 26: {From: 0x87e, To: 0x810}, + 27: {From: 0x8c3, To: 0xee3}, + 28: {From: 0x9ef, To: 0x331}, + 29: {From: 0xa36, To: 0x2c5}, + 30: {From: 0xa3d, To: 0xbf}, + 31: {From: 0xabe, To: 0x3322}, + 32: {From: 0xb38, To: 0x529}, + 33: {From: 0xb75, To: 0x265a}, + 34: {From: 0xb7e, To: 0xbc3}, + 35: {From: 0xb9b, To: 0x44e}, + 36: {From: 0xbbc, To: 0x4229}, + 37: {From: 0xbbf, To: 0x529}, + 38: {From: 0xbfe, To: 0x2da7}, + 39: {From: 0xc2e, To: 0x3181}, + 40: {From: 0xcb9, To: 0xf3}, + 41: {From: 0xd08, To: 0xfa}, + 42: {From: 0xdc8, To: 0x11a}, + 43: {From: 0xdd7, To: 0x32d}, + 44: {From: 0xdf8, To: 0xdfb}, + 45: {From: 0xdfe, To: 0x531}, + 46: {From: 0xedf, To: 0x205a}, + 47: {From: 0xeee, To: 0x2e9a}, + 48: {From: 0xf39, To: 0x367}, + 49: {From: 0x10d0, To: 0x140}, + 50: {From: 0x1104, To: 0x2d0}, + 51: {From: 0x11a0, To: 0x1ec}, + 52: {From: 0x1279, To: 0x21}, + 53: {From: 0x1424, To: 0x15e}, + 54: {From: 0x1470, To: 0x14e}, + 55: {From: 0x151f, To: 0xd9b}, + 56: {From: 0x1523, To: 0x390}, + 57: {From: 0x1532, To: 0x19f}, + 58: {From: 0x1580, To: 0x210}, + 59: {From: 0x1583, To: 0x10d}, + 60: {From: 0x15a3, To: 0x3caf}, + 61: {From: 0x166a, To: 0x19b}, + 62: {From: 0x16c8, To: 0x136}, + 63: {From: 0x1700, To: 0x29f8}, + 64: {From: 0x1718, To: 0x194}, + 65: {From: 0x1727, To: 0xf3f}, + 66: {From: 0x177a, To: 0x178}, + 67: {From: 0x1809, To: 0x17b6}, + 68: {From: 0x1816, To: 0x18f3}, + 69: {From: 0x188a, To: 0x436}, + 70: {From: 0x1979, To: 0x1d01}, + 71: {From: 0x1a74, To: 0x2bb0}, + 72: {From: 0x1a8a, To: 0x1f8}, + 73: {From: 0x1b5a, To: 0x1fa}, + 74: {From: 0x1b86, To: 0x1515}, + 75: {From: 0x1d64, To: 0x2c9b}, + 76: {From: 0x2038, To: 0x37b1}, + 77: {From: 0x203d, To: 0x20dd}, + 78: {From: 0x205a, To: 0x30b}, + 79: {From: 0x20e3, To: 0x274}, + 80: {From: 0x20ee, To: 0x263}, + 81: {From: 0x20f2, To: 0x22d}, + 82: {From: 0x20f9, To: 0x256}, + 83: {From: 0x210f, To: 0x21eb}, + 84: {From: 0x2135, To: 0x27d}, + 85: {From: 0x2160, To: 0x913}, + 86: {From: 0x2199, To: 0x121}, + 87: {From: 0x21ce, To: 0x1561}, + 88: {From: 0x21e6, To: 0x504}, + 89: {From: 0x21f4, To: 0x49f}, + 90: {From: 0x222d, To: 0x121}, + 91: {From: 0x2237, To: 0x121}, + 92: {From: 0x2262, To: 0x92a}, + 93: {From: 0x2316, To: 0x3226}, + 94: {From: 0x2382, To: 0x3365}, + 95: {From: 0x2472, To: 0x2c7}, + 96: {From: 0x24e4, To: 0x2ff}, + 97: {From: 0x24f0, To: 0x2fa}, + 98: {From: 0x24fa, To: 0x31f}, + 99: {From: 0x2550, To: 0xb5b}, + 100: {From: 0x25a9, To: 0xe2}, + 101: {From: 0x263e, To: 0x2d0}, + 102: {From: 0x26c9, To: 0x26b4}, + 103: {From: 0x26f9, To: 0x3c8}, + 104: {From: 0x2727, To: 0x3caf}, + 105: {From: 0x2765, To: 0x26b4}, + 106: {From: 0x2789, To: 0x4358}, + 107: {From: 0x28ef, To: 0x2837}, + 108: {From: 0x2914, To: 0x351}, + 109: {From: 0x2986, To: 0x2da7}, + 110: {From: 0x2b1a, To: 0x38d}, + 111: {From: 0x2bfc, To: 0x395}, + 112: {From: 0x2c3f, To: 0x3caf}, + 113: {From: 0x2cfc, To: 0x3be}, + 114: {From: 0x2d13, To: 0x597}, + 115: {From: 0x2d47, To: 0x148}, + 116: {From: 0x2d48, To: 0x148}, + 117: {From: 0x2dff, To: 0x2f1}, + 118: {From: 0x2e08, To: 0x19cc}, + 119: {From: 0x2e1a, To: 0x2d95}, + 120: {From: 0x2e21, To: 0x292}, + 121: {From: 0x2e54, To: 0x7d}, + 122: {From: 0x2e65, To: 0x2282}, + 123: {From: 0x2ea0, To: 0x2e9b}, + 124: {From: 0x2eef, To: 0x2ed7}, + 125: {From: 0x3193, To: 0x3c4}, + 126: {From: 0x3366, To: 0x338e}, + 127: {From: 0x342a, To: 0x3dc}, + 128: {From: 0x34ee, To: 0x18d0}, + 129: {From: 0x35c8, To: 0x2c9b}, + 130: {From: 0x35e6, To: 0x412}, + 131: {From: 0x3658, To: 0x246}, + 132: {From: 0x3676, To: 0x3f4}, + 133: {From: 0x36fd, To: 0x445}, + 134: {From: 0x37c0, To: 0x121}, + 135: {From: 0x3816, To: 0x38f2}, + 136: {From: 0x382b, To: 0x2c9b}, + 137: {From: 0x382f, To: 0xa9}, + 138: {From: 0x3832, To: 0x3228}, + 139: {From: 0x386c, To: 0x39a6}, + 140: {From: 0x3892, To: 0x3fc0}, + 141: {From: 0x38a5, To: 0x39d7}, + 142: {From: 0x38b4, To: 0x1fa4}, + 143: {From: 0x38b5, To: 0x2e9a}, + 144: {From: 0x395c, To: 0x47e}, + 145: {From: 0x3b4e, To: 0xd91}, + 146: {From: 0x3b78, To: 0x137}, + 147: {From: 0x3c99, To: 0x4bc}, + 148: {From: 0x3fbd, To: 0x100}, + 149: {From: 0x4208, To: 0xa91}, + 150: {From: 0x42be, To: 0x573}, + 151: {From: 0x42f9, To: 0x3f60}, + 152: {From: 0x4378, To: 0x25a}, + 153: {From: 0x43cb, To: 0x36cb}, + 154: {From: 0x43cd, To: 0x10f}, + 155: {From: 0x44af, To: 0x3322}, + 156: {From: 0x44e3, To: 0x512}, + 157: {From: 0x45ca, To: 0x2409}, + 158: {From: 0x45dd, To: 0x26dc}, + 159: {From: 0x4610, To: 0x48ae}, + 160: {From: 0x46ae, To: 0x46a0}, + 161: {From: 0x473e, To: 0x4745}, + 162: {From: 0x4916, To: 0x31f}, + 163: {From: 0x49a7, To: 0x523}, +} + +// Size: 164 bytes, 164 elements +var AliasTypes = [164]AliasType{ + // Entry 0 - 3F + 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, + 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, + 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, + 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, + // Entry 40 - 7F + 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, + 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, + 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, + 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, + // Entry 80 - BF + 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, + 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, + 0, 1, 1, 1, +} + +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 +) + +// script is an alphabetically sorted list of ISO 15924 codes. The index +// of the script in the string, divided by 4, is the internal scriptID. +const script tag.Index = "" + // Size: 976 bytes + "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + + "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" + + "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" + + "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" + + "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" + + "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" + + "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" + + "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" + + "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" + + "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" + + "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" + + "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" + + "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" + + "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" + +// suppressScript is an index from langID to the dominant script for that language, +// if it exists. If a script is given, it should be suppressed from the language tag. +// Size: 1330 bytes, 1330 elements +var suppressScript = [1330]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 40 - 7F + 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + // Entry 80 - BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry C0 - FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 100 - 13F + 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00, + // Entry 140 - 17F + 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 180 - 1BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00, + // Entry 1C0 - 1FF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, + // Entry 200 - 23F + 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 240 - 27F + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 280 - 2BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 2C0 - 2FF + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, + // Entry 300 - 33F + 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 340 - 37F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 380 - 3BF + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, + // Entry 3C0 - 3FF + 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 400 - 43F + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + // Entry 440 - 47F + 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + // Entry 480 - 4BF + 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 4C0 - 4FF + 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + // Entry 500 - 53F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, + 0x00, 0x00, +} + +const ( + _001 = 1 + _419 = 31 + _BR = 65 + _CA = 73 + _ES = 110 + _GB = 123 + _MD = 188 + _PT = 238 + _UK = 306 + _US = 309 + _ZZ = 357 + _XA = 323 + _XC = 325 + _XK = 333 +) + +// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID +// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for +// the UN.M49 codes used for groups.) +const isoRegionOffset = 32 + +// regionTypes defines the status of a region for various standards. +// Size: 358 bytes, 358 elements +var regionTypes = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 40 - 7F + 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, + 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, + 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 80 - BF + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry C0 - FF + 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, + 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + // Entry 100 - 13F + 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, + // Entry 140 - 17F + 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, + 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, +} + +// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. +// Each 2-letter codes is followed by two bytes with the following meaning: +// - [A-Z}{2}: the first letter of the 2-letter code plus these two +// letters form the 3-letter ISO code. +// - 0, n: index into altRegionISO3. +const regionISO tag.Index = "" + // Size: 1308 bytes + "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + + "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + + "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + + "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + + "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + + "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + + "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + + "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + + "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + + "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + + "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + + "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + + "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + + "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + + "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + + "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + + "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + + "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + + "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + + "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" + +// altRegionISO3 holds a list of 3-letter region codes that cannot be +// mapped to 2-letter codes using the default algorithm. This is a short list. +const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" + +// altRegionIDs holds a list of regionIDs the positions of which match those +// of the 3-letter ISO codes in altRegionISO3. +// Size: 22 bytes, 11 elements +var altRegionIDs = [11]uint16{ + 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, + 0x0121, 0x015f, 0x00dc, +} + +// Size: 80 bytes, 20 elements +var regionOldMap = [20]FromTo{ + 0: {From: 0x44, To: 0xc4}, + 1: {From: 0x58, To: 0xa7}, + 2: {From: 0x5f, To: 0x60}, + 3: {From: 0x66, To: 0x3b}, + 4: {From: 0x79, To: 0x78}, + 5: {From: 0x93, To: 0x37}, + 6: {From: 0xa3, To: 0x133}, + 7: {From: 0xc1, To: 0x133}, + 8: {From: 0xd7, To: 0x13f}, + 9: {From: 0xdc, To: 0x2b}, + 10: {From: 0xef, To: 0x133}, + 11: {From: 0xf2, To: 0xe2}, + 12: {From: 0xfc, To: 0x70}, + 13: {From: 0x103, To: 0x164}, + 14: {From: 0x12a, To: 0x126}, + 15: {From: 0x132, To: 0x7b}, + 16: {From: 0x13a, To: 0x13e}, + 17: {From: 0x141, To: 0x133}, + 18: {From: 0x15d, To: 0x15e}, + 19: {From: 0x163, To: 0x4b}, +} + +// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are +// codes indicating collections of regions. +// Size: 716 bytes, 358 elements +var m49 = [358]int16{ + // Entry 0 - 3F + 0, 1, 2, 3, 5, 9, 11, 13, + 14, 15, 17, 18, 19, 21, 29, 30, + 34, 35, 39, 53, 54, 57, 61, 142, + 143, 145, 150, 151, 154, 155, 202, 419, + 958, 0, 20, 784, 4, 28, 660, 8, + 51, 530, 24, 10, 32, 16, 40, 36, + 533, 248, 31, 70, 52, 50, 56, 854, + 100, 48, 108, 204, 652, 60, 96, 68, + // Entry 40 - 7F + 535, 76, 44, 64, 104, 74, 72, 112, + 84, 124, 166, 180, 140, 178, 756, 384, + 184, 152, 120, 156, 170, 0, 188, 891, + 296, 192, 132, 531, 162, 196, 203, 278, + 276, 0, 262, 208, 212, 214, 204, 12, + 0, 218, 233, 818, 732, 232, 724, 231, + 967, 0, 246, 242, 238, 583, 234, 0, + 250, 249, 266, 826, 308, 268, 254, 831, + // Entry 80 - BF + 288, 292, 304, 270, 324, 312, 226, 300, + 239, 320, 316, 624, 328, 344, 334, 340, + 191, 332, 348, 854, 0, 360, 372, 376, + 833, 356, 86, 368, 364, 352, 380, 832, + 388, 400, 392, 581, 404, 417, 116, 296, + 174, 659, 408, 410, 414, 136, 398, 418, + 422, 662, 438, 144, 430, 426, 440, 442, + 428, 434, 504, 492, 498, 499, 663, 450, + // Entry C0 - FF + 584, 581, 807, 466, 104, 496, 446, 580, + 474, 478, 500, 470, 480, 462, 454, 484, + 458, 508, 516, 540, 562, 574, 566, 548, + 558, 528, 578, 524, 10, 520, 536, 570, + 554, 512, 591, 0, 604, 258, 598, 608, + 586, 616, 666, 612, 630, 275, 620, 581, + 585, 600, 591, 634, 959, 960, 961, 962, + 963, 964, 965, 966, 967, 968, 969, 970, + // Entry 100 - 13F + 971, 972, 638, 716, 642, 688, 643, 646, + 682, 90, 690, 729, 752, 702, 654, 705, + 744, 703, 694, 674, 686, 706, 740, 728, + 678, 810, 222, 534, 760, 748, 0, 796, + 148, 260, 768, 764, 762, 772, 626, 795, + 788, 776, 626, 792, 780, 798, 158, 834, + 804, 800, 826, 581, 0, 840, 858, 860, + 336, 670, 704, 862, 92, 850, 704, 548, + // Entry 140 - 17F + 876, 581, 882, 973, 974, 975, 976, 977, + 978, 979, 980, 981, 982, 983, 984, 985, + 986, 987, 988, 989, 990, 991, 992, 993, + 994, 995, 996, 997, 998, 720, 887, 175, + 891, 710, 894, 180, 716, 999, +} + +// m49Index gives indexes into fromM49 based on the three most significant bits +// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in +// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] +// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. +// The region code is stored in the 9 lsb of the indexed value. +// Size: 18 bytes, 9 elements +var m49Index = [9]int16{ + 0, 59, 108, 143, 181, 220, 259, 291, + 333, +} + +// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. +// Size: 666 bytes, 333 elements +var fromM49 = [333]uint16{ + // Entry 0 - 3F + 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, + 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, + 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, + 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, + 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, + 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, + 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, + 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, + // Entry 40 - 7F + 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, + 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, + 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, + 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, + 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, + 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, + 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, + 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, + // Entry 80 - BF + 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, + 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, + 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, + 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, + 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, + 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, + 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, + 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, + // Entry C0 - FF + 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, + 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, + 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, + 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, + 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, + 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, + 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, + 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, + // Entry 100 - 13F + 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, + 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, + 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, + 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, + 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, + 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, + 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, + 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, + // Entry 140 - 17F + 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, + 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, +} + +// Size: 1615 bytes +var variantIndex = map[string]uint8{ + "1606nict": 0x0, + "1694acad": 0x1, + "1901": 0x2, + "1959acad": 0x3, + "1994": 0x4d, + "1996": 0x4, + "abl1943": 0x5, + "akuapem": 0x6, + "alalc97": 0x4f, + "aluku": 0x7, + "ao1990": 0x8, + "arevela": 0x9, + "arevmda": 0xa, + "asante": 0xb, + "baku1926": 0xc, + "balanka": 0xd, + "barla": 0xe, + "basiceng": 0xf, + "bauddha": 0x10, + "biscayan": 0x11, + "biske": 0x48, + "bohoric": 0x12, + "boont": 0x13, + "colb1945": 0x14, + "cornu": 0x15, + "dajnko": 0x16, + "ekavsk": 0x17, + "emodeng": 0x18, + "fonipa": 0x50, + "fonnapa": 0x51, + "fonupa": 0x52, + "fonxsamp": 0x53, + "hepburn": 0x19, + "heploc": 0x4e, + "hognorsk": 0x1a, + "hsistemo": 0x1b, + "ijekavsk": 0x1c, + "itihasa": 0x1d, + "jauer": 0x1e, + "jyutping": 0x1f, + "kkcor": 0x20, + "kociewie": 0x21, + "kscor": 0x22, + "laukika": 0x23, + "lipaw": 0x49, + "luna1918": 0x24, + "metelko": 0x25, + "monoton": 0x26, + "ndyuka": 0x27, + "nedis": 0x28, + "newfound": 0x29, + "njiva": 0x4a, + "nulik": 0x2a, + "osojs": 0x4b, + "oxendict": 0x2b, + "pahawh2": 0x2c, + "pahawh3": 0x2d, + "pahawh4": 0x2e, + "pamaka": 0x2f, + "petr1708": 0x30, + "pinyin": 0x31, + "polyton": 0x32, + "puter": 0x33, + "rigik": 0x34, + "rozaj": 0x35, + "rumgr": 0x36, + "scotland": 0x37, + "scouse": 0x38, + "simple": 0x54, + "solba": 0x4c, + "sotav": 0x39, + "spanglis": 0x3a, + "surmiran": 0x3b, + "sursilv": 0x3c, + "sutsilv": 0x3d, + "tarask": 0x3e, + "uccor": 0x3f, + "ucrcor": 0x40, + "ulster": 0x41, + "unifon": 0x42, + "vaidika": 0x43, + "valencia": 0x44, + "vallader": 0x45, + "wadegile": 0x46, + "xsistemo": 0x47, +} + +// variantNumSpecialized is the number of specialized variants in variants. +const variantNumSpecialized = 79 + +// nRegionGroups is the number of region groups. +const nRegionGroups = 33 + +type likelyLangRegion struct { + lang uint16 + region uint16 +} + +// likelyScript is a lookup table, indexed by scriptID, for the most likely +// languages and regions given a script. +// Size: 976 bytes, 244 elements +var likelyScript = [244]likelyLangRegion{ + 1: {lang: 0x14e, region: 0x84}, + 3: {lang: 0x2a2, region: 0x106}, + 4: {lang: 0x1f, region: 0x99}, + 5: {lang: 0x3a, region: 0x6b}, + 7: {lang: 0x3b, region: 0x9c}, + 8: {lang: 0x1d7, region: 0x28}, + 9: {lang: 0x13, region: 0x9c}, + 10: {lang: 0x5b, region: 0x95}, + 11: {lang: 0x60, region: 0x52}, + 12: {lang: 0xb9, region: 0xb4}, + 13: {lang: 0x63, region: 0x95}, + 14: {lang: 0xa5, region: 0x35}, + 15: {lang: 0x3e9, region: 0x99}, + 17: {lang: 0x529, region: 0x12e}, + 18: {lang: 0x3b1, region: 0x99}, + 19: {lang: 0x15e, region: 0x78}, + 20: {lang: 0xc2, region: 0x95}, + 21: {lang: 0x9d, region: 0xe7}, + 22: {lang: 0xdb, region: 0x35}, + 23: {lang: 0xf3, region: 0x49}, + 24: {lang: 0x4f0, region: 0x12b}, + 25: {lang: 0xe7, region: 0x13e}, + 26: {lang: 0xe5, region: 0x135}, + 28: {lang: 0xf1, region: 0x6b}, + 30: {lang: 0x1a0, region: 0x5d}, + 31: {lang: 0x3e2, region: 0x106}, + 33: {lang: 0x1be, region: 0x99}, + 36: {lang: 0x15e, region: 0x78}, + 39: {lang: 0x133, region: 0x6b}, + 40: {lang: 0x431, region: 0x27}, + 41: {lang: 0x27, region: 0x6f}, + 43: {lang: 0x210, region: 0x7d}, + 44: {lang: 0xfe, region: 0x38}, + 46: {lang: 0x19b, region: 0x99}, + 47: {lang: 0x19e, region: 0x130}, + 48: {lang: 0x3e9, region: 0x99}, + 49: {lang: 0x136, region: 0x87}, + 50: {lang: 0x1a4, region: 0x99}, + 51: {lang: 0x39d, region: 0x99}, + 52: {lang: 0x529, region: 0x12e}, + 53: {lang: 0x254, region: 0xab}, + 54: {lang: 0x529, region: 0x53}, + 55: {lang: 0x1cb, region: 0xe7}, + 56: {lang: 0x529, region: 0x53}, + 57: {lang: 0x529, region: 0x12e}, + 58: {lang: 0x2fd, region: 0x9b}, + 59: {lang: 0x1bc, region: 0x97}, + 60: {lang: 0x200, region: 0xa2}, + 61: {lang: 0x1c5, region: 0x12b}, + 62: {lang: 0x1ca, region: 0xaf}, + 65: {lang: 0x1d5, region: 0x92}, + 67: {lang: 0x142, region: 0x9e}, + 68: {lang: 0x254, region: 0xab}, + 69: {lang: 0x20e, region: 0x95}, + 70: {lang: 0x200, region: 0xa2}, + 72: {lang: 0x135, region: 0xc4}, + 73: {lang: 0x200, region: 0xa2}, + 74: {lang: 0x3bb, region: 0xe8}, + 75: {lang: 0x24a, region: 0xa6}, + 76: {lang: 0x3fa, region: 0x99}, + 79: {lang: 0x251, region: 0x99}, + 80: {lang: 0x254, region: 0xab}, + 82: {lang: 0x88, region: 0x99}, + 83: {lang: 0x370, region: 0x123}, + 84: {lang: 0x2b8, region: 0xaf}, + 89: {lang: 0x29f, region: 0x99}, + 90: {lang: 0x2a8, region: 0x99}, + 91: {lang: 0x28f, region: 0x87}, + 92: {lang: 0x1a0, region: 0x87}, + 93: {lang: 0x2ac, region: 0x53}, + 95: {lang: 0x4f4, region: 0x12b}, + 96: {lang: 0x4f5, region: 0x12b}, + 97: {lang: 0x1be, region: 0x99}, + 99: {lang: 0x337, region: 0x9c}, + 100: {lang: 0x4f7, region: 0x53}, + 101: {lang: 0xa9, region: 0x53}, + 104: {lang: 0x2e8, region: 0x112}, + 105: {lang: 0x4f8, region: 0x10b}, + 106: {lang: 0x4f8, region: 0x10b}, + 107: {lang: 0x304, region: 0x99}, + 108: {lang: 0x31b, region: 0x99}, + 109: {lang: 0x30b, region: 0x53}, + 111: {lang: 0x31e, region: 0x35}, + 112: {lang: 0x30e, region: 0x99}, + 113: {lang: 0x414, region: 0xe8}, + 114: {lang: 0x331, region: 0xc4}, + 115: {lang: 0x4f9, region: 0x108}, + 116: {lang: 0x3b, region: 0xa1}, + 117: {lang: 0x353, region: 0xdb}, + 120: {lang: 0x2d0, region: 0x84}, + 121: {lang: 0x52a, region: 0x53}, + 122: {lang: 0x403, region: 0x96}, + 123: {lang: 0x3ee, region: 0x99}, + 124: {lang: 0x39b, region: 0xc5}, + 125: {lang: 0x395, region: 0x99}, + 126: {lang: 0x399, region: 0x135}, + 127: {lang: 0x429, region: 0x115}, + 128: {lang: 0x3b, region: 0x11c}, + 129: {lang: 0xfd, region: 0xc4}, + 130: {lang: 0x27d, region: 0x106}, + 131: {lang: 0x2c9, region: 0x53}, + 132: {lang: 0x39f, region: 0x9c}, + 133: {lang: 0x39f, region: 0x53}, + 135: {lang: 0x3ad, region: 0xb0}, + 137: {lang: 0x1c6, region: 0x53}, + 138: {lang: 0x4fd, region: 0x9c}, + 189: {lang: 0x3cb, region: 0x95}, + 191: {lang: 0x372, region: 0x10c}, + 192: {lang: 0x420, region: 0x97}, + 194: {lang: 0x4ff, region: 0x15e}, + 195: {lang: 0x3f0, region: 0x99}, + 196: {lang: 0x45, region: 0x135}, + 197: {lang: 0x139, region: 0x7b}, + 198: {lang: 0x3e9, region: 0x99}, + 200: {lang: 0x3e9, region: 0x99}, + 201: {lang: 0x3fa, region: 0x99}, + 202: {lang: 0x40c, region: 0xb3}, + 203: {lang: 0x433, region: 0x99}, + 204: {lang: 0xef, region: 0xc5}, + 205: {lang: 0x43e, region: 0x95}, + 206: {lang: 0x44d, region: 0x35}, + 207: {lang: 0x44e, region: 0x9b}, + 211: {lang: 0x45a, region: 0xe7}, + 212: {lang: 0x11a, region: 0x99}, + 213: {lang: 0x45e, region: 0x53}, + 214: {lang: 0x232, region: 0x53}, + 215: {lang: 0x450, region: 0x99}, + 216: {lang: 0x4a5, region: 0x53}, + 217: {lang: 0x9f, region: 0x13e}, + 218: {lang: 0x461, region: 0x99}, + 220: {lang: 0x528, region: 0xba}, + 221: {lang: 0x153, region: 0xe7}, + 222: {lang: 0x128, region: 0xcd}, + 223: {lang: 0x46b, region: 0x123}, + 224: {lang: 0xa9, region: 0x53}, + 225: {lang: 0x2ce, region: 0x99}, + 226: {lang: 0x4ad, region: 0x11c}, + 227: {lang: 0x4be, region: 0xb4}, + 229: {lang: 0x1ce, region: 0x99}, + 232: {lang: 0x3a9, region: 0x9c}, + 233: {lang: 0x22, region: 0x9b}, + 234: {lang: 0x1ea, region: 0x53}, + 235: {lang: 0xef, region: 0xc5}, +} + +type likelyScriptRegion struct { + region uint16 + script uint8 + flags uint8 +} + +// likelyLang is a lookup table, indexed by langID, for the most likely +// scripts and regions given incomplete information. If more entries exist for a +// given language, region and script are the index and size respectively +// of the list in likelyLangList. +// Size: 5320 bytes, 1330 elements +var likelyLang = [1330]likelyScriptRegion{ + 0: {region: 0x135, script: 0x57, flags: 0x0}, + 1: {region: 0x6f, script: 0x57, flags: 0x0}, + 2: {region: 0x165, script: 0x57, flags: 0x0}, + 3: {region: 0x165, script: 0x57, flags: 0x0}, + 4: {region: 0x165, script: 0x57, flags: 0x0}, + 5: {region: 0x7d, script: 0x1f, flags: 0x0}, + 6: {region: 0x165, script: 0x57, flags: 0x0}, + 7: {region: 0x165, script: 0x1f, flags: 0x0}, + 8: {region: 0x80, script: 0x57, flags: 0x0}, + 9: {region: 0x165, script: 0x57, flags: 0x0}, + 10: {region: 0x165, script: 0x57, flags: 0x0}, + 11: {region: 0x165, script: 0x57, flags: 0x0}, + 12: {region: 0x95, script: 0x57, flags: 0x0}, + 13: {region: 0x131, script: 0x57, flags: 0x0}, + 14: {region: 0x80, script: 0x57, flags: 0x0}, + 15: {region: 0x165, script: 0x57, flags: 0x0}, + 16: {region: 0x165, script: 0x57, flags: 0x0}, + 17: {region: 0x106, script: 0x1f, flags: 0x0}, + 18: {region: 0x165, script: 0x57, flags: 0x0}, + 19: {region: 0x9c, script: 0x9, flags: 0x0}, + 20: {region: 0x128, script: 0x5, flags: 0x0}, + 21: {region: 0x165, script: 0x57, flags: 0x0}, + 22: {region: 0x161, script: 0x57, flags: 0x0}, + 23: {region: 0x165, script: 0x57, flags: 0x0}, + 24: {region: 0x165, script: 0x57, flags: 0x0}, + 25: {region: 0x165, script: 0x57, flags: 0x0}, + 26: {region: 0x165, script: 0x57, flags: 0x0}, + 27: {region: 0x165, script: 0x57, flags: 0x0}, + 28: {region: 0x52, script: 0x57, flags: 0x0}, + 29: {region: 0x165, script: 0x57, flags: 0x0}, + 30: {region: 0x165, script: 0x57, flags: 0x0}, + 31: {region: 0x99, script: 0x4, flags: 0x0}, + 32: {region: 0x165, script: 0x57, flags: 0x0}, + 33: {region: 0x80, script: 0x57, flags: 0x0}, + 34: {region: 0x9b, script: 0xe9, flags: 0x0}, + 35: {region: 0x165, script: 0x57, flags: 0x0}, + 36: {region: 0x165, script: 0x57, flags: 0x0}, + 37: {region: 0x14d, script: 0x57, flags: 0x0}, + 38: {region: 0x106, script: 0x1f, flags: 0x0}, + 39: {region: 0x6f, script: 0x29, flags: 0x0}, + 40: {region: 0x165, script: 0x57, flags: 0x0}, + 41: {region: 0x165, script: 0x57, flags: 0x0}, + 42: {region: 0xd6, script: 0x57, flags: 0x0}, + 43: {region: 0x165, script: 0x57, flags: 0x0}, + 45: {region: 0x165, script: 0x57, flags: 0x0}, + 46: {region: 0x165, script: 0x57, flags: 0x0}, + 47: {region: 0x165, script: 0x57, flags: 0x0}, + 48: {region: 0x165, script: 0x57, flags: 0x0}, + 49: {region: 0x165, script: 0x57, flags: 0x0}, + 50: {region: 0x165, script: 0x57, flags: 0x0}, + 51: {region: 0x95, script: 0x57, flags: 0x0}, + 52: {region: 0x165, script: 0x5, flags: 0x0}, + 53: {region: 0x122, script: 0x5, flags: 0x0}, + 54: {region: 0x165, script: 0x57, flags: 0x0}, + 55: {region: 0x165, script: 0x57, flags: 0x0}, + 56: {region: 0x165, script: 0x57, flags: 0x0}, + 57: {region: 0x165, script: 0x57, flags: 0x0}, + 58: {region: 0x6b, script: 0x5, flags: 0x0}, + 59: {region: 0x0, script: 0x3, flags: 0x1}, + 60: {region: 0x165, script: 0x57, flags: 0x0}, + 61: {region: 0x51, script: 0x57, flags: 0x0}, + 62: {region: 0x3f, script: 0x57, flags: 0x0}, + 63: {region: 0x67, script: 0x5, flags: 0x0}, + 65: {region: 0xba, script: 0x5, flags: 0x0}, + 66: {region: 0x6b, script: 0x5, flags: 0x0}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0x12f, script: 0x57, flags: 0x0}, + 69: {region: 0x135, script: 0xc4, flags: 0x0}, + 70: {region: 0x165, script: 0x57, flags: 0x0}, + 71: {region: 0x165, script: 0x57, flags: 0x0}, + 72: {region: 0x6e, script: 0x57, flags: 0x0}, + 73: {region: 0x165, script: 0x57, flags: 0x0}, + 74: {region: 0x165, script: 0x57, flags: 0x0}, + 75: {region: 0x49, script: 0x57, flags: 0x0}, + 76: {region: 0x165, script: 0x57, flags: 0x0}, + 77: {region: 0x106, script: 0x1f, flags: 0x0}, + 78: {region: 0x165, script: 0x5, flags: 0x0}, + 79: {region: 0x165, script: 0x57, flags: 0x0}, + 80: {region: 0x165, script: 0x57, flags: 0x0}, + 81: {region: 0x165, script: 0x57, flags: 0x0}, + 82: {region: 0x99, script: 0x21, flags: 0x0}, + 83: {region: 0x165, script: 0x57, flags: 0x0}, + 84: {region: 0x165, script: 0x57, flags: 0x0}, + 85: {region: 0x165, script: 0x57, flags: 0x0}, + 86: {region: 0x3f, script: 0x57, flags: 0x0}, + 87: {region: 0x165, script: 0x57, flags: 0x0}, + 88: {region: 0x3, script: 0x5, flags: 0x1}, + 89: {region: 0x106, script: 0x1f, flags: 0x0}, + 90: {region: 0xe8, script: 0x5, flags: 0x0}, + 91: {region: 0x95, script: 0x57, flags: 0x0}, + 92: {region: 0xdb, script: 0x21, flags: 0x0}, + 93: {region: 0x2e, script: 0x57, flags: 0x0}, + 94: {region: 0x52, script: 0x57, flags: 0x0}, + 95: {region: 0x165, script: 0x57, flags: 0x0}, + 96: {region: 0x52, script: 0xb, flags: 0x0}, + 97: {region: 0x165, script: 0x57, flags: 0x0}, + 98: {region: 0x165, script: 0x57, flags: 0x0}, + 99: {region: 0x95, script: 0x57, flags: 0x0}, + 100: {region: 0x165, script: 0x57, flags: 0x0}, + 101: {region: 0x52, script: 0x57, flags: 0x0}, + 102: {region: 0x165, script: 0x57, flags: 0x0}, + 103: {region: 0x165, script: 0x57, flags: 0x0}, + 104: {region: 0x165, script: 0x57, flags: 0x0}, + 105: {region: 0x165, script: 0x57, flags: 0x0}, + 106: {region: 0x4f, script: 0x57, flags: 0x0}, + 107: {region: 0x165, script: 0x57, flags: 0x0}, + 108: {region: 0x165, script: 0x57, flags: 0x0}, + 109: {region: 0x165, script: 0x57, flags: 0x0}, + 110: {region: 0x165, script: 0x29, flags: 0x0}, + 111: {region: 0x165, script: 0x57, flags: 0x0}, + 112: {region: 0x165, script: 0x57, flags: 0x0}, + 113: {region: 0x47, script: 0x1f, flags: 0x0}, + 114: {region: 0x165, script: 0x57, flags: 0x0}, + 115: {region: 0x165, script: 0x57, flags: 0x0}, + 116: {region: 0x10b, script: 0x5, flags: 0x0}, + 117: {region: 0x162, script: 0x57, flags: 0x0}, + 118: {region: 0x165, script: 0x57, flags: 0x0}, + 119: {region: 0x95, script: 0x57, flags: 0x0}, + 120: {region: 0x165, script: 0x57, flags: 0x0}, + 121: {region: 0x12f, script: 0x57, flags: 0x0}, + 122: {region: 0x52, script: 0x57, flags: 0x0}, + 123: {region: 0x99, script: 0xd7, flags: 0x0}, + 124: {region: 0xe8, script: 0x5, flags: 0x0}, + 125: {region: 0x99, script: 0x21, flags: 0x0}, + 126: {region: 0x38, script: 0x1f, flags: 0x0}, + 127: {region: 0x99, script: 0x21, flags: 0x0}, + 128: {region: 0xe8, script: 0x5, flags: 0x0}, + 129: {region: 0x12b, script: 0x31, flags: 0x0}, + 131: {region: 0x99, script: 0x21, flags: 0x0}, + 132: {region: 0x165, script: 0x57, flags: 0x0}, + 133: {region: 0x99, script: 0x21, flags: 0x0}, + 134: {region: 0xe7, script: 0x57, flags: 0x0}, + 135: {region: 0x165, script: 0x57, flags: 0x0}, + 136: {region: 0x99, script: 0x21, flags: 0x0}, + 137: {region: 0x165, script: 0x57, flags: 0x0}, + 138: {region: 0x13f, script: 0x57, flags: 0x0}, + 139: {region: 0x165, script: 0x57, flags: 0x0}, + 140: {region: 0x165, script: 0x57, flags: 0x0}, + 141: {region: 0xe7, script: 0x57, flags: 0x0}, + 142: {region: 0x165, script: 0x57, flags: 0x0}, + 143: {region: 0xd6, script: 0x57, flags: 0x0}, + 144: {region: 0x165, script: 0x57, flags: 0x0}, + 145: {region: 0x165, script: 0x57, flags: 0x0}, + 146: {region: 0x165, script: 0x57, flags: 0x0}, + 147: {region: 0x165, script: 0x29, flags: 0x0}, + 148: {region: 0x99, script: 0x21, flags: 0x0}, + 149: {region: 0x95, script: 0x57, flags: 0x0}, + 150: {region: 0x165, script: 0x57, flags: 0x0}, + 151: {region: 0x165, script: 0x57, flags: 0x0}, + 152: {region: 0x114, script: 0x57, flags: 0x0}, + 153: {region: 0x165, script: 0x57, flags: 0x0}, + 154: {region: 0x165, script: 0x57, flags: 0x0}, + 155: {region: 0x52, script: 0x57, flags: 0x0}, + 156: {region: 0x165, script: 0x57, flags: 0x0}, + 157: {region: 0xe7, script: 0x57, flags: 0x0}, + 158: {region: 0x165, script: 0x57, flags: 0x0}, + 159: {region: 0x13e, script: 0xd9, flags: 0x0}, + 160: {region: 0xc3, script: 0x57, flags: 0x0}, + 161: {region: 0x165, script: 0x57, flags: 0x0}, + 162: {region: 0x165, script: 0x57, flags: 0x0}, + 163: {region: 0xc3, script: 0x57, flags: 0x0}, + 164: {region: 0x165, script: 0x57, flags: 0x0}, + 165: {region: 0x35, script: 0xe, flags: 0x0}, + 166: {region: 0x165, script: 0x57, flags: 0x0}, + 167: {region: 0x165, script: 0x57, flags: 0x0}, + 168: {region: 0x165, script: 0x57, flags: 0x0}, + 169: {region: 0x53, script: 0xe0, flags: 0x0}, + 170: {region: 0x165, script: 0x57, flags: 0x0}, + 171: {region: 0x165, script: 0x57, flags: 0x0}, + 172: {region: 0x165, script: 0x57, flags: 0x0}, + 173: {region: 0x99, script: 0xe, flags: 0x0}, + 174: {region: 0x165, script: 0x57, flags: 0x0}, + 175: {region: 0x9c, script: 0x5, flags: 0x0}, + 176: {region: 0x165, script: 0x57, flags: 0x0}, + 177: {region: 0x4f, script: 0x57, flags: 0x0}, + 178: {region: 0x78, script: 0x57, flags: 0x0}, + 179: {region: 0x99, script: 0x21, flags: 0x0}, + 180: {region: 0xe8, script: 0x5, flags: 0x0}, + 181: {region: 0x99, script: 0x21, flags: 0x0}, + 182: {region: 0x165, script: 0x57, flags: 0x0}, + 183: {region: 0x33, script: 0x57, flags: 0x0}, + 184: {region: 0x165, script: 0x57, flags: 0x0}, + 185: {region: 0xb4, script: 0xc, flags: 0x0}, + 186: {region: 0x52, script: 0x57, flags: 0x0}, + 187: {region: 0x165, script: 0x29, flags: 0x0}, + 188: {region: 0xe7, script: 0x57, flags: 0x0}, + 189: {region: 0x165, script: 0x57, flags: 0x0}, + 190: {region: 0xe8, script: 0x21, flags: 0x0}, + 191: {region: 0x106, script: 0x1f, flags: 0x0}, + 192: {region: 0x15f, script: 0x57, flags: 0x0}, + 193: {region: 0x165, script: 0x57, flags: 0x0}, + 194: {region: 0x95, script: 0x57, flags: 0x0}, + 195: {region: 0x165, script: 0x57, flags: 0x0}, + 196: {region: 0x52, script: 0x57, flags: 0x0}, + 197: {region: 0x165, script: 0x57, flags: 0x0}, + 198: {region: 0x165, script: 0x57, flags: 0x0}, + 199: {region: 0x165, script: 0x57, flags: 0x0}, + 200: {region: 0x86, script: 0x57, flags: 0x0}, + 201: {region: 0x165, script: 0x57, flags: 0x0}, + 202: {region: 0x165, script: 0x57, flags: 0x0}, + 203: {region: 0x165, script: 0x57, flags: 0x0}, + 204: {region: 0x165, script: 0x57, flags: 0x0}, + 205: {region: 0x6d, script: 0x29, flags: 0x0}, + 206: {region: 0x165, script: 0x57, flags: 0x0}, + 207: {region: 0x165, script: 0x57, flags: 0x0}, + 208: {region: 0x52, script: 0x57, flags: 0x0}, + 209: {region: 0x165, script: 0x57, flags: 0x0}, + 210: {region: 0x165, script: 0x57, flags: 0x0}, + 211: {region: 0xc3, script: 0x57, flags: 0x0}, + 212: {region: 0x165, script: 0x57, flags: 0x0}, + 213: {region: 0x165, script: 0x57, flags: 0x0}, + 214: {region: 0x165, script: 0x57, flags: 0x0}, + 215: {region: 0x6e, script: 0x57, flags: 0x0}, + 216: {region: 0x165, script: 0x57, flags: 0x0}, + 217: {region: 0x165, script: 0x57, flags: 0x0}, + 218: {region: 0xd6, script: 0x57, flags: 0x0}, + 219: {region: 0x35, script: 0x16, flags: 0x0}, + 220: {region: 0x106, script: 0x1f, flags: 0x0}, + 221: {region: 0xe7, script: 0x57, flags: 0x0}, + 222: {region: 0x165, script: 0x57, flags: 0x0}, + 223: {region: 0x131, script: 0x57, flags: 0x0}, + 224: {region: 0x8a, script: 0x57, flags: 0x0}, + 225: {region: 0x75, script: 0x57, flags: 0x0}, + 226: {region: 0x106, script: 0x1f, flags: 0x0}, + 227: {region: 0x135, script: 0x57, flags: 0x0}, + 228: {region: 0x49, script: 0x57, flags: 0x0}, + 229: {region: 0x135, script: 0x1a, flags: 0x0}, + 230: {region: 0xa6, script: 0x5, flags: 0x0}, + 231: {region: 0x13e, script: 0x19, flags: 0x0}, + 232: {region: 0x165, script: 0x57, flags: 0x0}, + 233: {region: 0x9b, script: 0x5, flags: 0x0}, + 234: {region: 0x165, script: 0x57, flags: 0x0}, + 235: {region: 0x165, script: 0x57, flags: 0x0}, + 236: {region: 0x165, script: 0x57, flags: 0x0}, + 237: {region: 0x165, script: 0x57, flags: 0x0}, + 238: {region: 0x165, script: 0x57, flags: 0x0}, + 239: {region: 0xc5, script: 0xcc, flags: 0x0}, + 240: {region: 0x78, script: 0x57, flags: 0x0}, + 241: {region: 0x6b, script: 0x1c, flags: 0x0}, + 242: {region: 0xe7, script: 0x57, flags: 0x0}, + 243: {region: 0x49, script: 0x17, flags: 0x0}, + 244: {region: 0x130, script: 0x1f, flags: 0x0}, + 245: {region: 0x49, script: 0x17, flags: 0x0}, + 246: {region: 0x49, script: 0x17, flags: 0x0}, + 247: {region: 0x49, script: 0x17, flags: 0x0}, + 248: {region: 0x49, script: 0x17, flags: 0x0}, + 249: {region: 0x10a, script: 0x57, flags: 0x0}, + 250: {region: 0x5e, script: 0x57, flags: 0x0}, + 251: {region: 0xe9, script: 0x57, flags: 0x0}, + 252: {region: 0x49, script: 0x17, flags: 0x0}, + 253: {region: 0xc4, script: 0x81, flags: 0x0}, + 254: {region: 0x8, script: 0x2, flags: 0x1}, + 255: {region: 0x106, script: 0x1f, flags: 0x0}, + 256: {region: 0x7b, script: 0x57, flags: 0x0}, + 257: {region: 0x63, script: 0x57, flags: 0x0}, + 258: {region: 0x165, script: 0x57, flags: 0x0}, + 259: {region: 0x165, script: 0x57, flags: 0x0}, + 260: {region: 0x165, script: 0x57, flags: 0x0}, + 261: {region: 0x165, script: 0x57, flags: 0x0}, + 262: {region: 0x135, script: 0x57, flags: 0x0}, + 263: {region: 0x106, script: 0x1f, flags: 0x0}, + 264: {region: 0xa4, script: 0x57, flags: 0x0}, + 265: {region: 0x165, script: 0x57, flags: 0x0}, + 266: {region: 0x165, script: 0x57, flags: 0x0}, + 267: {region: 0x99, script: 0x5, flags: 0x0}, + 268: {region: 0x165, script: 0x57, flags: 0x0}, + 269: {region: 0x60, script: 0x57, flags: 0x0}, + 270: {region: 0x165, script: 0x57, flags: 0x0}, + 271: {region: 0x49, script: 0x57, flags: 0x0}, + 272: {region: 0x165, script: 0x57, flags: 0x0}, + 273: {region: 0x165, script: 0x57, flags: 0x0}, + 274: {region: 0x165, script: 0x57, flags: 0x0}, + 275: {region: 0x165, script: 0x5, flags: 0x0}, + 276: {region: 0x49, script: 0x57, flags: 0x0}, + 277: {region: 0x165, script: 0x57, flags: 0x0}, + 278: {region: 0x165, script: 0x57, flags: 0x0}, + 279: {region: 0xd4, script: 0x57, flags: 0x0}, + 280: {region: 0x4f, script: 0x57, flags: 0x0}, + 281: {region: 0x165, script: 0x57, flags: 0x0}, + 282: {region: 0x99, script: 0x5, flags: 0x0}, + 283: {region: 0x165, script: 0x57, flags: 0x0}, + 284: {region: 0x165, script: 0x57, flags: 0x0}, + 285: {region: 0x165, script: 0x57, flags: 0x0}, + 286: {region: 0x165, script: 0x29, flags: 0x0}, + 287: {region: 0x60, script: 0x57, flags: 0x0}, + 288: {region: 0xc3, script: 0x57, flags: 0x0}, + 289: {region: 0xd0, script: 0x57, flags: 0x0}, + 290: {region: 0x165, script: 0x57, flags: 0x0}, + 291: {region: 0xdb, script: 0x21, flags: 0x0}, + 292: {region: 0x52, script: 0x57, flags: 0x0}, + 293: {region: 0x165, script: 0x57, flags: 0x0}, + 294: {region: 0x165, script: 0x57, flags: 0x0}, + 295: {region: 0x165, script: 0x57, flags: 0x0}, + 296: {region: 0xcd, script: 0xde, flags: 0x0}, + 297: {region: 0x165, script: 0x57, flags: 0x0}, + 298: {region: 0x165, script: 0x57, flags: 0x0}, + 299: {region: 0x114, script: 0x57, flags: 0x0}, + 300: {region: 0x37, script: 0x57, flags: 0x0}, + 301: {region: 0x43, script: 0xe0, flags: 0x0}, + 302: {region: 0x165, script: 0x57, flags: 0x0}, + 303: {region: 0xa4, script: 0x57, flags: 0x0}, + 304: {region: 0x80, script: 0x57, flags: 0x0}, + 305: {region: 0xd6, script: 0x57, flags: 0x0}, + 306: {region: 0x9e, script: 0x57, flags: 0x0}, + 307: {region: 0x6b, script: 0x27, flags: 0x0}, + 308: {region: 0x165, script: 0x57, flags: 0x0}, + 309: {region: 0xc4, script: 0x48, flags: 0x0}, + 310: {region: 0x87, script: 0x31, flags: 0x0}, + 311: {region: 0x165, script: 0x57, flags: 0x0}, + 312: {region: 0x165, script: 0x57, flags: 0x0}, + 313: {region: 0xa, script: 0x2, flags: 0x1}, + 314: {region: 0x165, script: 0x57, flags: 0x0}, + 315: {region: 0x165, script: 0x57, flags: 0x0}, + 316: {region: 0x1, script: 0x57, flags: 0x0}, + 317: {region: 0x165, script: 0x57, flags: 0x0}, + 318: {region: 0x6e, script: 0x57, flags: 0x0}, + 319: {region: 0x135, script: 0x57, flags: 0x0}, + 320: {region: 0x6a, script: 0x57, flags: 0x0}, + 321: {region: 0x165, script: 0x57, flags: 0x0}, + 322: {region: 0x9e, script: 0x43, flags: 0x0}, + 323: {region: 0x165, script: 0x57, flags: 0x0}, + 324: {region: 0x165, script: 0x57, flags: 0x0}, + 325: {region: 0x6e, script: 0x57, flags: 0x0}, + 326: {region: 0x52, script: 0x57, flags: 0x0}, + 327: {region: 0x6e, script: 0x57, flags: 0x0}, + 328: {region: 0x9c, script: 0x5, flags: 0x0}, + 329: {region: 0x165, script: 0x57, flags: 0x0}, + 330: {region: 0x165, script: 0x57, flags: 0x0}, + 331: {region: 0x165, script: 0x57, flags: 0x0}, + 332: {region: 0x165, script: 0x57, flags: 0x0}, + 333: {region: 0x86, script: 0x57, flags: 0x0}, + 334: {region: 0xc, script: 0x2, flags: 0x1}, + 335: {region: 0x165, script: 0x57, flags: 0x0}, + 336: {region: 0xc3, script: 0x57, flags: 0x0}, + 337: {region: 0x72, script: 0x57, flags: 0x0}, + 338: {region: 0x10b, script: 0x5, flags: 0x0}, + 339: {region: 0xe7, script: 0x57, flags: 0x0}, + 340: {region: 0x10c, script: 0x57, flags: 0x0}, + 341: {region: 0x73, script: 0x57, flags: 0x0}, + 342: {region: 0x165, script: 0x57, flags: 0x0}, + 343: {region: 0x165, script: 0x57, flags: 0x0}, + 344: {region: 0x76, script: 0x57, flags: 0x0}, + 345: {region: 0x165, script: 0x57, flags: 0x0}, + 346: {region: 0x3b, script: 0x57, flags: 0x0}, + 347: {region: 0x165, script: 0x57, flags: 0x0}, + 348: {region: 0x165, script: 0x57, flags: 0x0}, + 349: {region: 0x165, script: 0x57, flags: 0x0}, + 350: {region: 0x78, script: 0x57, flags: 0x0}, + 351: {region: 0x135, script: 0x57, flags: 0x0}, + 352: {region: 0x78, script: 0x57, flags: 0x0}, + 353: {region: 0x60, script: 0x57, flags: 0x0}, + 354: {region: 0x60, script: 0x57, flags: 0x0}, + 355: {region: 0x52, script: 0x5, flags: 0x0}, + 356: {region: 0x140, script: 0x57, flags: 0x0}, + 357: {region: 0x165, script: 0x57, flags: 0x0}, + 358: {region: 0x84, script: 0x57, flags: 0x0}, + 359: {region: 0x165, script: 0x57, flags: 0x0}, + 360: {region: 0xd4, script: 0x57, flags: 0x0}, + 361: {region: 0x9e, script: 0x57, flags: 0x0}, + 362: {region: 0xd6, script: 0x57, flags: 0x0}, + 363: {region: 0x165, script: 0x57, flags: 0x0}, + 364: {region: 0x10b, script: 0x57, flags: 0x0}, + 365: {region: 0xd9, script: 0x57, flags: 0x0}, + 366: {region: 0x96, script: 0x57, flags: 0x0}, + 367: {region: 0x80, script: 0x57, flags: 0x0}, + 368: {region: 0x165, script: 0x57, flags: 0x0}, + 369: {region: 0xbc, script: 0x57, flags: 0x0}, + 370: {region: 0x165, script: 0x57, flags: 0x0}, + 371: {region: 0x165, script: 0x57, flags: 0x0}, + 372: {region: 0x165, script: 0x57, flags: 0x0}, + 373: {region: 0x53, script: 0x38, flags: 0x0}, + 374: {region: 0x165, script: 0x57, flags: 0x0}, + 375: {region: 0x95, script: 0x57, flags: 0x0}, + 376: {region: 0x165, script: 0x57, flags: 0x0}, + 377: {region: 0x165, script: 0x57, flags: 0x0}, + 378: {region: 0x99, script: 0x21, flags: 0x0}, + 379: {region: 0x165, script: 0x57, flags: 0x0}, + 380: {region: 0x9c, script: 0x5, flags: 0x0}, + 381: {region: 0x7e, script: 0x57, flags: 0x0}, + 382: {region: 0x7b, script: 0x57, flags: 0x0}, + 383: {region: 0x165, script: 0x57, flags: 0x0}, + 384: {region: 0x165, script: 0x57, flags: 0x0}, + 385: {region: 0x165, script: 0x57, flags: 0x0}, + 386: {region: 0x165, script: 0x57, flags: 0x0}, + 387: {region: 0x165, script: 0x57, flags: 0x0}, + 388: {region: 0x165, script: 0x57, flags: 0x0}, + 389: {region: 0x6f, script: 0x29, flags: 0x0}, + 390: {region: 0x165, script: 0x57, flags: 0x0}, + 391: {region: 0xdb, script: 0x21, flags: 0x0}, + 392: {region: 0x165, script: 0x57, flags: 0x0}, + 393: {region: 0xa7, script: 0x57, flags: 0x0}, + 394: {region: 0x165, script: 0x57, flags: 0x0}, + 395: {region: 0xe8, script: 0x5, flags: 0x0}, + 396: {region: 0x165, script: 0x57, flags: 0x0}, + 397: {region: 0xe8, script: 0x5, flags: 0x0}, + 398: {region: 0x165, script: 0x57, flags: 0x0}, + 399: {region: 0x165, script: 0x57, flags: 0x0}, + 400: {region: 0x6e, script: 0x57, flags: 0x0}, + 401: {region: 0x9c, script: 0x5, flags: 0x0}, + 402: {region: 0x165, script: 0x57, flags: 0x0}, + 403: {region: 0x165, script: 0x29, flags: 0x0}, + 404: {region: 0xf1, script: 0x57, flags: 0x0}, + 405: {region: 0x165, script: 0x57, flags: 0x0}, + 406: {region: 0x165, script: 0x57, flags: 0x0}, + 407: {region: 0x165, script: 0x57, flags: 0x0}, + 408: {region: 0x165, script: 0x29, flags: 0x0}, + 409: {region: 0x165, script: 0x57, flags: 0x0}, + 410: {region: 0x99, script: 0x21, flags: 0x0}, + 411: {region: 0x99, script: 0xda, flags: 0x0}, + 412: {region: 0x95, script: 0x57, flags: 0x0}, + 413: {region: 0xd9, script: 0x57, flags: 0x0}, + 414: {region: 0x130, script: 0x2f, flags: 0x0}, + 415: {region: 0x165, script: 0x57, flags: 0x0}, + 416: {region: 0xe, script: 0x2, flags: 0x1}, + 417: {region: 0x99, script: 0xe, flags: 0x0}, + 418: {region: 0x165, script: 0x57, flags: 0x0}, + 419: {region: 0x4e, script: 0x57, flags: 0x0}, + 420: {region: 0x99, script: 0x32, flags: 0x0}, + 421: {region: 0x41, script: 0x57, flags: 0x0}, + 422: {region: 0x54, script: 0x57, flags: 0x0}, + 423: {region: 0x165, script: 0x57, flags: 0x0}, + 424: {region: 0x80, script: 0x57, flags: 0x0}, + 425: {region: 0x165, script: 0x57, flags: 0x0}, + 426: {region: 0x165, script: 0x57, flags: 0x0}, + 427: {region: 0xa4, script: 0x57, flags: 0x0}, + 428: {region: 0x98, script: 0x57, flags: 0x0}, + 429: {region: 0x165, script: 0x57, flags: 0x0}, + 430: {region: 0xdb, script: 0x21, flags: 0x0}, + 431: {region: 0x165, script: 0x57, flags: 0x0}, + 432: {region: 0x165, script: 0x5, flags: 0x0}, + 433: {region: 0x49, script: 0x57, flags: 0x0}, + 434: {region: 0x165, script: 0x5, flags: 0x0}, + 435: {region: 0x165, script: 0x57, flags: 0x0}, + 436: {region: 0x10, script: 0x3, flags: 0x1}, + 437: {region: 0x165, script: 0x57, flags: 0x0}, + 438: {region: 0x53, script: 0x38, flags: 0x0}, + 439: {region: 0x165, script: 0x57, flags: 0x0}, + 440: {region: 0x135, script: 0x57, flags: 0x0}, + 441: {region: 0x24, script: 0x5, flags: 0x0}, + 442: {region: 0x165, script: 0x57, flags: 0x0}, + 443: {region: 0x165, script: 0x29, flags: 0x0}, + 444: {region: 0x97, script: 0x3b, flags: 0x0}, + 445: {region: 0x165, script: 0x57, flags: 0x0}, + 446: {region: 0x99, script: 0x21, flags: 0x0}, + 447: {region: 0x165, script: 0x57, flags: 0x0}, + 448: {region: 0x73, script: 0x57, flags: 0x0}, + 449: {region: 0x165, script: 0x57, flags: 0x0}, + 450: {region: 0x165, script: 0x57, flags: 0x0}, + 451: {region: 0xe7, script: 0x57, flags: 0x0}, + 452: {region: 0x165, script: 0x57, flags: 0x0}, + 453: {region: 0x12b, script: 0x3d, flags: 0x0}, + 454: {region: 0x53, script: 0x89, flags: 0x0}, + 455: {region: 0x165, script: 0x57, flags: 0x0}, + 456: {region: 0xe8, script: 0x5, flags: 0x0}, + 457: {region: 0x99, script: 0x21, flags: 0x0}, + 458: {region: 0xaf, script: 0x3e, flags: 0x0}, + 459: {region: 0xe7, script: 0x57, flags: 0x0}, + 460: {region: 0xe8, script: 0x5, flags: 0x0}, + 461: {region: 0xe6, script: 0x57, flags: 0x0}, + 462: {region: 0x99, script: 0x21, flags: 0x0}, + 463: {region: 0x99, script: 0x21, flags: 0x0}, + 464: {region: 0x165, script: 0x57, flags: 0x0}, + 465: {region: 0x90, script: 0x57, flags: 0x0}, + 466: {region: 0x60, script: 0x57, flags: 0x0}, + 467: {region: 0x53, script: 0x38, flags: 0x0}, + 468: {region: 0x91, script: 0x57, flags: 0x0}, + 469: {region: 0x92, script: 0x57, flags: 0x0}, + 470: {region: 0x165, script: 0x57, flags: 0x0}, + 471: {region: 0x28, script: 0x8, flags: 0x0}, + 472: {region: 0xd2, script: 0x57, flags: 0x0}, + 473: {region: 0x78, script: 0x57, flags: 0x0}, + 474: {region: 0x165, script: 0x57, flags: 0x0}, + 475: {region: 0x165, script: 0x57, flags: 0x0}, + 476: {region: 0xd0, script: 0x57, flags: 0x0}, + 477: {region: 0xd6, script: 0x57, flags: 0x0}, + 478: {region: 0x165, script: 0x57, flags: 0x0}, + 479: {region: 0x165, script: 0x57, flags: 0x0}, + 480: {region: 0x165, script: 0x57, flags: 0x0}, + 481: {region: 0x95, script: 0x57, flags: 0x0}, + 482: {region: 0x165, script: 0x57, flags: 0x0}, + 483: {region: 0x165, script: 0x57, flags: 0x0}, + 484: {region: 0x165, script: 0x57, flags: 0x0}, + 486: {region: 0x122, script: 0x57, flags: 0x0}, + 487: {region: 0xd6, script: 0x57, flags: 0x0}, + 488: {region: 0x165, script: 0x57, flags: 0x0}, + 489: {region: 0x165, script: 0x57, flags: 0x0}, + 490: {region: 0x53, script: 0xea, flags: 0x0}, + 491: {region: 0x165, script: 0x57, flags: 0x0}, + 492: {region: 0x135, script: 0x57, flags: 0x0}, + 493: {region: 0x165, script: 0x57, flags: 0x0}, + 494: {region: 0x49, script: 0x57, flags: 0x0}, + 495: {region: 0x165, script: 0x57, flags: 0x0}, + 496: {region: 0x165, script: 0x57, flags: 0x0}, + 497: {region: 0xe7, script: 0x57, flags: 0x0}, + 498: {region: 0x165, script: 0x57, flags: 0x0}, + 499: {region: 0x95, script: 0x57, flags: 0x0}, + 500: {region: 0x106, script: 0x1f, flags: 0x0}, + 501: {region: 0x1, script: 0x57, flags: 0x0}, + 502: {region: 0x165, script: 0x57, flags: 0x0}, + 503: {region: 0x165, script: 0x57, flags: 0x0}, + 504: {region: 0x9d, script: 0x57, flags: 0x0}, + 505: {region: 0x9e, script: 0x57, flags: 0x0}, + 506: {region: 0x49, script: 0x17, flags: 0x0}, + 507: {region: 0x97, script: 0x3b, flags: 0x0}, + 508: {region: 0x165, script: 0x57, flags: 0x0}, + 509: {region: 0x165, script: 0x57, flags: 0x0}, + 510: {region: 0x106, script: 0x57, flags: 0x0}, + 511: {region: 0x165, script: 0x57, flags: 0x0}, + 512: {region: 0xa2, script: 0x46, flags: 0x0}, + 513: {region: 0x165, script: 0x57, flags: 0x0}, + 514: {region: 0xa0, script: 0x57, flags: 0x0}, + 515: {region: 0x1, script: 0x57, flags: 0x0}, + 516: {region: 0x165, script: 0x57, flags: 0x0}, + 517: {region: 0x165, script: 0x57, flags: 0x0}, + 518: {region: 0x165, script: 0x57, flags: 0x0}, + 519: {region: 0x52, script: 0x57, flags: 0x0}, + 520: {region: 0x130, script: 0x3b, flags: 0x0}, + 521: {region: 0x165, script: 0x57, flags: 0x0}, + 522: {region: 0x12f, script: 0x57, flags: 0x0}, + 523: {region: 0xdb, script: 0x21, flags: 0x0}, + 524: {region: 0x165, script: 0x57, flags: 0x0}, + 525: {region: 0x63, script: 0x57, flags: 0x0}, + 526: {region: 0x95, script: 0x57, flags: 0x0}, + 527: {region: 0x95, script: 0x57, flags: 0x0}, + 528: {region: 0x7d, script: 0x2b, flags: 0x0}, + 529: {region: 0x137, script: 0x1f, flags: 0x0}, + 530: {region: 0x67, script: 0x57, flags: 0x0}, + 531: {region: 0xc4, script: 0x57, flags: 0x0}, + 532: {region: 0x165, script: 0x57, flags: 0x0}, + 533: {region: 0x165, script: 0x57, flags: 0x0}, + 534: {region: 0xd6, script: 0x57, flags: 0x0}, + 535: {region: 0xa4, script: 0x57, flags: 0x0}, + 536: {region: 0xc3, script: 0x57, flags: 0x0}, + 537: {region: 0x106, script: 0x1f, flags: 0x0}, + 538: {region: 0x165, script: 0x57, flags: 0x0}, + 539: {region: 0x165, script: 0x57, flags: 0x0}, + 540: {region: 0x165, script: 0x57, flags: 0x0}, + 541: {region: 0x165, script: 0x57, flags: 0x0}, + 542: {region: 0xd4, script: 0x5, flags: 0x0}, + 543: {region: 0xd6, script: 0x57, flags: 0x0}, + 544: {region: 0x164, script: 0x57, flags: 0x0}, + 545: {region: 0x165, script: 0x57, flags: 0x0}, + 546: {region: 0x165, script: 0x57, flags: 0x0}, + 547: {region: 0x12f, script: 0x57, flags: 0x0}, + 548: {region: 0x122, script: 0x5, flags: 0x0}, + 549: {region: 0x165, script: 0x57, flags: 0x0}, + 550: {region: 0x123, script: 0xdf, flags: 0x0}, + 551: {region: 0x5a, script: 0x57, flags: 0x0}, + 552: {region: 0x52, script: 0x57, flags: 0x0}, + 553: {region: 0x165, script: 0x57, flags: 0x0}, + 554: {region: 0x4f, script: 0x57, flags: 0x0}, + 555: {region: 0x99, script: 0x21, flags: 0x0}, + 556: {region: 0x99, script: 0x21, flags: 0x0}, + 557: {region: 0x4b, script: 0x57, flags: 0x0}, + 558: {region: 0x95, script: 0x57, flags: 0x0}, + 559: {region: 0x165, script: 0x57, flags: 0x0}, + 560: {region: 0x41, script: 0x57, flags: 0x0}, + 561: {region: 0x99, script: 0x57, flags: 0x0}, + 562: {region: 0x53, script: 0xd6, flags: 0x0}, + 563: {region: 0x99, script: 0x21, flags: 0x0}, + 564: {region: 0xc3, script: 0x57, flags: 0x0}, + 565: {region: 0x165, script: 0x57, flags: 0x0}, + 566: {region: 0x99, script: 0x72, flags: 0x0}, + 567: {region: 0xe8, script: 0x5, flags: 0x0}, + 568: {region: 0x165, script: 0x57, flags: 0x0}, + 569: {region: 0xa4, script: 0x57, flags: 0x0}, + 570: {region: 0x165, script: 0x57, flags: 0x0}, + 571: {region: 0x12b, script: 0x57, flags: 0x0}, + 572: {region: 0x165, script: 0x57, flags: 0x0}, + 573: {region: 0xd2, script: 0x57, flags: 0x0}, + 574: {region: 0x165, script: 0x57, flags: 0x0}, + 575: {region: 0xaf, script: 0x54, flags: 0x0}, + 576: {region: 0x165, script: 0x57, flags: 0x0}, + 577: {region: 0x165, script: 0x57, flags: 0x0}, + 578: {region: 0x13, script: 0x6, flags: 0x1}, + 579: {region: 0x165, script: 0x57, flags: 0x0}, + 580: {region: 0x52, script: 0x57, flags: 0x0}, + 581: {region: 0x82, script: 0x57, flags: 0x0}, + 582: {region: 0xa4, script: 0x57, flags: 0x0}, + 583: {region: 0x165, script: 0x57, flags: 0x0}, + 584: {region: 0x165, script: 0x57, flags: 0x0}, + 585: {region: 0x165, script: 0x57, flags: 0x0}, + 586: {region: 0xa6, script: 0x4b, flags: 0x0}, + 587: {region: 0x2a, script: 0x57, flags: 0x0}, + 588: {region: 0x165, script: 0x57, flags: 0x0}, + 589: {region: 0x165, script: 0x57, flags: 0x0}, + 590: {region: 0x165, script: 0x57, flags: 0x0}, + 591: {region: 0x165, script: 0x57, flags: 0x0}, + 592: {region: 0x165, script: 0x57, flags: 0x0}, + 593: {region: 0x99, script: 0x4f, flags: 0x0}, + 594: {region: 0x8b, script: 0x57, flags: 0x0}, + 595: {region: 0x165, script: 0x57, flags: 0x0}, + 596: {region: 0xab, script: 0x50, flags: 0x0}, + 597: {region: 0x106, script: 0x1f, flags: 0x0}, + 598: {region: 0x99, script: 0x21, flags: 0x0}, + 599: {region: 0x165, script: 0x57, flags: 0x0}, + 600: {region: 0x75, script: 0x57, flags: 0x0}, + 601: {region: 0x165, script: 0x57, flags: 0x0}, + 602: {region: 0xb4, script: 0x57, flags: 0x0}, + 603: {region: 0x165, script: 0x57, flags: 0x0}, + 604: {region: 0x165, script: 0x57, flags: 0x0}, + 605: {region: 0x165, script: 0x57, flags: 0x0}, + 606: {region: 0x165, script: 0x57, flags: 0x0}, + 607: {region: 0x165, script: 0x57, flags: 0x0}, + 608: {region: 0x165, script: 0x57, flags: 0x0}, + 609: {region: 0x165, script: 0x57, flags: 0x0}, + 610: {region: 0x165, script: 0x29, flags: 0x0}, + 611: {region: 0x165, script: 0x57, flags: 0x0}, + 612: {region: 0x106, script: 0x1f, flags: 0x0}, + 613: {region: 0x112, script: 0x57, flags: 0x0}, + 614: {region: 0xe7, script: 0x57, flags: 0x0}, + 615: {region: 0x106, script: 0x57, flags: 0x0}, + 616: {region: 0x165, script: 0x57, flags: 0x0}, + 617: {region: 0x99, script: 0x21, flags: 0x0}, + 618: {region: 0x99, script: 0x5, flags: 0x0}, + 619: {region: 0x12f, script: 0x57, flags: 0x0}, + 620: {region: 0x165, script: 0x57, flags: 0x0}, + 621: {region: 0x52, script: 0x57, flags: 0x0}, + 622: {region: 0x60, script: 0x57, flags: 0x0}, + 623: {region: 0x165, script: 0x57, flags: 0x0}, + 624: {region: 0x165, script: 0x57, flags: 0x0}, + 625: {region: 0x165, script: 0x29, flags: 0x0}, + 626: {region: 0x165, script: 0x57, flags: 0x0}, + 627: {region: 0x165, script: 0x57, flags: 0x0}, + 628: {region: 0x19, script: 0x3, flags: 0x1}, + 629: {region: 0x165, script: 0x57, flags: 0x0}, + 630: {region: 0x165, script: 0x57, flags: 0x0}, + 631: {region: 0x165, script: 0x57, flags: 0x0}, + 632: {region: 0x165, script: 0x57, flags: 0x0}, + 633: {region: 0x106, script: 0x1f, flags: 0x0}, + 634: {region: 0x165, script: 0x57, flags: 0x0}, + 635: {region: 0x165, script: 0x57, flags: 0x0}, + 636: {region: 0x165, script: 0x57, flags: 0x0}, + 637: {region: 0x106, script: 0x1f, flags: 0x0}, + 638: {region: 0x165, script: 0x57, flags: 0x0}, + 639: {region: 0x95, script: 0x57, flags: 0x0}, + 640: {region: 0xe8, script: 0x5, flags: 0x0}, + 641: {region: 0x7b, script: 0x57, flags: 0x0}, + 642: {region: 0x165, script: 0x57, flags: 0x0}, + 643: {region: 0x165, script: 0x57, flags: 0x0}, + 644: {region: 0x165, script: 0x57, flags: 0x0}, + 645: {region: 0x165, script: 0x29, flags: 0x0}, + 646: {region: 0x123, script: 0xdf, flags: 0x0}, + 647: {region: 0xe8, script: 0x5, flags: 0x0}, + 648: {region: 0x165, script: 0x57, flags: 0x0}, + 649: {region: 0x165, script: 0x57, flags: 0x0}, + 650: {region: 0x1c, script: 0x5, flags: 0x1}, + 651: {region: 0x165, script: 0x57, flags: 0x0}, + 652: {region: 0x165, script: 0x57, flags: 0x0}, + 653: {region: 0x165, script: 0x57, flags: 0x0}, + 654: {region: 0x138, script: 0x57, flags: 0x0}, + 655: {region: 0x87, script: 0x5b, flags: 0x0}, + 656: {region: 0x97, script: 0x3b, flags: 0x0}, + 657: {region: 0x12f, script: 0x57, flags: 0x0}, + 658: {region: 0xe8, script: 0x5, flags: 0x0}, + 659: {region: 0x131, script: 0x57, flags: 0x0}, + 660: {region: 0x165, script: 0x57, flags: 0x0}, + 661: {region: 0xb7, script: 0x57, flags: 0x0}, + 662: {region: 0x106, script: 0x1f, flags: 0x0}, + 663: {region: 0x165, script: 0x57, flags: 0x0}, + 664: {region: 0x95, script: 0x57, flags: 0x0}, + 665: {region: 0x165, script: 0x57, flags: 0x0}, + 666: {region: 0x53, script: 0xdf, flags: 0x0}, + 667: {region: 0x165, script: 0x57, flags: 0x0}, + 668: {region: 0x165, script: 0x57, flags: 0x0}, + 669: {region: 0x165, script: 0x57, flags: 0x0}, + 670: {region: 0x165, script: 0x57, flags: 0x0}, + 671: {region: 0x99, script: 0x59, flags: 0x0}, + 672: {region: 0x165, script: 0x57, flags: 0x0}, + 673: {region: 0x165, script: 0x57, flags: 0x0}, + 674: {region: 0x106, script: 0x1f, flags: 0x0}, + 675: {region: 0x131, script: 0x57, flags: 0x0}, + 676: {region: 0x165, script: 0x57, flags: 0x0}, + 677: {region: 0xd9, script: 0x57, flags: 0x0}, + 678: {region: 0x165, script: 0x57, flags: 0x0}, + 679: {region: 0x165, script: 0x57, flags: 0x0}, + 680: {region: 0x21, script: 0x2, flags: 0x1}, + 681: {region: 0x165, script: 0x57, flags: 0x0}, + 682: {region: 0x165, script: 0x57, flags: 0x0}, + 683: {region: 0x9e, script: 0x57, flags: 0x0}, + 684: {region: 0x53, script: 0x5d, flags: 0x0}, + 685: {region: 0x95, script: 0x57, flags: 0x0}, + 686: {region: 0x9c, script: 0x5, flags: 0x0}, + 687: {region: 0x135, script: 0x57, flags: 0x0}, + 688: {region: 0x165, script: 0x57, flags: 0x0}, + 689: {region: 0x165, script: 0x57, flags: 0x0}, + 690: {region: 0x99, script: 0xda, flags: 0x0}, + 691: {region: 0x9e, script: 0x57, flags: 0x0}, + 692: {region: 0x165, script: 0x57, flags: 0x0}, + 693: {region: 0x4b, script: 0x57, flags: 0x0}, + 694: {region: 0x165, script: 0x57, flags: 0x0}, + 695: {region: 0x165, script: 0x57, flags: 0x0}, + 696: {region: 0xaf, script: 0x54, flags: 0x0}, + 697: {region: 0x165, script: 0x57, flags: 0x0}, + 698: {region: 0x165, script: 0x57, flags: 0x0}, + 699: {region: 0x4b, script: 0x57, flags: 0x0}, + 700: {region: 0x165, script: 0x57, flags: 0x0}, + 701: {region: 0x165, script: 0x57, flags: 0x0}, + 702: {region: 0x162, script: 0x57, flags: 0x0}, + 703: {region: 0x9c, script: 0x5, flags: 0x0}, + 704: {region: 0xb6, script: 0x57, flags: 0x0}, + 705: {region: 0xb8, script: 0x57, flags: 0x0}, + 706: {region: 0x4b, script: 0x57, flags: 0x0}, + 707: {region: 0x4b, script: 0x57, flags: 0x0}, + 708: {region: 0xa4, script: 0x57, flags: 0x0}, + 709: {region: 0xa4, script: 0x57, flags: 0x0}, + 710: {region: 0x9c, script: 0x5, flags: 0x0}, + 711: {region: 0xb8, script: 0x57, flags: 0x0}, + 712: {region: 0x123, script: 0xdf, flags: 0x0}, + 713: {region: 0x53, script: 0x38, flags: 0x0}, + 714: {region: 0x12b, script: 0x57, flags: 0x0}, + 715: {region: 0x95, script: 0x57, flags: 0x0}, + 716: {region: 0x52, script: 0x57, flags: 0x0}, + 717: {region: 0x99, script: 0x21, flags: 0x0}, + 718: {region: 0x99, script: 0x21, flags: 0x0}, + 719: {region: 0x95, script: 0x57, flags: 0x0}, + 720: {region: 0x23, script: 0x3, flags: 0x1}, + 721: {region: 0xa4, script: 0x57, flags: 0x0}, + 722: {region: 0x165, script: 0x57, flags: 0x0}, + 723: {region: 0xcf, script: 0x57, flags: 0x0}, + 724: {region: 0x165, script: 0x57, flags: 0x0}, + 725: {region: 0x165, script: 0x57, flags: 0x0}, + 726: {region: 0x165, script: 0x57, flags: 0x0}, + 727: {region: 0x165, script: 0x57, flags: 0x0}, + 728: {region: 0x165, script: 0x57, flags: 0x0}, + 729: {region: 0x165, script: 0x57, flags: 0x0}, + 730: {region: 0x165, script: 0x57, flags: 0x0}, + 731: {region: 0x165, script: 0x57, flags: 0x0}, + 732: {region: 0x165, script: 0x57, flags: 0x0}, + 733: {region: 0x165, script: 0x57, flags: 0x0}, + 734: {region: 0x165, script: 0x57, flags: 0x0}, + 735: {region: 0x165, script: 0x5, flags: 0x0}, + 736: {region: 0x106, script: 0x1f, flags: 0x0}, + 737: {region: 0xe7, script: 0x57, flags: 0x0}, + 738: {region: 0x165, script: 0x57, flags: 0x0}, + 739: {region: 0x95, script: 0x57, flags: 0x0}, + 740: {region: 0x165, script: 0x29, flags: 0x0}, + 741: {region: 0x165, script: 0x57, flags: 0x0}, + 742: {region: 0x165, script: 0x57, flags: 0x0}, + 743: {region: 0x165, script: 0x57, flags: 0x0}, + 744: {region: 0x112, script: 0x57, flags: 0x0}, + 745: {region: 0xa4, script: 0x57, flags: 0x0}, + 746: {region: 0x165, script: 0x57, flags: 0x0}, + 747: {region: 0x165, script: 0x57, flags: 0x0}, + 748: {region: 0x123, script: 0x5, flags: 0x0}, + 749: {region: 0xcc, script: 0x57, flags: 0x0}, + 750: {region: 0x165, script: 0x57, flags: 0x0}, + 751: {region: 0x165, script: 0x57, flags: 0x0}, + 752: {region: 0x165, script: 0x57, flags: 0x0}, + 753: {region: 0xbf, script: 0x57, flags: 0x0}, + 754: {region: 0xd1, script: 0x57, flags: 0x0}, + 755: {region: 0x165, script: 0x57, flags: 0x0}, + 756: {region: 0x52, script: 0x57, flags: 0x0}, + 757: {region: 0xdb, script: 0x21, flags: 0x0}, + 758: {region: 0x12f, script: 0x57, flags: 0x0}, + 759: {region: 0xc0, script: 0x57, flags: 0x0}, + 760: {region: 0x165, script: 0x57, flags: 0x0}, + 761: {region: 0x165, script: 0x57, flags: 0x0}, + 762: {region: 0xe0, script: 0x57, flags: 0x0}, + 763: {region: 0x165, script: 0x57, flags: 0x0}, + 764: {region: 0x95, script: 0x57, flags: 0x0}, + 765: {region: 0x9b, script: 0x3a, flags: 0x0}, + 766: {region: 0x165, script: 0x57, flags: 0x0}, + 767: {region: 0xc2, script: 0x1f, flags: 0x0}, + 768: {region: 0x165, script: 0x5, flags: 0x0}, + 769: {region: 0x165, script: 0x57, flags: 0x0}, + 770: {region: 0x165, script: 0x57, flags: 0x0}, + 771: {region: 0x165, script: 0x57, flags: 0x0}, + 772: {region: 0x99, script: 0x6b, flags: 0x0}, + 773: {region: 0x165, script: 0x57, flags: 0x0}, + 774: {region: 0x165, script: 0x57, flags: 0x0}, + 775: {region: 0x10b, script: 0x57, flags: 0x0}, + 776: {region: 0x165, script: 0x57, flags: 0x0}, + 777: {region: 0x165, script: 0x57, flags: 0x0}, + 778: {region: 0x165, script: 0x57, flags: 0x0}, + 779: {region: 0x26, script: 0x3, flags: 0x1}, + 780: {region: 0x165, script: 0x57, flags: 0x0}, + 781: {region: 0x165, script: 0x57, flags: 0x0}, + 782: {region: 0x99, script: 0xe, flags: 0x0}, + 783: {region: 0xc4, script: 0x72, flags: 0x0}, + 785: {region: 0x165, script: 0x57, flags: 0x0}, + 786: {region: 0x49, script: 0x57, flags: 0x0}, + 787: {region: 0x49, script: 0x57, flags: 0x0}, + 788: {region: 0x37, script: 0x57, flags: 0x0}, + 789: {region: 0x165, script: 0x57, flags: 0x0}, + 790: {region: 0x165, script: 0x57, flags: 0x0}, + 791: {region: 0x165, script: 0x57, flags: 0x0}, + 792: {region: 0x165, script: 0x57, flags: 0x0}, + 793: {region: 0x165, script: 0x57, flags: 0x0}, + 794: {region: 0x165, script: 0x57, flags: 0x0}, + 795: {region: 0x99, script: 0x21, flags: 0x0}, + 796: {region: 0xdb, script: 0x21, flags: 0x0}, + 797: {region: 0x106, script: 0x1f, flags: 0x0}, + 798: {region: 0x35, script: 0x6f, flags: 0x0}, + 799: {region: 0x29, script: 0x3, flags: 0x1}, + 800: {region: 0xcb, script: 0x57, flags: 0x0}, + 801: {region: 0x165, script: 0x57, flags: 0x0}, + 802: {region: 0x165, script: 0x57, flags: 0x0}, + 803: {region: 0x165, script: 0x57, flags: 0x0}, + 804: {region: 0x99, script: 0x21, flags: 0x0}, + 805: {region: 0x52, script: 0x57, flags: 0x0}, + 807: {region: 0x165, script: 0x57, flags: 0x0}, + 808: {region: 0x135, script: 0x57, flags: 0x0}, + 809: {region: 0x165, script: 0x57, flags: 0x0}, + 810: {region: 0x165, script: 0x57, flags: 0x0}, + 811: {region: 0xe8, script: 0x5, flags: 0x0}, + 812: {region: 0xc3, script: 0x57, flags: 0x0}, + 813: {region: 0x99, script: 0x21, flags: 0x0}, + 814: {region: 0x95, script: 0x57, flags: 0x0}, + 815: {region: 0x164, script: 0x57, flags: 0x0}, + 816: {region: 0x165, script: 0x57, flags: 0x0}, + 817: {region: 0xc4, script: 0x72, flags: 0x0}, + 818: {region: 0x165, script: 0x57, flags: 0x0}, + 819: {region: 0x165, script: 0x29, flags: 0x0}, + 820: {region: 0x106, script: 0x1f, flags: 0x0}, + 821: {region: 0x165, script: 0x57, flags: 0x0}, + 822: {region: 0x131, script: 0x57, flags: 0x0}, + 823: {region: 0x9c, script: 0x63, flags: 0x0}, + 824: {region: 0x165, script: 0x57, flags: 0x0}, + 825: {region: 0x165, script: 0x57, flags: 0x0}, + 826: {region: 0x9c, script: 0x5, flags: 0x0}, + 827: {region: 0x165, script: 0x57, flags: 0x0}, + 828: {region: 0x165, script: 0x57, flags: 0x0}, + 829: {region: 0x165, script: 0x57, flags: 0x0}, + 830: {region: 0xdd, script: 0x57, flags: 0x0}, + 831: {region: 0x165, script: 0x57, flags: 0x0}, + 832: {region: 0x165, script: 0x57, flags: 0x0}, + 834: {region: 0x165, script: 0x57, flags: 0x0}, + 835: {region: 0x53, script: 0x38, flags: 0x0}, + 836: {region: 0x9e, script: 0x57, flags: 0x0}, + 837: {region: 0xd2, script: 0x57, flags: 0x0}, + 838: {region: 0x165, script: 0x57, flags: 0x0}, + 839: {region: 0xda, script: 0x57, flags: 0x0}, + 840: {region: 0x165, script: 0x57, flags: 0x0}, + 841: {region: 0x165, script: 0x57, flags: 0x0}, + 842: {region: 0x165, script: 0x57, flags: 0x0}, + 843: {region: 0xcf, script: 0x57, flags: 0x0}, + 844: {region: 0x165, script: 0x57, flags: 0x0}, + 845: {region: 0x165, script: 0x57, flags: 0x0}, + 846: {region: 0x164, script: 0x57, flags: 0x0}, + 847: {region: 0xd1, script: 0x57, flags: 0x0}, + 848: {region: 0x60, script: 0x57, flags: 0x0}, + 849: {region: 0xdb, script: 0x21, flags: 0x0}, + 850: {region: 0x165, script: 0x57, flags: 0x0}, + 851: {region: 0xdb, script: 0x21, flags: 0x0}, + 852: {region: 0x165, script: 0x57, flags: 0x0}, + 853: {region: 0x165, script: 0x57, flags: 0x0}, + 854: {region: 0xd2, script: 0x57, flags: 0x0}, + 855: {region: 0x165, script: 0x57, flags: 0x0}, + 856: {region: 0x165, script: 0x57, flags: 0x0}, + 857: {region: 0xd1, script: 0x57, flags: 0x0}, + 858: {region: 0x165, script: 0x57, flags: 0x0}, + 859: {region: 0xcf, script: 0x57, flags: 0x0}, + 860: {region: 0xcf, script: 0x57, flags: 0x0}, + 861: {region: 0x165, script: 0x57, flags: 0x0}, + 862: {region: 0x165, script: 0x57, flags: 0x0}, + 863: {region: 0x95, script: 0x57, flags: 0x0}, + 864: {region: 0x165, script: 0x57, flags: 0x0}, + 865: {region: 0xdf, script: 0x57, flags: 0x0}, + 866: {region: 0x165, script: 0x57, flags: 0x0}, + 867: {region: 0x165, script: 0x57, flags: 0x0}, + 868: {region: 0x99, script: 0x57, flags: 0x0}, + 869: {region: 0x165, script: 0x57, flags: 0x0}, + 870: {region: 0x165, script: 0x57, flags: 0x0}, + 871: {region: 0xd9, script: 0x57, flags: 0x0}, + 872: {region: 0x52, script: 0x57, flags: 0x0}, + 873: {region: 0x165, script: 0x57, flags: 0x0}, + 874: {region: 0xda, script: 0x57, flags: 0x0}, + 875: {region: 0x165, script: 0x57, flags: 0x0}, + 876: {region: 0x52, script: 0x57, flags: 0x0}, + 877: {region: 0x165, script: 0x57, flags: 0x0}, + 878: {region: 0x165, script: 0x57, flags: 0x0}, + 879: {region: 0xda, script: 0x57, flags: 0x0}, + 880: {region: 0x123, script: 0x53, flags: 0x0}, + 881: {region: 0x99, script: 0x21, flags: 0x0}, + 882: {region: 0x10c, script: 0xbf, flags: 0x0}, + 883: {region: 0x165, script: 0x57, flags: 0x0}, + 884: {region: 0x165, script: 0x57, flags: 0x0}, + 885: {region: 0x84, script: 0x78, flags: 0x0}, + 886: {region: 0x161, script: 0x57, flags: 0x0}, + 887: {region: 0x165, script: 0x57, flags: 0x0}, + 888: {region: 0x49, script: 0x17, flags: 0x0}, + 889: {region: 0x165, script: 0x57, flags: 0x0}, + 890: {region: 0x161, script: 0x57, flags: 0x0}, + 891: {region: 0x165, script: 0x57, flags: 0x0}, + 892: {region: 0x165, script: 0x57, flags: 0x0}, + 893: {region: 0x165, script: 0x57, flags: 0x0}, + 894: {region: 0x165, script: 0x57, flags: 0x0}, + 895: {region: 0x165, script: 0x57, flags: 0x0}, + 896: {region: 0x117, script: 0x57, flags: 0x0}, + 897: {region: 0x165, script: 0x57, flags: 0x0}, + 898: {region: 0x165, script: 0x57, flags: 0x0}, + 899: {region: 0x135, script: 0x57, flags: 0x0}, + 900: {region: 0x165, script: 0x57, flags: 0x0}, + 901: {region: 0x53, script: 0x57, flags: 0x0}, + 902: {region: 0x165, script: 0x57, flags: 0x0}, + 903: {region: 0xce, script: 0x57, flags: 0x0}, + 904: {region: 0x12f, script: 0x57, flags: 0x0}, + 905: {region: 0x131, script: 0x57, flags: 0x0}, + 906: {region: 0x80, script: 0x57, flags: 0x0}, + 907: {region: 0x78, script: 0x57, flags: 0x0}, + 908: {region: 0x165, script: 0x57, flags: 0x0}, + 910: {region: 0x165, script: 0x57, flags: 0x0}, + 911: {region: 0x165, script: 0x57, flags: 0x0}, + 912: {region: 0x6f, script: 0x57, flags: 0x0}, + 913: {region: 0x165, script: 0x57, flags: 0x0}, + 914: {region: 0x165, script: 0x57, flags: 0x0}, + 915: {region: 0x165, script: 0x57, flags: 0x0}, + 916: {region: 0x165, script: 0x57, flags: 0x0}, + 917: {region: 0x99, script: 0x7d, flags: 0x0}, + 918: {region: 0x165, script: 0x57, flags: 0x0}, + 919: {region: 0x165, script: 0x5, flags: 0x0}, + 920: {region: 0x7d, script: 0x1f, flags: 0x0}, + 921: {region: 0x135, script: 0x7e, flags: 0x0}, + 922: {region: 0x165, script: 0x5, flags: 0x0}, + 923: {region: 0xc5, script: 0x7c, flags: 0x0}, + 924: {region: 0x165, script: 0x57, flags: 0x0}, + 925: {region: 0x2c, script: 0x3, flags: 0x1}, + 926: {region: 0xe7, script: 0x57, flags: 0x0}, + 927: {region: 0x2f, script: 0x2, flags: 0x1}, + 928: {region: 0xe7, script: 0x57, flags: 0x0}, + 929: {region: 0x30, script: 0x57, flags: 0x0}, + 930: {region: 0xf0, script: 0x57, flags: 0x0}, + 931: {region: 0x165, script: 0x57, flags: 0x0}, + 932: {region: 0x78, script: 0x57, flags: 0x0}, + 933: {region: 0xd6, script: 0x57, flags: 0x0}, + 934: {region: 0x135, script: 0x57, flags: 0x0}, + 935: {region: 0x49, script: 0x57, flags: 0x0}, + 936: {region: 0x165, script: 0x57, flags: 0x0}, + 937: {region: 0x9c, script: 0xe8, flags: 0x0}, + 938: {region: 0x165, script: 0x57, flags: 0x0}, + 939: {region: 0x60, script: 0x57, flags: 0x0}, + 940: {region: 0x165, script: 0x5, flags: 0x0}, + 941: {region: 0xb0, script: 0x87, flags: 0x0}, + 943: {region: 0x165, script: 0x57, flags: 0x0}, + 944: {region: 0x165, script: 0x57, flags: 0x0}, + 945: {region: 0x99, script: 0x12, flags: 0x0}, + 946: {region: 0xa4, script: 0x57, flags: 0x0}, + 947: {region: 0xe9, script: 0x57, flags: 0x0}, + 948: {region: 0x165, script: 0x57, flags: 0x0}, + 949: {region: 0x9e, script: 0x57, flags: 0x0}, + 950: {region: 0x165, script: 0x57, flags: 0x0}, + 951: {region: 0x165, script: 0x57, flags: 0x0}, + 952: {region: 0x87, script: 0x31, flags: 0x0}, + 953: {region: 0x75, script: 0x57, flags: 0x0}, + 954: {region: 0x165, script: 0x57, flags: 0x0}, + 955: {region: 0xe8, script: 0x4a, flags: 0x0}, + 956: {region: 0x9c, script: 0x5, flags: 0x0}, + 957: {region: 0x1, script: 0x57, flags: 0x0}, + 958: {region: 0x24, script: 0x5, flags: 0x0}, + 959: {region: 0x165, script: 0x57, flags: 0x0}, + 960: {region: 0x41, script: 0x57, flags: 0x0}, + 961: {region: 0x165, script: 0x57, flags: 0x0}, + 962: {region: 0x7a, script: 0x57, flags: 0x0}, + 963: {region: 0x165, script: 0x57, flags: 0x0}, + 964: {region: 0xe4, script: 0x57, flags: 0x0}, + 965: {region: 0x89, script: 0x57, flags: 0x0}, + 966: {region: 0x69, script: 0x57, flags: 0x0}, + 967: {region: 0x165, script: 0x57, flags: 0x0}, + 968: {region: 0x99, script: 0x21, flags: 0x0}, + 969: {region: 0x165, script: 0x57, flags: 0x0}, + 970: {region: 0x102, script: 0x57, flags: 0x0}, + 971: {region: 0x95, script: 0x57, flags: 0x0}, + 972: {region: 0x165, script: 0x57, flags: 0x0}, + 973: {region: 0x165, script: 0x57, flags: 0x0}, + 974: {region: 0x9e, script: 0x57, flags: 0x0}, + 975: {region: 0x165, script: 0x5, flags: 0x0}, + 976: {region: 0x99, script: 0x57, flags: 0x0}, + 977: {region: 0x31, script: 0x2, flags: 0x1}, + 978: {region: 0xdb, script: 0x21, flags: 0x0}, + 979: {region: 0x35, script: 0xe, flags: 0x0}, + 980: {region: 0x4e, script: 0x57, flags: 0x0}, + 981: {region: 0x72, script: 0x57, flags: 0x0}, + 982: {region: 0x4e, script: 0x57, flags: 0x0}, + 983: {region: 0x9c, script: 0x5, flags: 0x0}, + 984: {region: 0x10c, script: 0x57, flags: 0x0}, + 985: {region: 0x3a, script: 0x57, flags: 0x0}, + 986: {region: 0x165, script: 0x57, flags: 0x0}, + 987: {region: 0xd1, script: 0x57, flags: 0x0}, + 988: {region: 0x104, script: 0x57, flags: 0x0}, + 989: {region: 0x95, script: 0x57, flags: 0x0}, + 990: {region: 0x12f, script: 0x57, flags: 0x0}, + 991: {region: 0x165, script: 0x57, flags: 0x0}, + 992: {region: 0x165, script: 0x57, flags: 0x0}, + 993: {region: 0x73, script: 0x57, flags: 0x0}, + 994: {region: 0x106, script: 0x1f, flags: 0x0}, + 995: {region: 0x130, script: 0x1f, flags: 0x0}, + 996: {region: 0x109, script: 0x57, flags: 0x0}, + 997: {region: 0x107, script: 0x57, flags: 0x0}, + 998: {region: 0x12f, script: 0x57, flags: 0x0}, + 999: {region: 0x165, script: 0x57, flags: 0x0}, + 1000: {region: 0xa2, script: 0x49, flags: 0x0}, + 1001: {region: 0x99, script: 0x21, flags: 0x0}, + 1002: {region: 0x80, script: 0x57, flags: 0x0}, + 1003: {region: 0x106, script: 0x1f, flags: 0x0}, + 1004: {region: 0xa4, script: 0x57, flags: 0x0}, + 1005: {region: 0x95, script: 0x57, flags: 0x0}, + 1006: {region: 0x99, script: 0x57, flags: 0x0}, + 1007: {region: 0x114, script: 0x57, flags: 0x0}, + 1008: {region: 0x99, script: 0xc3, flags: 0x0}, + 1009: {region: 0x165, script: 0x57, flags: 0x0}, + 1010: {region: 0x165, script: 0x57, flags: 0x0}, + 1011: {region: 0x12f, script: 0x57, flags: 0x0}, + 1012: {region: 0x9e, script: 0x57, flags: 0x0}, + 1013: {region: 0x99, script: 0x21, flags: 0x0}, + 1014: {region: 0x165, script: 0x5, flags: 0x0}, + 1015: {region: 0x9e, script: 0x57, flags: 0x0}, + 1016: {region: 0x7b, script: 0x57, flags: 0x0}, + 1017: {region: 0x49, script: 0x57, flags: 0x0}, + 1018: {region: 0x33, script: 0x4, flags: 0x1}, + 1019: {region: 0x9e, script: 0x57, flags: 0x0}, + 1020: {region: 0x9c, script: 0x5, flags: 0x0}, + 1021: {region: 0xda, script: 0x57, flags: 0x0}, + 1022: {region: 0x4f, script: 0x57, flags: 0x0}, + 1023: {region: 0xd1, script: 0x57, flags: 0x0}, + 1024: {region: 0xcf, script: 0x57, flags: 0x0}, + 1025: {region: 0xc3, script: 0x57, flags: 0x0}, + 1026: {region: 0x4c, script: 0x57, flags: 0x0}, + 1027: {region: 0x96, script: 0x7a, flags: 0x0}, + 1028: {region: 0xb6, script: 0x57, flags: 0x0}, + 1029: {region: 0x165, script: 0x29, flags: 0x0}, + 1030: {region: 0x165, script: 0x57, flags: 0x0}, + 1032: {region: 0xba, script: 0xdc, flags: 0x0}, + 1033: {region: 0x165, script: 0x57, flags: 0x0}, + 1034: {region: 0xc4, script: 0x72, flags: 0x0}, + 1035: {region: 0x165, script: 0x5, flags: 0x0}, + 1036: {region: 0xb3, script: 0xca, flags: 0x0}, + 1037: {region: 0x6f, script: 0x57, flags: 0x0}, + 1038: {region: 0x165, script: 0x57, flags: 0x0}, + 1039: {region: 0x165, script: 0x57, flags: 0x0}, + 1040: {region: 0x165, script: 0x57, flags: 0x0}, + 1041: {region: 0x165, script: 0x57, flags: 0x0}, + 1042: {region: 0x111, script: 0x57, flags: 0x0}, + 1043: {region: 0x165, script: 0x57, flags: 0x0}, + 1044: {region: 0xe8, script: 0x5, flags: 0x0}, + 1045: {region: 0x165, script: 0x57, flags: 0x0}, + 1046: {region: 0x10f, script: 0x57, flags: 0x0}, + 1047: {region: 0x165, script: 0x57, flags: 0x0}, + 1048: {region: 0xe9, script: 0x57, flags: 0x0}, + 1049: {region: 0x165, script: 0x57, flags: 0x0}, + 1050: {region: 0x95, script: 0x57, flags: 0x0}, + 1051: {region: 0x142, script: 0x57, flags: 0x0}, + 1052: {region: 0x10c, script: 0x57, flags: 0x0}, + 1054: {region: 0x10c, script: 0x57, flags: 0x0}, + 1055: {region: 0x72, script: 0x57, flags: 0x0}, + 1056: {region: 0x97, script: 0xc0, flags: 0x0}, + 1057: {region: 0x165, script: 0x57, flags: 0x0}, + 1058: {region: 0x72, script: 0x57, flags: 0x0}, + 1059: {region: 0x164, script: 0x57, flags: 0x0}, + 1060: {region: 0x165, script: 0x57, flags: 0x0}, + 1061: {region: 0xc3, script: 0x57, flags: 0x0}, + 1062: {region: 0x165, script: 0x57, flags: 0x0}, + 1063: {region: 0x165, script: 0x57, flags: 0x0}, + 1064: {region: 0x165, script: 0x57, flags: 0x0}, + 1065: {region: 0x115, script: 0x57, flags: 0x0}, + 1066: {region: 0x165, script: 0x57, flags: 0x0}, + 1067: {region: 0x165, script: 0x57, flags: 0x0}, + 1068: {region: 0x123, script: 0xdf, flags: 0x0}, + 1069: {region: 0x165, script: 0x57, flags: 0x0}, + 1070: {region: 0x165, script: 0x57, flags: 0x0}, + 1071: {region: 0x165, script: 0x57, flags: 0x0}, + 1072: {region: 0x165, script: 0x57, flags: 0x0}, + 1073: {region: 0x27, script: 0x57, flags: 0x0}, + 1074: {region: 0x37, script: 0x5, flags: 0x1}, + 1075: {region: 0x99, script: 0xcb, flags: 0x0}, + 1076: {region: 0x116, script: 0x57, flags: 0x0}, + 1077: {region: 0x114, script: 0x57, flags: 0x0}, + 1078: {region: 0x99, script: 0x21, flags: 0x0}, + 1079: {region: 0x161, script: 0x57, flags: 0x0}, + 1080: {region: 0x165, script: 0x57, flags: 0x0}, + 1081: {region: 0x165, script: 0x57, flags: 0x0}, + 1082: {region: 0x6d, script: 0x57, flags: 0x0}, + 1083: {region: 0x161, script: 0x57, flags: 0x0}, + 1084: {region: 0x165, script: 0x57, flags: 0x0}, + 1085: {region: 0x60, script: 0x57, flags: 0x0}, + 1086: {region: 0x95, script: 0x57, flags: 0x0}, + 1087: {region: 0x165, script: 0x57, flags: 0x0}, + 1088: {region: 0x165, script: 0x57, flags: 0x0}, + 1089: {region: 0x12f, script: 0x57, flags: 0x0}, + 1090: {region: 0x165, script: 0x57, flags: 0x0}, + 1091: {region: 0x84, script: 0x57, flags: 0x0}, + 1092: {region: 0x10c, script: 0x57, flags: 0x0}, + 1093: {region: 0x12f, script: 0x57, flags: 0x0}, + 1094: {region: 0x15f, script: 0x5, flags: 0x0}, + 1095: {region: 0x4b, script: 0x57, flags: 0x0}, + 1096: {region: 0x60, script: 0x57, flags: 0x0}, + 1097: {region: 0x165, script: 0x57, flags: 0x0}, + 1098: {region: 0x99, script: 0x21, flags: 0x0}, + 1099: {region: 0x95, script: 0x57, flags: 0x0}, + 1100: {region: 0x165, script: 0x57, flags: 0x0}, + 1101: {region: 0x35, script: 0xe, flags: 0x0}, + 1102: {region: 0x9b, script: 0xcf, flags: 0x0}, + 1103: {region: 0xe9, script: 0x57, flags: 0x0}, + 1104: {region: 0x99, script: 0xd7, flags: 0x0}, + 1105: {region: 0xdb, script: 0x21, flags: 0x0}, + 1106: {region: 0x165, script: 0x57, flags: 0x0}, + 1107: {region: 0x165, script: 0x57, flags: 0x0}, + 1108: {region: 0x165, script: 0x57, flags: 0x0}, + 1109: {region: 0x165, script: 0x57, flags: 0x0}, + 1110: {region: 0x165, script: 0x57, flags: 0x0}, + 1111: {region: 0x165, script: 0x57, flags: 0x0}, + 1112: {region: 0x165, script: 0x57, flags: 0x0}, + 1113: {region: 0x165, script: 0x57, flags: 0x0}, + 1114: {region: 0xe7, script: 0x57, flags: 0x0}, + 1115: {region: 0x165, script: 0x57, flags: 0x0}, + 1116: {region: 0x165, script: 0x57, flags: 0x0}, + 1117: {region: 0x99, script: 0x4f, flags: 0x0}, + 1118: {region: 0x53, script: 0xd5, flags: 0x0}, + 1119: {region: 0xdb, script: 0x21, flags: 0x0}, + 1120: {region: 0xdb, script: 0x21, flags: 0x0}, + 1121: {region: 0x99, script: 0xda, flags: 0x0}, + 1122: {region: 0x165, script: 0x57, flags: 0x0}, + 1123: {region: 0x112, script: 0x57, flags: 0x0}, + 1124: {region: 0x131, script: 0x57, flags: 0x0}, + 1125: {region: 0x126, script: 0x57, flags: 0x0}, + 1126: {region: 0x165, script: 0x57, flags: 0x0}, + 1127: {region: 0x3c, script: 0x3, flags: 0x1}, + 1128: {region: 0x165, script: 0x57, flags: 0x0}, + 1129: {region: 0x165, script: 0x57, flags: 0x0}, + 1130: {region: 0x165, script: 0x57, flags: 0x0}, + 1131: {region: 0x123, script: 0xdf, flags: 0x0}, + 1132: {region: 0xdb, script: 0x21, flags: 0x0}, + 1133: {region: 0xdb, script: 0x21, flags: 0x0}, + 1134: {region: 0xdb, script: 0x21, flags: 0x0}, + 1135: {region: 0x6f, script: 0x29, flags: 0x0}, + 1136: {region: 0x165, script: 0x57, flags: 0x0}, + 1137: {region: 0x6d, script: 0x29, flags: 0x0}, + 1138: {region: 0x165, script: 0x57, flags: 0x0}, + 1139: {region: 0x165, script: 0x57, flags: 0x0}, + 1140: {region: 0x165, script: 0x57, flags: 0x0}, + 1141: {region: 0xd6, script: 0x57, flags: 0x0}, + 1142: {region: 0x127, script: 0x57, flags: 0x0}, + 1143: {region: 0x125, script: 0x57, flags: 0x0}, + 1144: {region: 0x32, script: 0x57, flags: 0x0}, + 1145: {region: 0xdb, script: 0x21, flags: 0x0}, + 1146: {region: 0xe7, script: 0x57, flags: 0x0}, + 1147: {region: 0x165, script: 0x57, flags: 0x0}, + 1148: {region: 0x165, script: 0x57, flags: 0x0}, + 1149: {region: 0x32, script: 0x57, flags: 0x0}, + 1150: {region: 0xd4, script: 0x57, flags: 0x0}, + 1151: {region: 0x165, script: 0x57, flags: 0x0}, + 1152: {region: 0x161, script: 0x57, flags: 0x0}, + 1153: {region: 0x165, script: 0x57, flags: 0x0}, + 1154: {region: 0x129, script: 0x57, flags: 0x0}, + 1155: {region: 0x165, script: 0x57, flags: 0x0}, + 1156: {region: 0xce, script: 0x57, flags: 0x0}, + 1157: {region: 0x165, script: 0x57, flags: 0x0}, + 1158: {region: 0xe6, script: 0x57, flags: 0x0}, + 1159: {region: 0x165, script: 0x57, flags: 0x0}, + 1160: {region: 0x165, script: 0x57, flags: 0x0}, + 1161: {region: 0x165, script: 0x57, flags: 0x0}, + 1162: {region: 0x12b, script: 0x57, flags: 0x0}, + 1163: {region: 0x12b, script: 0x57, flags: 0x0}, + 1164: {region: 0x12e, script: 0x57, flags: 0x0}, + 1165: {region: 0x165, script: 0x5, flags: 0x0}, + 1166: {region: 0x161, script: 0x57, flags: 0x0}, + 1167: {region: 0x87, script: 0x31, flags: 0x0}, + 1168: {region: 0xdb, script: 0x21, flags: 0x0}, + 1169: {region: 0xe7, script: 0x57, flags: 0x0}, + 1170: {region: 0x43, script: 0xe0, flags: 0x0}, + 1171: {region: 0x165, script: 0x57, flags: 0x0}, + 1172: {region: 0x106, script: 0x1f, flags: 0x0}, + 1173: {region: 0x165, script: 0x57, flags: 0x0}, + 1174: {region: 0x165, script: 0x57, flags: 0x0}, + 1175: {region: 0x131, script: 0x57, flags: 0x0}, + 1176: {region: 0x165, script: 0x57, flags: 0x0}, + 1177: {region: 0x123, script: 0xdf, flags: 0x0}, + 1178: {region: 0x32, script: 0x57, flags: 0x0}, + 1179: {region: 0x165, script: 0x57, flags: 0x0}, + 1180: {region: 0x165, script: 0x57, flags: 0x0}, + 1181: {region: 0xce, script: 0x57, flags: 0x0}, + 1182: {region: 0x165, script: 0x57, flags: 0x0}, + 1183: {region: 0x165, script: 0x57, flags: 0x0}, + 1184: {region: 0x12d, script: 0x57, flags: 0x0}, + 1185: {region: 0x165, script: 0x57, flags: 0x0}, + 1187: {region: 0x165, script: 0x57, flags: 0x0}, + 1188: {region: 0xd4, script: 0x57, flags: 0x0}, + 1189: {region: 0x53, script: 0xd8, flags: 0x0}, + 1190: {region: 0xe5, script: 0x57, flags: 0x0}, + 1191: {region: 0x165, script: 0x57, flags: 0x0}, + 1192: {region: 0x106, script: 0x1f, flags: 0x0}, + 1193: {region: 0xba, script: 0x57, flags: 0x0}, + 1194: {region: 0x165, script: 0x57, flags: 0x0}, + 1195: {region: 0x106, script: 0x1f, flags: 0x0}, + 1196: {region: 0x3f, script: 0x4, flags: 0x1}, + 1197: {region: 0x11c, script: 0xe2, flags: 0x0}, + 1198: {region: 0x130, script: 0x1f, flags: 0x0}, + 1199: {region: 0x75, script: 0x57, flags: 0x0}, + 1200: {region: 0x2a, script: 0x57, flags: 0x0}, + 1202: {region: 0x43, script: 0x3, flags: 0x1}, + 1203: {region: 0x99, script: 0xe, flags: 0x0}, + 1204: {region: 0xe8, script: 0x5, flags: 0x0}, + 1205: {region: 0x165, script: 0x57, flags: 0x0}, + 1206: {region: 0x165, script: 0x57, flags: 0x0}, + 1207: {region: 0x165, script: 0x57, flags: 0x0}, + 1208: {region: 0x165, script: 0x57, flags: 0x0}, + 1209: {region: 0x165, script: 0x57, flags: 0x0}, + 1210: {region: 0x165, script: 0x57, flags: 0x0}, + 1211: {region: 0x165, script: 0x57, flags: 0x0}, + 1212: {region: 0x46, script: 0x4, flags: 0x1}, + 1213: {region: 0x165, script: 0x57, flags: 0x0}, + 1214: {region: 0xb4, script: 0xe3, flags: 0x0}, + 1215: {region: 0x165, script: 0x57, flags: 0x0}, + 1216: {region: 0x161, script: 0x57, flags: 0x0}, + 1217: {region: 0x9e, script: 0x57, flags: 0x0}, + 1218: {region: 0x106, script: 0x57, flags: 0x0}, + 1219: {region: 0x13e, script: 0x57, flags: 0x0}, + 1220: {region: 0x11b, script: 0x57, flags: 0x0}, + 1221: {region: 0x165, script: 0x57, flags: 0x0}, + 1222: {region: 0x36, script: 0x57, flags: 0x0}, + 1223: {region: 0x60, script: 0x57, flags: 0x0}, + 1224: {region: 0xd1, script: 0x57, flags: 0x0}, + 1225: {region: 0x1, script: 0x57, flags: 0x0}, + 1226: {region: 0x106, script: 0x57, flags: 0x0}, + 1227: {region: 0x6a, script: 0x57, flags: 0x0}, + 1228: {region: 0x12f, script: 0x57, flags: 0x0}, + 1229: {region: 0x165, script: 0x57, flags: 0x0}, + 1230: {region: 0x36, script: 0x57, flags: 0x0}, + 1231: {region: 0x4e, script: 0x57, flags: 0x0}, + 1232: {region: 0x165, script: 0x57, flags: 0x0}, + 1233: {region: 0x6f, script: 0x29, flags: 0x0}, + 1234: {region: 0x165, script: 0x57, flags: 0x0}, + 1235: {region: 0xe7, script: 0x57, flags: 0x0}, + 1236: {region: 0x2f, script: 0x57, flags: 0x0}, + 1237: {region: 0x99, script: 0xda, flags: 0x0}, + 1238: {region: 0x99, script: 0x21, flags: 0x0}, + 1239: {region: 0x165, script: 0x57, flags: 0x0}, + 1240: {region: 0x165, script: 0x57, flags: 0x0}, + 1241: {region: 0x165, script: 0x57, flags: 0x0}, + 1242: {region: 0x165, script: 0x57, flags: 0x0}, + 1243: {region: 0x165, script: 0x57, flags: 0x0}, + 1244: {region: 0x165, script: 0x57, flags: 0x0}, + 1245: {region: 0x165, script: 0x57, flags: 0x0}, + 1246: {region: 0x165, script: 0x57, flags: 0x0}, + 1247: {region: 0x165, script: 0x57, flags: 0x0}, + 1248: {region: 0x140, script: 0x57, flags: 0x0}, + 1249: {region: 0x165, script: 0x57, flags: 0x0}, + 1250: {region: 0x165, script: 0x57, flags: 0x0}, + 1251: {region: 0xa8, script: 0x5, flags: 0x0}, + 1252: {region: 0x165, script: 0x57, flags: 0x0}, + 1253: {region: 0x114, script: 0x57, flags: 0x0}, + 1254: {region: 0x165, script: 0x57, flags: 0x0}, + 1255: {region: 0x165, script: 0x57, flags: 0x0}, + 1256: {region: 0x165, script: 0x57, flags: 0x0}, + 1257: {region: 0x165, script: 0x57, flags: 0x0}, + 1258: {region: 0x99, script: 0x21, flags: 0x0}, + 1259: {region: 0x53, script: 0x38, flags: 0x0}, + 1260: {region: 0x165, script: 0x57, flags: 0x0}, + 1261: {region: 0x165, script: 0x57, flags: 0x0}, + 1262: {region: 0x41, script: 0x57, flags: 0x0}, + 1263: {region: 0x165, script: 0x57, flags: 0x0}, + 1264: {region: 0x12b, script: 0x18, flags: 0x0}, + 1265: {region: 0x165, script: 0x57, flags: 0x0}, + 1266: {region: 0x161, script: 0x57, flags: 0x0}, + 1267: {region: 0x165, script: 0x57, flags: 0x0}, + 1268: {region: 0x12b, script: 0x5f, flags: 0x0}, + 1269: {region: 0x12b, script: 0x60, flags: 0x0}, + 1270: {region: 0x7d, script: 0x2b, flags: 0x0}, + 1271: {region: 0x53, script: 0x64, flags: 0x0}, + 1272: {region: 0x10b, script: 0x69, flags: 0x0}, + 1273: {region: 0x108, script: 0x73, flags: 0x0}, + 1274: {region: 0x99, script: 0x21, flags: 0x0}, + 1275: {region: 0x131, script: 0x57, flags: 0x0}, + 1276: {region: 0x165, script: 0x57, flags: 0x0}, + 1277: {region: 0x9c, script: 0x8a, flags: 0x0}, + 1278: {region: 0x165, script: 0x57, flags: 0x0}, + 1279: {region: 0x15e, script: 0xc2, flags: 0x0}, + 1280: {region: 0x165, script: 0x57, flags: 0x0}, + 1281: {region: 0x165, script: 0x57, flags: 0x0}, + 1282: {region: 0xdb, script: 0x21, flags: 0x0}, + 1283: {region: 0x165, script: 0x57, flags: 0x0}, + 1284: {region: 0x165, script: 0x57, flags: 0x0}, + 1285: {region: 0xd1, script: 0x57, flags: 0x0}, + 1286: {region: 0x75, script: 0x57, flags: 0x0}, + 1287: {region: 0x165, script: 0x57, flags: 0x0}, + 1288: {region: 0x165, script: 0x57, flags: 0x0}, + 1289: {region: 0x52, script: 0x57, flags: 0x0}, + 1290: {region: 0x165, script: 0x57, flags: 0x0}, + 1291: {region: 0x165, script: 0x57, flags: 0x0}, + 1292: {region: 0x165, script: 0x57, flags: 0x0}, + 1293: {region: 0x52, script: 0x57, flags: 0x0}, + 1294: {region: 0x165, script: 0x57, flags: 0x0}, + 1295: {region: 0x165, script: 0x57, flags: 0x0}, + 1296: {region: 0x165, script: 0x57, flags: 0x0}, + 1297: {region: 0x165, script: 0x57, flags: 0x0}, + 1298: {region: 0x1, script: 0x3b, flags: 0x0}, + 1299: {region: 0x165, script: 0x57, flags: 0x0}, + 1300: {region: 0x165, script: 0x57, flags: 0x0}, + 1301: {region: 0x165, script: 0x57, flags: 0x0}, + 1302: {region: 0x165, script: 0x57, flags: 0x0}, + 1303: {region: 0x165, script: 0x57, flags: 0x0}, + 1304: {region: 0xd6, script: 0x57, flags: 0x0}, + 1305: {region: 0x165, script: 0x57, flags: 0x0}, + 1306: {region: 0x165, script: 0x57, flags: 0x0}, + 1307: {region: 0x165, script: 0x57, flags: 0x0}, + 1308: {region: 0x41, script: 0x57, flags: 0x0}, + 1309: {region: 0x165, script: 0x57, flags: 0x0}, + 1310: {region: 0xcf, script: 0x57, flags: 0x0}, + 1311: {region: 0x4a, script: 0x3, flags: 0x1}, + 1312: {region: 0x165, script: 0x57, flags: 0x0}, + 1313: {region: 0x165, script: 0x57, flags: 0x0}, + 1314: {region: 0x165, script: 0x57, flags: 0x0}, + 1315: {region: 0x53, script: 0x57, flags: 0x0}, + 1316: {region: 0x10b, script: 0x57, flags: 0x0}, + 1318: {region: 0xa8, script: 0x5, flags: 0x0}, + 1319: {region: 0xd9, script: 0x57, flags: 0x0}, + 1320: {region: 0xba, script: 0xdc, flags: 0x0}, + 1321: {region: 0x4d, script: 0x14, flags: 0x1}, + 1322: {region: 0x53, script: 0x79, flags: 0x0}, + 1323: {region: 0x165, script: 0x57, flags: 0x0}, + 1324: {region: 0x122, script: 0x57, flags: 0x0}, + 1325: {region: 0xd0, script: 0x57, flags: 0x0}, + 1326: {region: 0x165, script: 0x57, flags: 0x0}, + 1327: {region: 0x161, script: 0x57, flags: 0x0}, + 1329: {region: 0x12b, script: 0x57, flags: 0x0}, +} + +// likelyLangList holds lists info associated with likelyLang. +// Size: 388 bytes, 97 elements +var likelyLangList = [97]likelyScriptRegion{ + 0: {region: 0x9c, script: 0x7, flags: 0x0}, + 1: {region: 0xa1, script: 0x74, flags: 0x2}, + 2: {region: 0x11c, script: 0x80, flags: 0x2}, + 3: {region: 0x32, script: 0x57, flags: 0x0}, + 4: {region: 0x9b, script: 0x5, flags: 0x4}, + 5: {region: 0x9c, script: 0x5, flags: 0x4}, + 6: {region: 0x106, script: 0x1f, flags: 0x4}, + 7: {region: 0x9c, script: 0x5, flags: 0x2}, + 8: {region: 0x106, script: 0x1f, flags: 0x0}, + 9: {region: 0x38, script: 0x2c, flags: 0x2}, + 10: {region: 0x135, script: 0x57, flags: 0x0}, + 11: {region: 0x7b, script: 0xc5, flags: 0x2}, + 12: {region: 0x114, script: 0x57, flags: 0x0}, + 13: {region: 0x84, script: 0x1, flags: 0x2}, + 14: {region: 0x5d, script: 0x1e, flags: 0x0}, + 15: {region: 0x87, script: 0x5c, flags: 0x2}, + 16: {region: 0xd6, script: 0x57, flags: 0x0}, + 17: {region: 0x52, script: 0x5, flags: 0x4}, + 18: {region: 0x10b, script: 0x5, flags: 0x4}, + 19: {region: 0xae, script: 0x1f, flags: 0x0}, + 20: {region: 0x24, script: 0x5, flags: 0x4}, + 21: {region: 0x53, script: 0x5, flags: 0x4}, + 22: {region: 0x9c, script: 0x5, flags: 0x4}, + 23: {region: 0xc5, script: 0x5, flags: 0x4}, + 24: {region: 0x53, script: 0x5, flags: 0x2}, + 25: {region: 0x12b, script: 0x57, flags: 0x0}, + 26: {region: 0xb0, script: 0x5, flags: 0x4}, + 27: {region: 0x9b, script: 0x5, flags: 0x2}, + 28: {region: 0xa5, script: 0x1f, flags: 0x0}, + 29: {region: 0x53, script: 0x5, flags: 0x4}, + 30: {region: 0x12b, script: 0x57, flags: 0x4}, + 31: {region: 0x53, script: 0x5, flags: 0x2}, + 32: {region: 0x12b, script: 0x57, flags: 0x2}, + 33: {region: 0xdb, script: 0x21, flags: 0x0}, + 34: {region: 0x99, script: 0x5a, flags: 0x2}, + 35: {region: 0x83, script: 0x57, flags: 0x0}, + 36: {region: 0x84, script: 0x78, flags: 0x4}, + 37: {region: 0x84, script: 0x78, flags: 0x2}, + 38: {region: 0xc5, script: 0x1f, flags: 0x0}, + 39: {region: 0x53, script: 0x6d, flags: 0x4}, + 40: {region: 0x53, script: 0x6d, flags: 0x2}, + 41: {region: 0xd0, script: 0x57, flags: 0x0}, + 42: {region: 0x4a, script: 0x5, flags: 0x4}, + 43: {region: 0x95, script: 0x5, flags: 0x4}, + 44: {region: 0x99, script: 0x33, flags: 0x0}, + 45: {region: 0xe8, script: 0x5, flags: 0x4}, + 46: {region: 0xe8, script: 0x5, flags: 0x2}, + 47: {region: 0x9c, script: 0x84, flags: 0x0}, + 48: {region: 0x53, script: 0x85, flags: 0x2}, + 49: {region: 0xba, script: 0xdc, flags: 0x0}, + 50: {region: 0xd9, script: 0x57, flags: 0x4}, + 51: {region: 0xe8, script: 0x5, flags: 0x0}, + 52: {region: 0x99, script: 0x21, flags: 0x2}, + 53: {region: 0x99, script: 0x4c, flags: 0x2}, + 54: {region: 0x99, script: 0xc9, flags: 0x2}, + 55: {region: 0x105, script: 0x1f, flags: 0x0}, + 56: {region: 0xbd, script: 0x57, flags: 0x4}, + 57: {region: 0x104, script: 0x57, flags: 0x4}, + 58: {region: 0x106, script: 0x57, flags: 0x4}, + 59: {region: 0x12b, script: 0x57, flags: 0x4}, + 60: {region: 0x124, script: 0x1f, flags: 0x0}, + 61: {region: 0xe8, script: 0x5, flags: 0x4}, + 62: {region: 0xe8, script: 0x5, flags: 0x2}, + 63: {region: 0x53, script: 0x5, flags: 0x0}, + 64: {region: 0xae, script: 0x1f, flags: 0x4}, + 65: {region: 0xc5, script: 0x1f, flags: 0x4}, + 66: {region: 0xae, script: 0x1f, flags: 0x2}, + 67: {region: 0x99, script: 0xe, flags: 0x0}, + 68: {region: 0xdb, script: 0x21, flags: 0x4}, + 69: {region: 0xdb, script: 0x21, flags: 0x2}, + 70: {region: 0x137, script: 0x57, flags: 0x0}, + 71: {region: 0x24, script: 0x5, flags: 0x4}, + 72: {region: 0x53, script: 0x1f, flags: 0x4}, + 73: {region: 0x24, script: 0x5, flags: 0x2}, + 74: {region: 0x8d, script: 0x39, flags: 0x0}, + 75: {region: 0x53, script: 0x38, flags: 0x4}, + 76: {region: 0x53, script: 0x38, flags: 0x2}, + 77: {region: 0x53, script: 0x38, flags: 0x0}, + 78: {region: 0x2f, script: 0x39, flags: 0x4}, + 79: {region: 0x3e, script: 0x39, flags: 0x4}, + 80: {region: 0x7b, script: 0x39, flags: 0x4}, + 81: {region: 0x7e, script: 0x39, flags: 0x4}, + 82: {region: 0x8d, script: 0x39, flags: 0x4}, + 83: {region: 0x95, script: 0x39, flags: 0x4}, + 84: {region: 0xc6, script: 0x39, flags: 0x4}, + 85: {region: 0xd0, script: 0x39, flags: 0x4}, + 86: {region: 0xe2, script: 0x39, flags: 0x4}, + 87: {region: 0xe5, script: 0x39, flags: 0x4}, + 88: {region: 0xe7, script: 0x39, flags: 0x4}, + 89: {region: 0x116, script: 0x39, flags: 0x4}, + 90: {region: 0x123, script: 0x39, flags: 0x4}, + 91: {region: 0x12e, script: 0x39, flags: 0x4}, + 92: {region: 0x135, script: 0x39, flags: 0x4}, + 93: {region: 0x13e, script: 0x39, flags: 0x4}, + 94: {region: 0x12e, script: 0x11, flags: 0x2}, + 95: {region: 0x12e, script: 0x34, flags: 0x2}, + 96: {region: 0x12e, script: 0x39, flags: 0x2}, +} + +type likelyLangScript struct { + lang uint16 + script uint8 + flags uint8 +} + +// likelyRegion is a lookup table, indexed by regionID, for the most likely +// languages and scripts given incomplete information. If more entries exist +// for a given regionID, lang and script are the index and size respectively +// of the list in likelyRegionList. +// TODO: exclude containers and user-definable regions from the list. +// Size: 1432 bytes, 358 elements +var likelyRegion = [358]likelyLangScript{ + 34: {lang: 0xd7, script: 0x57, flags: 0x0}, + 35: {lang: 0x3a, script: 0x5, flags: 0x0}, + 36: {lang: 0x0, script: 0x2, flags: 0x1}, + 39: {lang: 0x2, script: 0x2, flags: 0x1}, + 40: {lang: 0x4, script: 0x2, flags: 0x1}, + 42: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 43: {lang: 0x0, script: 0x57, flags: 0x0}, + 44: {lang: 0x13e, script: 0x57, flags: 0x0}, + 45: {lang: 0x41b, script: 0x57, flags: 0x0}, + 46: {lang: 0x10d, script: 0x57, flags: 0x0}, + 48: {lang: 0x367, script: 0x57, flags: 0x0}, + 49: {lang: 0x444, script: 0x57, flags: 0x0}, + 50: {lang: 0x58, script: 0x57, flags: 0x0}, + 51: {lang: 0x6, script: 0x2, flags: 0x1}, + 53: {lang: 0xa5, script: 0xe, flags: 0x0}, + 54: {lang: 0x367, script: 0x57, flags: 0x0}, + 55: {lang: 0x15e, script: 0x57, flags: 0x0}, + 56: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 57: {lang: 0x3a, script: 0x5, flags: 0x0}, + 58: {lang: 0x3d9, script: 0x57, flags: 0x0}, + 59: {lang: 0x15e, script: 0x57, flags: 0x0}, + 60: {lang: 0x15e, script: 0x57, flags: 0x0}, + 62: {lang: 0x31f, script: 0x57, flags: 0x0}, + 63: {lang: 0x13e, script: 0x57, flags: 0x0}, + 64: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 65: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 67: {lang: 0x8, script: 0x2, flags: 0x1}, + 69: {lang: 0x0, script: 0x57, flags: 0x0}, + 71: {lang: 0x71, script: 0x1f, flags: 0x0}, + 73: {lang: 0x512, script: 0x3b, flags: 0x2}, + 74: {lang: 0x31f, script: 0x5, flags: 0x2}, + 75: {lang: 0x445, script: 0x57, flags: 0x0}, + 76: {lang: 0x15e, script: 0x57, flags: 0x0}, + 77: {lang: 0x15e, script: 0x57, flags: 0x0}, + 78: {lang: 0x10d, script: 0x57, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 81: {lang: 0x13e, script: 0x57, flags: 0x0}, + 82: {lang: 0x15e, script: 0x57, flags: 0x0}, + 83: {lang: 0xa, script: 0x4, flags: 0x1}, + 84: {lang: 0x13e, script: 0x57, flags: 0x0}, + 85: {lang: 0x0, script: 0x57, flags: 0x0}, + 86: {lang: 0x13e, script: 0x57, flags: 0x0}, + 89: {lang: 0x13e, script: 0x57, flags: 0x0}, + 90: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 91: {lang: 0x3a1, script: 0x57, flags: 0x0}, + 93: {lang: 0xe, script: 0x2, flags: 0x1}, + 94: {lang: 0xfa, script: 0x57, flags: 0x0}, + 96: {lang: 0x10d, script: 0x57, flags: 0x0}, + 98: {lang: 0x1, script: 0x57, flags: 0x0}, + 99: {lang: 0x101, script: 0x57, flags: 0x0}, + 101: {lang: 0x13e, script: 0x57, flags: 0x0}, + 103: {lang: 0x10, script: 0x2, flags: 0x1}, + 104: {lang: 0x13e, script: 0x57, flags: 0x0}, + 105: {lang: 0x13e, script: 0x57, flags: 0x0}, + 106: {lang: 0x140, script: 0x57, flags: 0x0}, + 107: {lang: 0x3a, script: 0x5, flags: 0x0}, + 108: {lang: 0x3a, script: 0x5, flags: 0x0}, + 109: {lang: 0x46f, script: 0x29, flags: 0x0}, + 110: {lang: 0x13e, script: 0x57, flags: 0x0}, + 111: {lang: 0x12, script: 0x2, flags: 0x1}, + 113: {lang: 0x10d, script: 0x57, flags: 0x0}, + 114: {lang: 0x151, script: 0x57, flags: 0x0}, + 115: {lang: 0x1c0, script: 0x21, flags: 0x2}, + 118: {lang: 0x158, script: 0x57, flags: 0x0}, + 120: {lang: 0x15e, script: 0x57, flags: 0x0}, + 122: {lang: 0x15e, script: 0x57, flags: 0x0}, + 123: {lang: 0x14, script: 0x2, flags: 0x1}, + 125: {lang: 0x16, script: 0x3, flags: 0x1}, + 126: {lang: 0x15e, script: 0x57, flags: 0x0}, + 128: {lang: 0x21, script: 0x57, flags: 0x0}, + 130: {lang: 0x245, script: 0x57, flags: 0x0}, + 132: {lang: 0x15e, script: 0x57, flags: 0x0}, + 133: {lang: 0x15e, script: 0x57, flags: 0x0}, + 134: {lang: 0x13e, script: 0x57, flags: 0x0}, + 135: {lang: 0x19, script: 0x2, flags: 0x1}, + 136: {lang: 0x0, script: 0x57, flags: 0x0}, + 137: {lang: 0x13e, script: 0x57, flags: 0x0}, + 139: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 141: {lang: 0x529, script: 0x39, flags: 0x0}, + 142: {lang: 0x0, script: 0x57, flags: 0x0}, + 143: {lang: 0x13e, script: 0x57, flags: 0x0}, + 144: {lang: 0x1d1, script: 0x57, flags: 0x0}, + 145: {lang: 0x1d4, script: 0x57, flags: 0x0}, + 146: {lang: 0x1d5, script: 0x57, flags: 0x0}, + 148: {lang: 0x13e, script: 0x57, flags: 0x0}, + 149: {lang: 0x1b, script: 0x2, flags: 0x1}, + 151: {lang: 0x1bc, script: 0x3b, flags: 0x0}, + 153: {lang: 0x1d, script: 0x3, flags: 0x1}, + 155: {lang: 0x3a, script: 0x5, flags: 0x0}, + 156: {lang: 0x20, script: 0x2, flags: 0x1}, + 157: {lang: 0x1f8, script: 0x57, flags: 0x0}, + 158: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 161: {lang: 0x3a, script: 0x5, flags: 0x0}, + 162: {lang: 0x200, script: 0x46, flags: 0x0}, + 164: {lang: 0x445, script: 0x57, flags: 0x0}, + 165: {lang: 0x28a, script: 0x1f, flags: 0x0}, + 166: {lang: 0x22, script: 0x3, flags: 0x1}, + 168: {lang: 0x25, script: 0x2, flags: 0x1}, + 170: {lang: 0x254, script: 0x50, flags: 0x0}, + 171: {lang: 0x254, script: 0x50, flags: 0x0}, + 172: {lang: 0x3a, script: 0x5, flags: 0x0}, + 174: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 175: {lang: 0x27, script: 0x2, flags: 0x1}, + 176: {lang: 0x3a, script: 0x5, flags: 0x0}, + 178: {lang: 0x10d, script: 0x57, flags: 0x0}, + 179: {lang: 0x40c, script: 0xca, flags: 0x0}, + 181: {lang: 0x43b, script: 0x57, flags: 0x0}, + 182: {lang: 0x2c0, script: 0x57, flags: 0x0}, + 183: {lang: 0x15e, script: 0x57, flags: 0x0}, + 184: {lang: 0x2c7, script: 0x57, flags: 0x0}, + 185: {lang: 0x3a, script: 0x5, flags: 0x0}, + 186: {lang: 0x29, script: 0x2, flags: 0x1}, + 187: {lang: 0x15e, script: 0x57, flags: 0x0}, + 188: {lang: 0x2b, script: 0x2, flags: 0x1}, + 189: {lang: 0x432, script: 0x57, flags: 0x0}, + 190: {lang: 0x15e, script: 0x57, flags: 0x0}, + 191: {lang: 0x2f1, script: 0x57, flags: 0x0}, + 194: {lang: 0x2d, script: 0x2, flags: 0x1}, + 195: {lang: 0xa0, script: 0x57, flags: 0x0}, + 196: {lang: 0x2f, script: 0x2, flags: 0x1}, + 197: {lang: 0x31, script: 0x2, flags: 0x1}, + 198: {lang: 0x33, script: 0x2, flags: 0x1}, + 200: {lang: 0x15e, script: 0x57, flags: 0x0}, + 201: {lang: 0x35, script: 0x2, flags: 0x1}, + 203: {lang: 0x320, script: 0x57, flags: 0x0}, + 204: {lang: 0x37, script: 0x3, flags: 0x1}, + 205: {lang: 0x128, script: 0xde, flags: 0x0}, + 207: {lang: 0x13e, script: 0x57, flags: 0x0}, + 208: {lang: 0x31f, script: 0x57, flags: 0x0}, + 209: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 210: {lang: 0x16, script: 0x57, flags: 0x0}, + 211: {lang: 0x15e, script: 0x57, flags: 0x0}, + 212: {lang: 0x1b4, script: 0x57, flags: 0x0}, + 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, + 216: {lang: 0x13e, script: 0x57, flags: 0x0}, + 217: {lang: 0x367, script: 0x57, flags: 0x0}, + 218: {lang: 0x347, script: 0x57, flags: 0x0}, + 219: {lang: 0x351, script: 0x21, flags: 0x0}, + 225: {lang: 0x3a, script: 0x5, flags: 0x0}, + 226: {lang: 0x13e, script: 0x57, flags: 0x0}, + 228: {lang: 0x13e, script: 0x57, flags: 0x0}, + 229: {lang: 0x15e, script: 0x57, flags: 0x0}, + 230: {lang: 0x486, script: 0x57, flags: 0x0}, + 231: {lang: 0x153, script: 0x57, flags: 0x0}, + 232: {lang: 0x3a, script: 0x3, flags: 0x1}, + 233: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 234: {lang: 0x15e, script: 0x57, flags: 0x0}, + 236: {lang: 0x13e, script: 0x57, flags: 0x0}, + 237: {lang: 0x3a, script: 0x5, flags: 0x0}, + 238: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 240: {lang: 0x3a2, script: 0x57, flags: 0x0}, + 241: {lang: 0x194, script: 0x57, flags: 0x0}, + 243: {lang: 0x3a, script: 0x5, flags: 0x0}, + 258: {lang: 0x15e, script: 0x57, flags: 0x0}, + 260: {lang: 0x3d, script: 0x2, flags: 0x1}, + 261: {lang: 0x432, script: 0x1f, flags: 0x0}, + 262: {lang: 0x3f, script: 0x2, flags: 0x1}, + 263: {lang: 0x3e5, script: 0x57, flags: 0x0}, + 264: {lang: 0x3a, script: 0x5, flags: 0x0}, + 266: {lang: 0x15e, script: 0x57, flags: 0x0}, + 267: {lang: 0x3a, script: 0x5, flags: 0x0}, + 268: {lang: 0x41, script: 0x2, flags: 0x1}, + 271: {lang: 0x416, script: 0x57, flags: 0x0}, + 272: {lang: 0x347, script: 0x57, flags: 0x0}, + 273: {lang: 0x43, script: 0x2, flags: 0x1}, + 275: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 276: {lang: 0x15e, script: 0x57, flags: 0x0}, + 277: {lang: 0x429, script: 0x57, flags: 0x0}, + 278: {lang: 0x367, script: 0x57, flags: 0x0}, + 280: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 282: {lang: 0x13e, script: 0x57, flags: 0x0}, + 284: {lang: 0x45, script: 0x2, flags: 0x1}, + 288: {lang: 0x15e, script: 0x57, flags: 0x0}, + 289: {lang: 0x15e, script: 0x57, flags: 0x0}, + 290: {lang: 0x47, script: 0x2, flags: 0x1}, + 291: {lang: 0x49, script: 0x3, flags: 0x1}, + 292: {lang: 0x4c, script: 0x2, flags: 0x1}, + 293: {lang: 0x477, script: 0x57, flags: 0x0}, + 294: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 295: {lang: 0x476, script: 0x57, flags: 0x0}, + 296: {lang: 0x4e, script: 0x2, flags: 0x1}, + 297: {lang: 0x482, script: 0x57, flags: 0x0}, + 299: {lang: 0x50, script: 0x4, flags: 0x1}, + 301: {lang: 0x4a0, script: 0x57, flags: 0x0}, + 302: {lang: 0x54, script: 0x2, flags: 0x1}, + 303: {lang: 0x445, script: 0x57, flags: 0x0}, + 304: {lang: 0x56, script: 0x3, flags: 0x1}, + 305: {lang: 0x445, script: 0x57, flags: 0x0}, + 309: {lang: 0x512, script: 0x3b, flags: 0x2}, + 310: {lang: 0x13e, script: 0x57, flags: 0x0}, + 311: {lang: 0x4bc, script: 0x57, flags: 0x0}, + 312: {lang: 0x1f9, script: 0x57, flags: 0x0}, + 315: {lang: 0x13e, script: 0x57, flags: 0x0}, + 318: {lang: 0x4c3, script: 0x57, flags: 0x0}, + 319: {lang: 0x8a, script: 0x57, flags: 0x0}, + 320: {lang: 0x15e, script: 0x57, flags: 0x0}, + 322: {lang: 0x41b, script: 0x57, flags: 0x0}, + 333: {lang: 0x59, script: 0x2, flags: 0x1}, + 350: {lang: 0x3a, script: 0x5, flags: 0x0}, + 351: {lang: 0x5b, script: 0x2, flags: 0x1}, + 356: {lang: 0x423, script: 0x57, flags: 0x0}, +} + +// likelyRegionList holds lists info associated with likelyRegion. +// Size: 372 bytes, 93 elements +var likelyRegionList = [93]likelyLangScript{ + 0: {lang: 0x148, script: 0x5, flags: 0x0}, + 1: {lang: 0x476, script: 0x57, flags: 0x0}, + 2: {lang: 0x431, script: 0x57, flags: 0x0}, + 3: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, + 5: {lang: 0x274, script: 0x57, flags: 0x0}, + 6: {lang: 0xb7, script: 0x57, flags: 0x0}, + 7: {lang: 0x432, script: 0x1f, flags: 0x0}, + 8: {lang: 0x12d, script: 0xe0, flags: 0x0}, + 9: {lang: 0x351, script: 0x21, flags: 0x0}, + 10: {lang: 0x529, script: 0x38, flags: 0x0}, + 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, + 12: {lang: 0x523, script: 0x57, flags: 0x0}, + 13: {lang: 0x29a, script: 0xdf, flags: 0x0}, + 14: {lang: 0x136, script: 0x31, flags: 0x0}, + 15: {lang: 0x48a, script: 0x57, flags: 0x0}, + 16: {lang: 0x3a, script: 0x5, flags: 0x0}, + 17: {lang: 0x15e, script: 0x57, flags: 0x0}, + 18: {lang: 0x27, script: 0x29, flags: 0x0}, + 19: {lang: 0x139, script: 0x57, flags: 0x0}, + 20: {lang: 0x26a, script: 0x5, flags: 0x2}, + 21: {lang: 0x512, script: 0x3b, flags: 0x2}, + 22: {lang: 0x210, script: 0x2b, flags: 0x0}, + 23: {lang: 0x5, script: 0x1f, flags: 0x0}, + 24: {lang: 0x274, script: 0x57, flags: 0x0}, + 25: {lang: 0x136, script: 0x31, flags: 0x0}, + 26: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 27: {lang: 0x1e1, script: 0x57, flags: 0x0}, + 28: {lang: 0x31f, script: 0x5, flags: 0x0}, + 29: {lang: 0x1be, script: 0x21, flags: 0x0}, + 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 31: {lang: 0x236, script: 0x72, flags: 0x0}, + 32: {lang: 0x148, script: 0x5, flags: 0x0}, + 33: {lang: 0x476, script: 0x57, flags: 0x0}, + 34: {lang: 0x24a, script: 0x4b, flags: 0x0}, + 35: {lang: 0xe6, script: 0x5, flags: 0x0}, + 36: {lang: 0x226, script: 0xdf, flags: 0x0}, + 37: {lang: 0x3a, script: 0x5, flags: 0x0}, + 38: {lang: 0x15e, script: 0x57, flags: 0x0}, + 39: {lang: 0x2b8, script: 0x54, flags: 0x0}, + 40: {lang: 0x226, script: 0xdf, flags: 0x0}, + 41: {lang: 0x3a, script: 0x5, flags: 0x0}, + 42: {lang: 0x15e, script: 0x57, flags: 0x0}, + 43: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 44: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 45: {lang: 0x2ff, script: 0x1f, flags: 0x0}, + 46: {lang: 0x431, script: 0x57, flags: 0x0}, + 47: {lang: 0x331, script: 0x72, flags: 0x0}, + 48: {lang: 0x213, script: 0x57, flags: 0x0}, + 49: {lang: 0x30b, script: 0x1f, flags: 0x0}, + 50: {lang: 0x242, script: 0x5, flags: 0x0}, + 51: {lang: 0x529, script: 0x39, flags: 0x0}, + 52: {lang: 0x3c0, script: 0x57, flags: 0x0}, + 53: {lang: 0x3a, script: 0x5, flags: 0x0}, + 54: {lang: 0x15e, script: 0x57, flags: 0x0}, + 55: {lang: 0x2ed, script: 0x57, flags: 0x0}, + 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 57: {lang: 0x88, script: 0x21, flags: 0x0}, + 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, + 60: {lang: 0xbe, script: 0x21, flags: 0x0}, + 61: {lang: 0x3dc, script: 0x57, flags: 0x0}, + 62: {lang: 0x7e, script: 0x1f, flags: 0x0}, + 63: {lang: 0x3e2, script: 0x1f, flags: 0x0}, + 64: {lang: 0x267, script: 0x57, flags: 0x0}, + 65: {lang: 0x444, script: 0x57, flags: 0x0}, + 66: {lang: 0x512, script: 0x3b, flags: 0x0}, + 67: {lang: 0x412, script: 0x57, flags: 0x0}, + 68: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 69: {lang: 0x3a, script: 0x5, flags: 0x0}, + 70: {lang: 0x15e, script: 0x57, flags: 0x0}, + 71: {lang: 0x15e, script: 0x57, flags: 0x0}, + 72: {lang: 0x35, script: 0x5, flags: 0x0}, + 73: {lang: 0x46b, script: 0xdf, flags: 0x0}, + 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, + 75: {lang: 0x30f, script: 0x72, flags: 0x0}, + 76: {lang: 0x467, script: 0x1f, flags: 0x0}, + 77: {lang: 0x148, script: 0x5, flags: 0x0}, + 78: {lang: 0x3a, script: 0x5, flags: 0x0}, + 79: {lang: 0x15e, script: 0x57, flags: 0x0}, + 80: {lang: 0x48a, script: 0x57, flags: 0x0}, + 81: {lang: 0x58, script: 0x5, flags: 0x0}, + 82: {lang: 0x219, script: 0x1f, flags: 0x0}, + 83: {lang: 0x81, script: 0x31, flags: 0x0}, + 84: {lang: 0x529, script: 0x39, flags: 0x0}, + 85: {lang: 0x48c, script: 0x57, flags: 0x0}, + 86: {lang: 0x4ae, script: 0x1f, flags: 0x0}, + 87: {lang: 0x512, script: 0x3b, flags: 0x0}, + 88: {lang: 0x3b3, script: 0x57, flags: 0x0}, + 89: {lang: 0x431, script: 0x57, flags: 0x0}, + 90: {lang: 0x432, script: 0x1f, flags: 0x0}, + 91: {lang: 0x15e, script: 0x57, flags: 0x0}, + 92: {lang: 0x446, script: 0x5, flags: 0x0}, +} + +type likelyTag struct { + lang uint16 + region uint16 + script uint8 +} + +// Size: 198 bytes, 33 elements +var likelyRegionGroup = [33]likelyTag{ + 1: {lang: 0x139, region: 0xd6, script: 0x57}, + 2: {lang: 0x139, region: 0x135, script: 0x57}, + 3: {lang: 0x3c0, region: 0x41, script: 0x57}, + 4: {lang: 0x139, region: 0x2f, script: 0x57}, + 5: {lang: 0x139, region: 0xd6, script: 0x57}, + 6: {lang: 0x13e, region: 0xcf, script: 0x57}, + 7: {lang: 0x445, region: 0x12f, script: 0x57}, + 8: {lang: 0x3a, region: 0x6b, script: 0x5}, + 9: {lang: 0x445, region: 0x4b, script: 0x57}, + 10: {lang: 0x139, region: 0x161, script: 0x57}, + 11: {lang: 0x139, region: 0x135, script: 0x57}, + 12: {lang: 0x139, region: 0x135, script: 0x57}, + 13: {lang: 0x13e, region: 0x59, script: 0x57}, + 14: {lang: 0x529, region: 0x53, script: 0x38}, + 15: {lang: 0x1be, region: 0x99, script: 0x21}, + 16: {lang: 0x1e1, region: 0x95, script: 0x57}, + 17: {lang: 0x1f9, region: 0x9e, script: 0x57}, + 18: {lang: 0x139, region: 0x2f, script: 0x57}, + 19: {lang: 0x139, region: 0xe6, script: 0x57}, + 20: {lang: 0x139, region: 0x8a, script: 0x57}, + 21: {lang: 0x41b, region: 0x142, script: 0x57}, + 22: {lang: 0x529, region: 0x53, script: 0x38}, + 23: {lang: 0x4bc, region: 0x137, script: 0x57}, + 24: {lang: 0x3a, region: 0x108, script: 0x5}, + 25: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 26: {lang: 0x3e2, region: 0x106, script: 0x1f}, + 27: {lang: 0x139, region: 0x7b, script: 0x57}, + 28: {lang: 0x10d, region: 0x60, script: 0x57}, + 29: {lang: 0x139, region: 0xd6, script: 0x57}, + 30: {lang: 0x13e, region: 0x1f, script: 0x57}, + 31: {lang: 0x139, region: 0x9a, script: 0x57}, + 32: {lang: 0x139, region: 0x7b, script: 0x57}, +} + +// Size: 264 bytes, 33 elements +var regionContainment = [33]uint64{ + // Entry 0 - 1F + 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, + 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, + 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, + 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, + 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, + 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, + 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, + // Entry 20 - 3F + 0x0000000100000000, +} + +// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, +// where each set holds all groupings that are directly connected in a region +// containment graph. +// Size: 358 bytes, 358 elements +var regionInclusion = [358]uint8{ + // Entry 0 - 3F + 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, + 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, + 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, + 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, + 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, + 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, + 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, + 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, + // Entry 40 - 7F + 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, + 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, + 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, + 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, + 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, + 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, + 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, + 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, + // Entry 80 - BF + 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, + 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, + 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, + 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, + 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, + 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, + 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, + 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, + // Entry C0 - FF + 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, + 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, + 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, + 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, + 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, + 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, + 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + // Entry 100 - 13F + 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, + 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, + 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, + 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, + 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, + 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, + 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, + 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, + // Entry 140 - 17F + 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, + 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, +} + +// regionInclusionBits is an array of bit vectors where every vector represents +// a set of region groupings. These sets are used to compute the distance +// between two regions for the purpose of language matching. +// Size: 584 bytes, 73 elements +var regionInclusionBits = [73]uint64{ + // Entry 0 - 1F + 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, + 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, + 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, + 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, + 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, + 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, + 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, + 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, + // Entry 20 - 3F + 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, + 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, + 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, + 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, + 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, + 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, + 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, + 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, + // Entry 40 - 5F + 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, + 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, + 0x0000000102020001, +} + +// regionInclusionNext marks, for each entry in regionInclusionBits, the set of +// all groups that are reachable from the groups set in the respective entry. +// Size: 73 bytes, 73 elements +var regionInclusionNext = [73]uint8{ + // Entry 0 - 3F + 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, + 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, + 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, + 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, + 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, + 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, + 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, + 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, + // Entry 40 - 7F + 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, + 0x43, +} + +type parentRel struct { + lang uint16 + script uint8 + maxScript uint8 + toRegion uint16 + fromRegion []uint16 +} + +// Size: 414 bytes, 5 elements +var parents = [5]parentRel{ + 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, + 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, + 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, + 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, + 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, +} + +// Total table size 25886 bytes (25KiB); checksum: 50D3D57D diff --git a/vendor/golang.org/x/text/internal/language/tags.go b/vendor/golang.org/x/text/internal/language/tags.go new file mode 100644 index 0000000000..e7afd3188e --- /dev/null +++ b/vendor/golang.org/x/text/internal/language/tags.go @@ -0,0 +1,48 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package language + +// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. +// It simplifies safe initialization of Tag values. +func MustParse(s string) Tag { + t, err := Parse(s) + if err != nil { + panic(err) + } + return t +} + +// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. +// It simplifies safe initialization of Base values. +func MustParseBase(s string) Language { + b, err := ParseBase(s) + if err != nil { + panic(err) + } + return b +} + +// MustParseScript is like ParseScript, but panics if the given script cannot be +// parsed. It simplifies safe initialization of Script values. +func MustParseScript(s string) Script { + scr, err := ParseScript(s) + if err != nil { + panic(err) + } + return scr +} + +// MustParseRegion is like ParseRegion, but panics if the given region cannot be +// parsed. It simplifies safe initialization of Region values. +func MustParseRegion(s string) Region { + r, err := ParseRegion(s) + if err != nil { + panic(err) + } + return r +} + +// Und is the root language. +var Und Tag diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile deleted file mode 100644 index 79f005784f..0000000000 --- a/vendor/golang.org/x/text/language/Makefile +++ /dev/null @@ -1,16 +0,0 @@ -# Copyright 2013 The Go Authors. All rights reserved. -# Use of this source code is governed by a BSD-style -# license that can be found in the LICENSE file. - -CLEANFILES+=maketables - -maketables: maketables.go - go build $^ - -tables: maketables - ./maketables > tables.go - gofmt -w -s tables.go - -# Build (but do not run) maketables during testing, -# just to make sure it still compiles. -testshort: maketables diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go index 101fd23c1d..a24fd1a4d6 100644 --- a/vendor/golang.org/x/text/language/coverage.go +++ b/vendor/golang.org/x/text/language/coverage.go @@ -7,6 +7,8 @@ package language import ( "fmt" "sort" + + "golang.org/x/text/internal/language" ) // The Coverage interface is used to define the level of coverage of an @@ -44,9 +46,9 @@ type allSubtags struct{} // consecutive range, it simply returns a slice of numbers in increasing order. // The "undefined" region is not returned. func (s allSubtags) Regions() []Region { - reg := make([]Region, numRegions) + reg := make([]Region, language.NumRegions) for i := range reg { - reg[i] = Region{regionID(i + 1)} + reg[i] = Region{language.Region(i + 1)} } return reg } @@ -55,9 +57,9 @@ func (s allSubtags) Regions() []Region { // consecutive range, it simply returns a slice of numbers in increasing order. // The "undefined" script is not returned. func (s allSubtags) Scripts() []Script { - scr := make([]Script, numScripts) + scr := make([]Script, language.NumScripts) for i := range scr { - scr[i] = Script{scriptID(i + 1)} + scr[i] = Script{language.Script(i + 1)} } return scr } @@ -65,22 +67,10 @@ func (s allSubtags) Scripts() []Script { // BaseLanguages returns the list of all supported base languages. It generates // the list by traversing the internal structures. func (s allSubtags) BaseLanguages() []Base { - base := make([]Base, 0, numLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Base{langID(i)}) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Base{langID(i)}) - } - v >>= 1 - i++ - } + bs := language.BaseLanguages() + base := make([]Base, len(bs)) + for i, b := range bs { + base[i] = Base{b} } return base } @@ -90,7 +80,7 @@ func (s allSubtags) Tags() []Tag { return nil } -// coverage is used used by NewCoverage which is used as a convenient way for +// coverage is used by NewCoverage which is used as a convenient way for // creating Coverage implementations for partially defined data. Very often a // package will only need to define a subset of slices. coverage provides a // convenient way to do this. Moreover, packages using NewCoverage, instead of @@ -134,7 +124,7 @@ func (s *coverage) BaseLanguages() []Base { } a := make([]Base, len(tags)) for i, t := range tags { - a[i] = Base{langID(t.lang)} + a[i] = Base{language.Language(t.lang())} } sort.Sort(bases(a)) k := 0 diff --git a/vendor/golang.org/x/text/language/gen.go b/vendor/golang.org/x/text/language/gen.go index 302f1940aa..3004eb42c1 100644 --- a/vendor/golang.org/x/text/language/gen.go +++ b/vendor/golang.org/x/text/language/gen.go @@ -10,21 +10,16 @@ package main import ( - "bufio" "flag" "fmt" "io" - "io/ioutil" "log" - "math" - "reflect" - "regexp" "sort" "strconv" "strings" "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/tag" + "golang.org/x/text/internal/language" "golang.org/x/text/unicode/cldr" ) @@ -37,272 +32,17 @@ var ( "output file for generated tables") ) -var comment = []string{ - ` -lang holds an alphabetically sorted list of ISO-639 language identifiers. -All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -For 2-byte language identifiers, the two successive bytes have the following meaning: - - if the first letter of the 2- and 3-letter ISO codes are the same: - the second and third letter of the 3-letter ISO code. - - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -For 3-byte language identifiers the 4th byte is 0.`, - ` -langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -in lookup tables. The language ids for these language codes are derived directly -from the letters and are not consecutive.`, - ` -altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -to 2-letter language codes that cannot be derived using the method described above. -Each 3-letter code is followed by its 1-byte langID.`, - ` -altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, - ` -langAliasMap maps langIDs to their suggested replacements.`, - ` -script is an alphabetically sorted list of ISO 15924 codes. The index -of the script in the string, divided by 4, is the internal scriptID.`, - ` -isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -the UN.M49 codes used for groups.)`, - ` -regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -Each 2-letter codes is followed by two bytes with the following meaning: - - [A-Z}{2}: the first letter of the 2-letter code plus these two - letters form the 3-letter ISO code. - - 0, n: index into altRegionISO3.`, - ` -regionTypes defines the status of a region for various standards.`, - ` -m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -codes indicating collections of regions.`, - ` -m49Index gives indexes into fromM49 based on the three most significant bits -of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in - fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -The region code is stored in the 9 lsb of the indexed value.`, - ` -fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, - ` -altRegionISO3 holds a list of 3-letter region codes that cannot be -mapped to 2-letter codes using the default algorithm. This is a short list.`, - ` -altRegionIDs holds a list of regionIDs the positions of which match those -of the 3-letter ISO codes in altRegionISO3.`, - ` -variantNumSpecialized is the number of specialized variants in variants.`, - ` -suppressScript is an index from langID to the dominant script for that language, -if it exists. If a script is given, it should be suppressed from the language tag.`, - ` -likelyLang is a lookup table, indexed by langID, for the most likely -scripts and regions given incomplete information. If more entries exist for a -given language, region and script are the index and size respectively -of the list in likelyLangList.`, - ` -likelyLangList holds lists info associated with likelyLang.`, - ` -likelyRegion is a lookup table, indexed by regionID, for the most likely -languages and scripts given incomplete information. If more entries exist -for a given regionID, lang and script are the index and size respectively -of the list in likelyRegionList. -TODO: exclude containers and user-definable regions from the list.`, - ` -likelyRegionList holds lists info associated with likelyRegion.`, - ` -likelyScript is a lookup table, indexed by scriptID, for the most likely -languages and regions given a script.`, - ` -matchLang holds pairs of langIDs of base languages that are typically -mutually intelligible. Each pair is associated with a confidence and -whether the intelligibility goes one or both ways.`, - ` -matchScript holds pairs of scriptIDs where readers of one script -can typically also read the other. Each is associated with a confidence.`, - ` -nRegionGroups is the number of region groups.`, - ` -regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -where each set holds all groupings that are directly connected in a region -containment graph.`, - ` -regionInclusionBits is an array of bit vectors where every vector represents -a set of region groupings. These sets are used to compute the distance -between two regions for the purpose of language matching.`, - ` -regionInclusionNext marks, for each entry in regionInclusionBits, the set of -all groups that are reachable from the groups set in the respective entry.`, -} - -// TODO: consider changing some of these structures to tries. This can reduce -// memory, but may increase the need for memory allocations. This could be -// mitigated if we can piggyback on language tags for common cases. - -func failOnError(e error) { - if e != nil { - log.Panic(e) - } -} - -type setType int - -const ( - Indexed setType = 1 + iota // all elements must be of same size - Linear -) - -type stringSet struct { - s []string - sorted, frozen bool - - // We often need to update values after the creation of an index is completed. - // We include a convenience map for keeping track of this. - update map[string]string - typ setType // used for checking. -} - -func (ss *stringSet) clone() stringSet { - c := *ss - c.s = append([]string(nil), c.s...) - return c -} - -func (ss *stringSet) setType(t setType) { - if ss.typ != t && ss.typ != 0 { - log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) - } -} - -// parse parses a whitespace-separated string and initializes ss with its -// components. -func (ss *stringSet) parse(s string) { - scan := bufio.NewScanner(strings.NewReader(s)) - scan.Split(bufio.ScanWords) - for scan.Scan() { - ss.add(scan.Text()) - } -} - -func (ss *stringSet) assertChangeable() { - if ss.frozen { - log.Panic("attempt to modify a frozen stringSet") - } -} - -func (ss *stringSet) add(s string) { - ss.assertChangeable() - ss.s = append(ss.s, s) - ss.sorted = ss.frozen -} - -func (ss *stringSet) freeze() { - ss.compact() - ss.frozen = true -} - -func (ss *stringSet) compact() { - if ss.sorted { - return - } - a := ss.s - sort.Strings(a) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - a[k+1] = a[i] - k++ - } - } - ss.s = a[:k+1] - ss.sorted = ss.frozen -} - -type funcSorter struct { - fn func(a, b string) bool - sort.StringSlice -} - -func (s funcSorter) Less(i, j int) bool { - return s.fn(s.StringSlice[i], s.StringSlice[j]) -} - -func (ss *stringSet) sortFunc(f func(a, b string) bool) { - ss.compact() - sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) -} - -func (ss *stringSet) remove(s string) { - ss.assertChangeable() - if i, ok := ss.find(s); ok { - copy(ss.s[i:], ss.s[i+1:]) - ss.s = ss.s[:len(ss.s)-1] - } -} - -func (ss *stringSet) replace(ol, nu string) { - ss.s[ss.index(ol)] = nu - ss.sorted = ss.frozen -} - -func (ss *stringSet) index(s string) int { - ss.setType(Indexed) - i, ok := ss.find(s) - if !ok { - if i < len(ss.s) { - log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) - } - log.Panicf("find: item %q is not in list", s) - - } - return i -} - -func (ss *stringSet) find(s string) (int, bool) { - ss.compact() - i := sort.SearchStrings(ss.s, s) - return i, i != len(ss.s) && ss.s[i] == s -} - -func (ss *stringSet) slice() []string { - ss.compact() - return ss.s -} +func main() { + gen.Init() -func (ss *stringSet) updateLater(v, key string) { - if ss.update == nil { - ss.update = map[string]string{} - } - ss.update[v] = key -} + w := gen.NewCodeWriter() + defer w.WriteGoFile("tables.go", "language") -// join joins the string and ensures that all entries are of the same length. -func (ss *stringSet) join() string { - ss.setType(Indexed) - n := len(ss.s[0]) - for _, s := range ss.s { - if len(s) != n { - log.Panicf("join: not all entries are of the same length: %q", s) - } - } - ss.s = append(ss.s, strings.Repeat("\xff", n)) - return strings.Join(ss.s, "") -} + b := newBuilder(w) + gen.WriteCLDRVersion(w) -// ianaEntry holds information for an entry in the IANA Language Subtag Repository. -// All types use the same entry. -// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various -// fields. -type ianaEntry struct { - typ string - description []string - scope string - added string - preferred string - deprecated string - suppressScript string - macro string - prefix []string + b.writeConstants() + b.writeMatchData() } type builder struct { @@ -310,546 +50,51 @@ type builder struct { hw io.Writer // MultiWriter for w and w.Hash data *cldr.CLDR supp *cldr.SupplementalData +} - // indices - locale stringSet // common locales - lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data - langNoIndex stringSet // 3-letter ISO codes with no associated data - script stringSet // 4-letter ISO codes - region stringSet // 2-letter ISO or 3-digit UN M49 codes - variant stringSet // 4-8-alphanumeric variant code. - - // Region codes that are groups with their corresponding group IDs. - groups map[int]index +func (b *builder) langIndex(s string) uint16 { + return uint16(language.MustParseBase(s)) +} - // langInfo - registry map[string]*ianaEntry +func (b *builder) regionIndex(s string) int { + return int(language.MustParseRegion(s)) } -type index uint +func (b *builder) scriptIndex(s string) int { + return int(language.MustParseScript(s)) +} func newBuilder(w *gen.CodeWriter) *builder { r := gen.OpenCLDRCoreZip() defer r.Close() d := &cldr.Decoder{} data, err := d.DecodeZip(r) - failOnError(err) + if err != nil { + log.Fatal(err) + } b := builder{ w: w, hw: io.MultiWriter(w, w.Hash), data: data, supp: data.Supplemental(), } - b.parseRegistry() return &b } -func (b *builder) parseRegistry() { - r := gen.OpenIANAFile("assignments/language-subtag-registry") - defer r.Close() - b.registry = make(map[string]*ianaEntry) - - scan := bufio.NewScanner(r) - scan.Split(bufio.ScanWords) - var record *ianaEntry - for more := scan.Scan(); more; { - key := scan.Text() - more = scan.Scan() - value := scan.Text() - switch key { - case "Type:": - record = &ianaEntry{typ: value} - case "Subtag:", "Tag:": - if s := strings.SplitN(value, "..", 2); len(s) > 1 { - for a := s[0]; a <= s[1]; a = inc(a) { - b.addToRegistry(a, record) - } - } else { - b.addToRegistry(value, record) - } - case "Suppress-Script:": - record.suppressScript = value - case "Added:": - record.added = value - case "Deprecated:": - record.deprecated = value - case "Macrolanguage:": - record.macro = value - case "Preferred-Value:": - record.preferred = value - case "Prefix:": - record.prefix = append(record.prefix, value) - case "Scope:": - record.scope = value - case "Description:": - buf := []byte(value) - for more = scan.Scan(); more; more = scan.Scan() { - b := scan.Bytes() - if b[0] == '%' || b[len(b)-1] == ':' { - break - } - buf = append(buf, ' ') - buf = append(buf, b...) - } - record.description = append(record.description, string(buf)) - continue - default: - continue - } - more = scan.Scan() - } - if scan.Err() != nil { - log.Panic(scan.Err()) - } -} - -func (b *builder) addToRegistry(key string, entry *ianaEntry) { - if info, ok := b.registry[key]; ok { - if info.typ != "language" || entry.typ != "extlang" { - log.Fatalf("parseRegistry: tag %q already exists", key) - } - } else { - b.registry[key] = entry - } -} - -var commentIndex = make(map[string]string) - -func init() { - for _, s := range comment { - key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) - commentIndex[key] = s - } -} - -func (b *builder) comment(name string) { - if s := commentIndex[name]; len(s) > 0 { - b.w.WriteComment(s) - } else { - fmt.Fprintln(b.w) - } -} - -func (b *builder) pf(f string, x ...interface{}) { - fmt.Fprintf(b.hw, f, x...) - fmt.Fprint(b.hw, "\n") -} - -func (b *builder) p(x ...interface{}) { - fmt.Fprintln(b.hw, x...) -} - -func (b *builder) addSize(s int) { - b.w.Size += s - b.pf("// Size: %d bytes", s) -} - -func (b *builder) writeConst(name string, x interface{}) { - b.comment(name) - b.w.WriteConst(name, x) -} - // writeConsts computes f(v) for all v in values and writes the results // as constants named _v to a single constant block. func (b *builder) writeConsts(f func(string) int, values ...string) { - b.pf("const (") + fmt.Fprintln(b.w, "const (") for _, v := range values { - b.pf("\t_%s = %v", v, f(v)) - } - b.pf(")") -} - -// writeType writes the type of the given value, which must be a struct. -func (b *builder) writeType(value interface{}) { - b.comment(reflect.TypeOf(value).Name()) - b.w.WriteType(value) -} - -func (b *builder) writeSlice(name string, ss interface{}) { - b.writeSliceAddSize(name, 0, ss) -} - -func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { - b.comment(name) - b.w.Size += extraSize - v := reflect.ValueOf(ss) - t := v.Type().Elem() - b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) - - fmt.Fprintf(b.w, "var %s = ", name) - b.w.WriteArray(ss) - b.p() -} - -type fromTo struct { - from, to uint16 -} - -func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { - ss.sortFunc(func(a, b string) bool { - return index(a) < index(b) - }) - m := []fromTo{} - for _, s := range ss.s { - m = append(m, fromTo{index(s), index(ss.update[s])}) - } - b.writeSlice(name, m) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s string) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -func (b *builder) writeBitVector(name string, ss []string) { - vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) - for _, s := range ss { - v := strToInt(s) - vec[v/8] |= 1 << (v % 8) - } - b.writeSlice(name, vec) -} - -// TODO: convert this type into a list or two-stage trie. -func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size())) - for _, k := range m { - sz += len(k) - } - b.addSize(sz) - keys := []string{} - b.pf(`var %s = map[string]uint16{`, name) - for k := range m { - keys = append(keys, k) - } - sort.Strings(keys) - for _, k := range keys { - b.pf("\t%q: %v,", k, f(m[k])) - } - b.p("}") -} - -func (b *builder) writeMap(name string, m interface{}) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) - b.addSize(sz) - f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { - return strings.IndexRune("{}, ", r) != -1 - }) - sort.Strings(f[1:]) - b.pf(`var %s = %s{`, name, f[0]) - for _, kv := range f[1:] { - b.pf("\t%s,", kv) - } - b.p("}") -} - -func (b *builder) langIndex(s string) uint16 { - if s == "und" { - return 0 - } - if i, ok := b.lang.find(s); ok { - return uint16(i) - } - return uint16(strToInt(s)) + uint16(len(b.lang.s)) -} - -// inc advances the string to its lexicographical successor. -func inc(s string) string { - const maxTagLength = 4 - var buf [maxTagLength]byte - intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) - for i := 0; i < len(s); i++ { - if s[i] <= 'Z' { - buf[i] -= 'a' - 'A' - } - } - return string(buf[:len(s)]) -} - -func (b *builder) parseIndices() { - meta := b.supp.Metadata - - for k, v := range b.registry { - var ss *stringSet - switch v.typ { - case "language": - if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { - b.lang.add(k) - continue - } else { - ss = &b.langNoIndex - } - case "region": - ss = &b.region - case "script": - ss = &b.script - case "variant": - ss = &b.variant - default: - continue - } - ss.add(k) - } - // Include any language for which there is data. - for _, lang := range b.data.Locales() { - if x := b.data.RawLDML(lang); false || - x.LocaleDisplayNames != nil || - x.Characters != nil || - x.Delimiters != nil || - x.Measurement != nil || - x.Dates != nil || - x.Numbers != nil || - x.Units != nil || - x.ListPatterns != nil || - x.Collations != nil || - x.Segmentations != nil || - x.Rbnf != nil || - x.Annotations != nil || - x.Metadata != nil { - - from := strings.Split(lang, "_") - if lang := from[0]; lang != "root" { - b.lang.add(lang) - } - } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range b.data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - if lang = strings.Split(lang, "_")[0]; lang != "root" { - b.lang.add(lang) - } - } - } + fmt.Fprintf(b.w, "\t_%s = %v\n", v, f(v)) } - // Include languages in likely subtags. - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - b.lang.add(from[0]) - } - // Include ISO-639 alpha-3 bibliographic entries. - for _, a := range meta.Alias.LanguageAlias { - if a.Reason == "bibliographic" { - b.langNoIndex.add(a.Type) - } - } - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 { - b.region.add(reg.Type) - } - } - - for _, s := range b.lang.s { - if len(s) == 3 { - b.langNoIndex.remove(s) - } - } - b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) - b.writeConst("numScripts", len(b.script.slice())) - b.writeConst("numRegions", len(b.region.slice())) - - // Add dummy codes at the start of each list to represent "unspecified". - b.lang.add("---") - b.script.add("----") - b.region.add("---") - - // common locales - b.locale.parse(meta.DefaultContent.Locales) + fmt.Fprintln(b.w, ")") } // TODO: region inclusion data will probably not be use used in future matchers. -func (b *builder) computeRegionGroups() { - b.groups = make(map[int]index) - - // Create group indices. - for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. - b.groups[i] = index(len(b.groups)) - } - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - if _, ok := b.groups[group]; !ok { - b.groups[group] = index(len(b.groups)) - } - } - if len(b.groups) > 64 { - log.Fatalf("only 64 groups supported, found %d", len(b.groups)) - } - b.writeConst("nRegionGroups", len(b.groups)) -} - var langConsts = []string{ - "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", - "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", - "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", - "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", - "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", - "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", - - // constants for grandfathered tags (if not already defined) - "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", - "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", -} - -// writeLanguage generates all tables needed for language canonicalization. -func (b *builder) writeLanguage() { - meta := b.supp.Metadata - - b.writeConst("nonCanonicalUnd", b.lang.index("und")) - b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) - b.writeConst("langPrivateStart", b.langIndex("qaa")) - b.writeConst("langPrivateEnd", b.langIndex("qtz")) - - // Get language codes that need to be mapped (overlong 3-letter codes, - // deprecated 2-letter codes, legacy and grandfathered tags.) - langAliasMap := stringSet{} - aliasTypeMap := map[string]langAliasType{} - - // altLangISO3 get the alternative ISO3 names that need to be mapped. - altLangISO3 := stringSet{} - // Add dummy start to avoid the use of index 0. - altLangISO3.add("---") - altLangISO3.updateLater("---", "aa") - - lang := b.lang.clone() - for _, a := range meta.Alias.LanguageAlias { - if a.Replacement == "" { - a.Replacement = "und" - } - // TODO: support mapping to tags - repl := strings.SplitN(a.Replacement, "_", 2)[0] - if a.Reason == "overlong" { - if len(a.Replacement) == 2 && len(a.Type) == 3 { - lang.updateLater(a.Replacement, a.Type) - } - } else if len(a.Type) <= 3 { - switch a.Reason { - case "macrolanguage": - aliasTypeMap[a.Type] = langMacro - case "deprecated": - // handled elsewhere - continue - case "bibliographic", "legacy": - if a.Type == "no" { - continue - } - aliasTypeMap[a.Type] = langLegacy - default: - log.Fatalf("new %s alias: %s", a.Reason, a.Type) - } - langAliasMap.add(a.Type) - langAliasMap.updateLater(a.Type, repl) - } - } - // Manually add the mapping of "nb" (Norwegian) to its macro language. - // This can be removed if CLDR adopts this change. - langAliasMap.add("nb") - langAliasMap.updateLater("nb", "no") - aliasTypeMap["nb"] = langMacro - - for k, v := range b.registry { - // Also add deprecated values for 3-letter ISO codes, which CLDR omits. - if v.typ == "language" && v.deprecated != "" && v.preferred != "" { - langAliasMap.add(k) - langAliasMap.updateLater(k, v.preferred) - aliasTypeMap[k] = langDeprecated - } - } - // Fix CLDR mappings. - lang.updateLater("tl", "tgl") - lang.updateLater("sh", "hbs") - lang.updateLater("mo", "mol") - lang.updateLater("no", "nor") - lang.updateLater("tw", "twi") - lang.updateLater("nb", "nob") - lang.updateLater("ak", "aka") - lang.updateLater("bh", "bih") - - // Ensure that each 2-letter code is matched with a 3-letter code. - for _, v := range lang.s[1:] { - s, ok := lang.update[v] - if !ok { - if s, ok = lang.update[langAliasMap.update[v]]; !ok { - continue - } - lang.update[v] = s - } - if v[0] != s[0] { - altLangISO3.add(s) - altLangISO3.updateLater(s, v) - } - } - - // Complete canonicalized language tags. - lang.freeze() - for i, v := range lang.s { - // We can avoid these manual entries by using the IANA registry directly. - // Seems easier to update the list manually, as changes are rare. - // The panic in this loop will trigger if we miss an entry. - add := "" - if s, ok := lang.update[v]; ok { - if s[0] == v[0] { - add = s[1:] - } else { - add = string([]byte{0, byte(altLangISO3.index(s))}) - } - } else if len(v) == 3 { - add = "\x00" - } else { - log.Panicf("no data for long form of %q", v) - } - lang.s[i] += add - } - b.writeConst("lang", tag.Index(lang.join())) - - b.writeConst("langNoIndexOffset", len(b.lang.s)) - - // space of all valid 3-letter language identifiers. - b.writeBitVector("langNoIndex", b.langNoIndex.slice()) - - altLangIndex := []uint16{} - for i, s := range altLangISO3.slice() { - altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) - if i > 0 { - idx := b.lang.index(altLangISO3.update[s]) - altLangIndex = append(altLangIndex, uint16(idx)) - } - } - b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) - b.writeSlice("altLangIndex", altLangIndex) - - b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex) - types := make([]langAliasType, len(langAliasMap.s)) - for i, s := range langAliasMap.s { - types[i] = aliasTypeMap[s] - } - b.writeSlice("langAliasTypes", types) + "de", "en", "fr", "it", "mo", "no", "nb", "pt", "sh", "mul", "und", } var scriptConsts = []string{ @@ -857,508 +102,15 @@ var scriptConsts = []string{ "Zzzz", } -func (b *builder) writeScript() { - b.writeConsts(b.script.index, scriptConsts...) - b.writeConst("script", tag.Index(b.script.join())) - - supp := make([]uint8, len(b.lang.slice())) - for i, v := range b.lang.slice()[1:] { - if sc := b.registry[v].suppressScript; sc != "" { - supp[i+1] = uint8(b.script.index(sc)) - } - } - b.writeSlice("suppressScript", supp) - - // There is only one deprecated script in CLDR. This value is hard-coded. - // We check here if the code must be updated. - for _, a := range b.supp.Metadata.Alias.ScriptAlias { - if a.Type != "Qaai" { - log.Panicf("unexpected deprecated stript %q", a.Type) - } - } -} - -func parseM49(s string) int16 { - if len(s) == 0 { - return 0 - } - v, err := strconv.ParseUint(s, 10, 10) - failOnError(err) - return int16(v) -} - var regionConsts = []string{ "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. } -func (b *builder) writeRegion() { - b.writeConsts(b.region.index, regionConsts...) - - isoOffset := b.region.index("AA") - m49map := make([]int16, len(b.region.slice())) - fromM49map := make(map[int16]int) - altRegionISO3 := "" - altRegionIDs := []uint16{} - - b.writeConst("isoRegionOffset", isoOffset) - - // 2-letter region lookup and mapping to numeric codes. - regionISO := b.region.clone() - regionISO.s = regionISO.s[isoOffset:] - regionISO.sorted = false - - regionTypes := make([]byte, len(b.region.s)) - - // Is the region valid BCP 47? - for s, e := range b.registry { - if len(s) == 2 && s == strings.ToUpper(s) { - i := b.region.index(s) - for _, d := range e.description { - if strings.Contains(d, "Private use") { - regionTypes[i] = iso3166UserAssigned - } - } - regionTypes[i] |= bcp47Region - } - } - - // Is the region a valid ccTLD? - r := gen.OpenIANAFile("domains/root/db") - defer r.Close() - - buf, err := ioutil.ReadAll(r) - failOnError(err) - re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) - for _, m := range re.FindAllSubmatch(buf, -1) { - i := b.region.index(strings.ToUpper(string(m[1]))) - regionTypes[i] |= ccTLD - } - - b.writeSlice("regionTypes", regionTypes) - - iso3Set := make(map[string]int) - update := func(iso2, iso3 string) { - i := regionISO.index(iso2) - if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { - regionISO.s[i] += iso3[1:] - iso3Set[iso3] = -1 - } else { - if ok && j >= 0 { - regionISO.s[i] += string([]byte{0, byte(j)}) - } else { - iso3Set[iso3] = len(altRegionISO3) - regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) - altRegionISO3 += iso3 - altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - i := regionISO.index(tc.Type) + isoOffset - if d := m49map[i]; d != 0 { - log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) - } - m49 := parseM49(tc.Numeric) - m49map[i] = m49 - if r := fromM49map[m49]; r == 0 { - fromM49map[m49] = i - } else if r != i { - dep := b.registry[regionISO.s[r-isoOffset]].deprecated - if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { - fromM49map[m49] = i - } - } - } - for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { - if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { - from := parseM49(ta.Type) - if r := fromM49map[from]; r == 0 { - fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - if len(tc.Alpha3) == 3 { - update(tc.Type, tc.Alpha3) - } - } - // This entries are not included in territoryCodes. Mostly 3-letter variants - // of deleted codes and an entry for QU. - for _, m := range []struct{ iso2, iso3 string }{ - {"CT", "CTE"}, - {"DY", "DHY"}, - {"HV", "HVO"}, - {"JT", "JTN"}, - {"MI", "MID"}, - {"NH", "NHB"}, - {"NQ", "ATN"}, - {"PC", "PCI"}, - {"PU", "PUS"}, - {"PZ", "PCZ"}, - {"RH", "RHO"}, - {"VD", "VDR"}, - {"WK", "WAK"}, - // These three-letter codes are used for others as well. - {"FQ", "ATF"}, - } { - update(m.iso2, m.iso3) - } - for i, s := range regionISO.s { - if len(s) != 4 { - regionISO.s[i] = s + " " - } - } - b.writeConst("regionISO", tag.Index(regionISO.join())) - b.writeConst("altRegionISO3", altRegionISO3) - b.writeSlice("altRegionIDs", altRegionIDs) - - // Create list of deprecated regions. - // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only - // Transitionally-reserved mapping not included. - regionOldMap := stringSet{} - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { - regionOldMap.add(reg.Type) - regionOldMap.updateLater(reg.Type, reg.Replacement) - i, _ := regionISO.find(reg.Type) - j, _ := regionISO.find(reg.Replacement) - if k := m49map[i+isoOffset]; k == 0 { - m49map[i+isoOffset] = m49map[j+isoOffset] - } - } - } - b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { - return uint16(b.region.index(s)) - }) - // 3-digit region lookup, groupings. - for i := 1; i < isoOffset; i++ { - m := parseM49(b.region.s[i]) - m49map[i] = m - fromM49map[m] = i - } - b.writeSlice("m49", m49map) - - const ( - searchBits = 7 - regionBits = 9 - ) - if len(m49map) >= 1<<regionBits { - log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits) - } - m49Index := [9]int16{} - fromM49 := []uint16{} - m49 := []int{} - for k, _ := range fromM49map { - m49 = append(m49, int(k)) - } - sort.Ints(m49) - for _, k := range m49[1:] { - val := (k & (1<<searchBits - 1)) << regionBits - fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)])) - m49Index[1:][k>>searchBits] = int16(len(fromM49)) - } - b.writeSlice("m49Index", m49Index) - b.writeSlice("fromM49", fromM49) -} - -const ( - // TODO: put these lists in regionTypes as user data? Could be used for - // various optimizations and refinements and could be exposed in the API. - iso3166Except = "AC CP DG EA EU FX IC SU TA UK" - iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. - // DY and RH are actually not deleted, but indeterminately reserved. - iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" -) - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func find(list []string, s string) int { - for i, t := range list { - if t == s { - return i - } - } - return -1 -} - -// writeVariants generates per-variant information and creates a map from variant -// name to index value. We assign index values such that sorting multiple -// variants by index value will result in the correct order. -// There are two types of variants: specialized and general. Specialized variants -// are only applicable to certain language or language-script pairs. Generalized -// variants apply to any language. Generalized variants always sort after -// specialized variants. We will therefore always assign a higher index value -// to a generalized variant than any other variant. Generalized variants are -// sorted alphabetically among themselves. -// Specialized variants may also sort after other specialized variants. Such -// variants will be ordered after any of the variants they may follow. -// We assume that if a variant x is followed by a variant y, then for any prefix -// p of x, p-x is a prefix of y. This allows us to order tags based on the -// maximum of the length of any of its prefixes. -// TODO: it is possible to define a set of Prefix values on variants such that -// a total order cannot be defined to the point that this algorithm breaks. -// In other words, we cannot guarantee the same order of variants for the -// future using the same algorithm or for non-compliant combinations of -// variants. For this reason, consider using simple alphabetic sorting -// of variants and ignore Prefix restrictions altogether. -func (b *builder) writeVariant() { - generalized := stringSet{} - specialized := stringSet{} - specializedExtend := stringSet{} - // Collate the variants by type and check assumptions. - for _, v := range b.variant.slice() { - e := b.registry[v] - if len(e.prefix) == 0 { - generalized.add(v) - continue - } - c := strings.Split(e.prefix[0], "-") - hasScriptOrRegion := false - if len(c) > 1 { - _, hasScriptOrRegion = b.script.find(c[1]) - if !hasScriptOrRegion { - _, hasScriptOrRegion = b.region.find(c[1]) - - } - } - if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { - // Variant is preceded by a language. - specialized.add(v) - continue - } - // Variant is preceded by another variant. - specializedExtend.add(v) - prefix := c[0] + "-" - if hasScriptOrRegion { - prefix += c[1] - } - for _, p := range e.prefix { - // Verify that the prefix minus the last element is a prefix of the - // predecessor element. - i := strings.LastIndex(p, "-") - pred := b.registry[p[i+1:]] - if find(pred.prefix, p[:i]) < 0 { - log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) - } - // The sorting used below does not work in the general case. It works - // if we assume that variants that may be followed by others only have - // prefixes of the same length. Verify this. - count := strings.Count(p[:i], "-") - for _, q := range pred.prefix { - if c := strings.Count(q, "-"); c != count { - log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) - } - } - if !strings.HasPrefix(p, prefix) { - log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) - } - } - } - - // Sort extended variants. - a := specializedExtend.s - less := func(v, w string) bool { - // Sort by the maximum number of elements. - maxCount := func(s string) (max int) { - for _, p := range b.registry[s].prefix { - if c := strings.Count(p, "-"); c > max { - max = c - } - } - return - } - if cv, cw := maxCount(v), maxCount(w); cv != cw { - return cv < cw - } - // Sort by name as tie breaker. - return v < w - } - sort.Sort(funcSorter{less, sort.StringSlice(a)}) - specializedExtend.frozen = true - - // Create index from variant name to index. - variantIndex := make(map[string]uint8) - add := func(s []string) { - for _, v := range s { - variantIndex[v] = uint8(len(variantIndex)) - } - } - add(specialized.slice()) - add(specializedExtend.s) - numSpecialized := len(variantIndex) - add(generalized.slice()) - if n := len(variantIndex); n > 255 { - log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) - } - b.writeMap("variantIndex", variantIndex) - b.writeConst("variantNumSpecialized", numSpecialized) -} - -func (b *builder) writeLanguageInfo() { -} - -// writeLikelyData writes tables that are used both for finding parent relations and for -// language matching. Each entry contains additional bits to indicate the status of the -// data to know when it cannot be used for parent relations. -func (b *builder) writeLikelyData() { - const ( - isList = 1 << iota - scriptInFrom - regionInFrom - ) - type ( // generated types - likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 - } - likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 - } - likelyLangRegion struct { - lang uint16 - region uint16 - } - // likelyTag is used for getting likely tags for group regions, where - // the likely region might be a region contained in the group. - likelyTag struct { - lang uint16 - region uint16 - script uint8 - } - ) - var ( // generated variables - likelyRegionGroup = make([]likelyTag, len(b.groups)) - likelyLang = make([]likelyScriptRegion, len(b.lang.s)) - likelyRegion = make([]likelyLangScript, len(b.region.s)) - likelyScript = make([]likelyLangRegion, len(b.script.s)) - likelyLangList = []likelyScriptRegion{} - likelyRegionList = []likelyLangScript{} - ) - type fromTo struct { - from, to []string - } - langToOther := map[int][]fromTo{} - regionToOther := map[int][]fromTo{} - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - to := strings.Split(m.To, "_") - if len(to) != 3 { - log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) - } - if len(from) > 3 { - log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) - } - if from[0] != to[0] && from[0] != "und" { - log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) - } - if len(from) == 3 { - if from[2] != to[2] { - log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) - } - if from[0] != "und" { - log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) - } - } - if len(from) == 1 || from[0] != "und" { - id := 0 - if from[0] != "und" { - id = b.lang.index(from[0]) - } - langToOther[id] = append(langToOther[id], fromTo{from, to}) - } else if len(from) == 2 && len(from[1]) == 4 { - sid := b.script.index(from[1]) - likelyScript[sid].lang = uint16(b.langIndex(to[0])) - likelyScript[sid].region = uint16(b.region.index(to[2])) - } else { - r := b.region.index(from[len(from)-1]) - if id, ok := b.groups[r]; ok { - if from[0] != "und" { - log.Fatalf("region changed unexpectedly: %s -> %s", from, to) - } - likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) - likelyRegionGroup[id].script = uint8(b.script.index(to[1])) - likelyRegionGroup[id].region = uint16(b.region.index(to[2])) - } else { - regionToOther[r] = append(regionToOther[r], fromTo{from, to}) - } - } - } - b.writeType(likelyLangRegion{}) - b.writeSlice("likelyScript", likelyScript) - - for id := range b.lang.s { - list := langToOther[id] - if len(list) == 1 { - likelyLang[id].region = uint16(b.region.index(list[0].to[2])) - likelyLang[id].script = uint8(b.script.index(list[0].to[1])) - } else if len(list) > 1 { - likelyLang[id].flags = isList - likelyLang[id].region = uint16(len(likelyLangList)) - likelyLang[id].script = uint8(len(list)) - for _, x := range list { - flags := uint8(0) - if len(x.from) > 1 { - if x.from[1] == x.to[2] { - flags = regionInFrom - } else { - flags = scriptInFrom - } - } - likelyLangList = append(likelyLangList, likelyScriptRegion{ - region: uint16(b.region.index(x.to[2])), - script: uint8(b.script.index(x.to[1])), - flags: flags, - }) - } - } - } - // TODO: merge suppressScript data with this table. - b.writeType(likelyScriptRegion{}) - b.writeSlice("likelyLang", likelyLang) - b.writeSlice("likelyLangList", likelyLangList) - - for id := range b.region.s { - list := regionToOther[id] - if len(list) == 1 { - likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) - likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) - if len(list[0].from) > 2 { - likelyRegion[id].flags = scriptInFrom - } - } else if len(list) > 1 { - likelyRegion[id].flags = isList - likelyRegion[id].lang = uint16(len(likelyRegionList)) - likelyRegion[id].script = uint8(len(list)) - for i, x := range list { - if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { - log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) - } - x := likelyLangScript{ - lang: uint16(b.langIndex(x.to[0])), - script: uint8(b.script.index(x.to[1])), - } - if len(list[0].from) > 2 { - x.flags = scriptInFrom - } - likelyRegionList = append(likelyRegionList, x) - } - } - } - b.writeType(likelyLangScript{}) - b.writeSlice("likelyRegion", likelyRegion) - b.writeSlice("likelyRegionList", likelyRegionList) - - b.writeType(likelyTag{}) - b.writeSlice("likelyRegionGroup", likelyRegionGroup) +func (b *builder) writeConstants() { + b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) + b.writeConsts(b.regionIndex, regionConsts...) + b.writeConsts(b.scriptIndex, scriptConsts...) } type mutualIntelligibility struct { @@ -1397,7 +149,7 @@ func (b *builder) writeMatchData() { regions := strings.Split(g.Contains, " ") regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...) } - regionToGroups := make([]uint8, len(b.region.s)) + regionToGroups := make([]uint8, language.NumRegions) idToIndex := map[string]uint8{} for i, mv := range lm[0].MatchVariable { @@ -1410,12 +162,12 @@ func (b *builder) writeMatchData() { todo := []string{r} for k := 0; k < len(todo); k++ { r := todo[k] - regionToGroups[b.region.index(r)] |= 1 << uint8(i) + regionToGroups[b.regionIndex(r)] |= 1 << uint8(i) todo = append(todo, regionHierarchy[r]...) } } } - b.writeSlice("regionToGroups", regionToGroups) + b.w.WriteVar("regionToGroups", regionToGroups) // maps language id to in- and out-of-group region. paradigmLocales := [][3]uint16{} @@ -1426,16 +178,16 @@ func (b *builder) writeMatchData() { pc := strings.SplitN(locales[i+j], "-", 2) x[0] = b.langIndex(pc[0]) if len(pc) == 2 { - x[1+j] = uint16(b.region.index(pc[1])) + x[1+j] = uint16(b.regionIndex(pc[1])) } } paradigmLocales = append(paradigmLocales, x) } - b.writeSlice("paradigmLocales", paradigmLocales) + b.w.WriteVar("paradigmLocales", paradigmLocales) - b.writeType(mutualIntelligibility{}) - b.writeType(scriptIntelligibility{}) - b.writeType(regionIntelligibility{}) + b.w.WriteType(mutualIntelligibility{}) + b.w.WriteType(scriptIntelligibility{}) + b.w.WriteType(regionIntelligibility{}) matchLang := []mutualIntelligibility{} matchScript := []scriptIntelligibility{} @@ -1461,16 +213,16 @@ func (b *builder) writeMatchData() { matchScript = append(matchScript, scriptIntelligibility{ wantLang: uint16(b.langIndex(d[0])), haveLang: uint16(b.langIndex(s[0])), - wantScript: uint8(b.script.index(d[1])), - haveScript: uint8(b.script.index(s[1])), + wantScript: uint8(b.scriptIndex(d[1])), + haveScript: uint8(b.scriptIndex(s[1])), distance: uint8(distance), }) if m.Oneway != "true" { matchScript = append(matchScript, scriptIntelligibility{ wantLang: uint16(b.langIndex(s[0])), haveLang: uint16(b.langIndex(d[0])), - wantScript: uint8(b.script.index(s[1])), - haveScript: uint8(b.script.index(d[1])), + wantScript: uint8(b.scriptIndex(s[1])), + haveScript: uint8(b.scriptIndex(d[1])), distance: uint8(distance), }) } @@ -1512,7 +264,7 @@ func (b *builder) writeMatchData() { distance: uint8(distance), } if d[1] != "*" { - ri.script = uint8(b.script.index(d[1])) + ri.script = uint8(b.scriptIndex(d[1])) } switch { case d[2] == "*": @@ -1532,181 +284,22 @@ func (b *builder) writeMatchData() { sort.SliceStable(matchLang, func(i, j int) bool { return matchLang[i].distance < matchLang[j].distance }) - b.writeSlice("matchLang", matchLang) - + b.w.WriteComment(` + matchLang holds pairs of langIDs of base languages that are typically + mutually intelligible. Each pair is associated with a confidence and + whether the intelligibility goes one or both ways.`) + b.w.WriteVar("matchLang", matchLang) + + b.w.WriteComment(` + matchScript holds pairs of scriptIDs where readers of one script + can typically also read the other. Each is associated with a confidence.`) sort.SliceStable(matchScript, func(i, j int) bool { return matchScript[i].distance < matchScript[j].distance }) - b.writeSlice("matchScript", matchScript) + b.w.WriteVar("matchScript", matchScript) sort.SliceStable(matchRegion, func(i, j int) bool { return matchRegion[i].distance < matchRegion[j].distance }) - b.writeSlice("matchRegion", matchRegion) -} - -func (b *builder) writeRegionInclusionData() { - var ( - // mm holds for each group the set of groups with a distance of 1. - mm = make(map[int][]index) - - // containment holds for each group the transitive closure of - // containment of other groups. - containment = make(map[index][]index) - ) - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - groupIdx := b.groups[group] - for _, mem := range strings.Split(g.Contains, " ") { - r := b.region.index(mem) - mm[r] = append(mm[r], groupIdx) - if g, ok := b.groups[r]; ok { - mm[group] = append(mm[group], g) - containment[groupIdx] = append(containment[groupIdx], g) - } - } - } - - regionContainment := make([]uint64, len(b.groups)) - for _, g := range b.groups { - l := containment[g] - - // Compute the transitive closure of containment. - for i := 0; i < len(l); i++ { - l = append(l, containment[l[i]]...) - } - - // Compute the bitmask. - regionContainment[g] = 1 << g - for _, v := range l { - regionContainment[g] |= 1 << v - } - } - b.writeSlice("regionContainment", regionContainment) - - regionInclusion := make([]uint8, len(b.region.s)) - bvs := make(map[uint64]index) - // Make the first bitvector positions correspond with the groups. - for r, i := range b.groups { - bv := uint64(1 << i) - for _, g := range mm[r] { - bv |= 1 << g - } - bvs[bv] = i - regionInclusion[r] = uint8(bvs[bv]) - } - for r := 1; r < len(b.region.s); r++ { - if _, ok := b.groups[r]; !ok { - bv := uint64(0) - for _, g := range mm[r] { - bv |= 1 << g - } - if bv == 0 { - // Pick the world for unspecified regions. - bv = 1 << b.groups[b.region.index("001")] - } - if _, ok := bvs[bv]; !ok { - bvs[bv] = index(len(bvs)) - } - regionInclusion[r] = uint8(bvs[bv]) - } - } - b.writeSlice("regionInclusion", regionInclusion) - regionInclusionBits := make([]uint64, len(bvs)) - for k, v := range bvs { - regionInclusionBits[v] = uint64(k) - } - // Add bit vectors for increasingly large distances until a fixed point is reached. - regionInclusionNext := []uint8{} - for i := 0; i < len(regionInclusionBits); i++ { - bits := regionInclusionBits[i] - next := bits - for i := uint(0); i < uint(len(b.groups)); i++ { - if bits&(1<<i) != 0 { - next |= regionInclusionBits[i] - } - } - if _, ok := bvs[next]; !ok { - bvs[next] = index(len(bvs)) - regionInclusionBits = append(regionInclusionBits, next) - } - regionInclusionNext = append(regionInclusionNext, uint8(bvs[next])) - } - b.writeSlice("regionInclusionBits", regionInclusionBits) - b.writeSlice("regionInclusionNext", regionInclusionNext) -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -func (b *builder) writeParents() { - b.writeType(parentRel{}) - - parents := []parentRel{} - - // Construct parent overrides. - n := 0 - for _, p := range b.data.Supplemental().ParentLocales.ParentLocale { - // Skipping non-standard scripts to root is implemented using addTags. - if p.Parent == "root" { - continue - } - - sub := strings.Split(p.Parent, "_") - parent := parentRel{lang: b.langIndex(sub[0])} - if len(sub) == 2 { - // TODO: check that all undefined scripts are indeed Latn in these - // cases. - parent.maxScript = uint8(b.script.index("Latn")) - parent.toRegion = uint16(b.region.index(sub[1])) - } else { - parent.script = uint8(b.script.index(sub[1])) - parent.maxScript = parent.script - parent.toRegion = uint16(b.region.index(sub[2])) - } - for _, c := range strings.Split(p.Locales, " ") { - region := b.region.index(c[strings.LastIndex(c, "_")+1:]) - parent.fromRegion = append(parent.fromRegion, uint16(region)) - } - parents = append(parents, parent) - n += len(parent.fromRegion) - } - b.writeSliceAddSize("parents", n*2, parents) -} - -func main() { - gen.Init() - - gen.Repackage("gen_common.go", "common.go", "language") - - w := gen.NewCodeWriter() - defer w.WriteGoFile("tables.go", "language") - - fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`) - - b := newBuilder(w) - gen.WriteCLDRVersion(w) - - b.parseIndices() - b.writeType(fromTo{}) - b.writeLanguage() - b.writeScript() - b.writeRegion() - b.writeVariant() - // TODO: b.writeLocale() - b.computeRegionGroups() - b.writeLikelyData() - b.writeMatchData() - b.writeRegionInclusionData() - b.writeParents() + b.w.WriteVar("matchRegion", matchRegion) } diff --git a/vendor/golang.org/x/text/language/gen_index.go b/vendor/golang.org/x/text/language/gen_index.go deleted file mode 100644 index 5ca9bccac5..0000000000 --- a/vendor/golang.org/x/text/language/gen_index.go +++ /dev/null @@ -1,162 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This file generates derivative tables based on the language package itself. - -import ( - "bytes" - "flag" - "fmt" - "io/ioutil" - "log" - "reflect" - "sort" - "strings" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/language" - "golang.org/x/text/unicode/cldr" -) - -var ( - test = flag.Bool("test", false, - "test existing tables; can be used to compare web data with package data.") - - draft = flag.String("draft", - "contributed", - `Minimal draft requirements (approved, contributed, provisional, unconfirmed).`) -) - -func main() { - gen.Init() - - // Read the CLDR zip file. - r := gen.OpenCLDRCoreZip() - defer r.Close() - - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - if err != nil { - log.Fatalf("DecodeZip: %v", err) - } - - w := gen.NewCodeWriter() - defer func() { - buf := &bytes.Buffer{} - - if _, err = w.WriteGo(buf, "language", ""); err != nil { - log.Fatalf("Error formatting file index.go: %v", err) - } - - // Since we're generating a table for our own package we need to rewrite - // doing the equivalent of go fmt -r 'language.b -> b'. Using - // bytes.Replace will do. - out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1) - if err := ioutil.WriteFile("index.go", out, 0600); err != nil { - log.Fatalf("Could not create file index.go: %v", err) - } - }() - - m := map[language.Tag]bool{} - for _, lang := range data.Locales() { - // We include all locales unconditionally to be consistent with en_US. - // We want en_US, even though it has no data associated with it. - - // TODO: put any of the languages for which no data exists at the end - // of the index. This allows all components based on ICU to use that - // as the cutoff point. - // if x := data.RawLDML(lang); false || - // x.LocaleDisplayNames != nil || - // x.Characters != nil || - // x.Delimiters != nil || - // x.Measurement != nil || - // x.Dates != nil || - // x.Numbers != nil || - // x.Units != nil || - // x.ListPatterns != nil || - // x.Collations != nil || - // x.Segmentations != nil || - // x.Rbnf != nil || - // x.Annotations != nil || - // x.Metadata != nil { - - // TODO: support POSIX natively, albeit non-standard. - tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) - m[tag] = true - // } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - m[language.Make(lang)] = true - } - } - } - - var core, special []language.Tag - - for t := range m { - if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { - log.Fatalf("Unexpected extension %v in %v", x, t) - } - if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { - core = append(core, t) - } else { - special = append(special, t) - } - } - - w.WriteComment(` - NumCompactTags is the number of common tags. The maximum tag is - NumCompactTags-1.`) - w.WriteConst("NumCompactTags", len(core)+len(special)) - - sort.Sort(byAlpha(special)) - w.WriteVar("specialTags", special) - - // TODO: order by frequency? - sort.Sort(byAlpha(core)) - - // Size computations are just an estimate. - w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size()) - w.Size += len(core) * 6 // size of uint32 and uint16 - - fmt.Fprintln(w) - fmt.Fprintln(w, "var coreTags = map[uint32]uint16{") - fmt.Fprintln(w, "0x0: 0, // und") - i := len(special) + 1 // Und and special tags already written. - for _, t := range core { - if t == language.Und { - continue - } - fmt.Fprint(w.Hash, t, i) - b, s, r := t.Raw() - fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n", - getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number - getIndex(s, 2), - getIndex(r, 3), - i, t) - i++ - } - fmt.Fprintln(w, "}") -} - -// getIndex prints the subtag type and extracts its index of size nibble. -// If the index is less than n nibbles, the result is prefixed with 0s. -func getIndex(x interface{}, n int) string { - s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00} - s = s[strings.Index(s, "0x")+2 : len(s)-1] - return strings.Repeat("0", n-len(s)) + s -} - -type byAlpha []language.Tag - -func (a byAlpha) Len() int { return len(a) } -func (a byAlpha) Swap(i, j int) { a[i], a[j] = a[j], a[i] } -func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() } diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go deleted file mode 100644 index 5311e5cbe4..0000000000 --- a/vendor/golang.org/x/text/language/index.go +++ /dev/null @@ -1,783 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 768 - -var specialTags = []Tag{ // 2 elements - 0: {lang: 0xd7, region: 0x6e, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, - 1: {lang: 0x139, region: 0x135, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, -} // Size: 72 bytes - -var coreTags = map[uint32]uint16{ - 0x0: 0, // und - 0x01600000: 3, // af - 0x016000d2: 4, // af-NA - 0x01600161: 5, // af-ZA - 0x01c00000: 6, // agq - 0x01c00052: 7, // agq-CM - 0x02100000: 8, // ak - 0x02100080: 9, // ak-GH - 0x02700000: 10, // am - 0x0270006f: 11, // am-ET - 0x03a00000: 12, // ar - 0x03a00001: 13, // ar-001 - 0x03a00023: 14, // ar-AE - 0x03a00039: 15, // ar-BH - 0x03a00062: 16, // ar-DJ - 0x03a00067: 17, // ar-DZ - 0x03a0006b: 18, // ar-EG - 0x03a0006c: 19, // ar-EH - 0x03a0006d: 20, // ar-ER - 0x03a00097: 21, // ar-IL - 0x03a0009b: 22, // ar-IQ - 0x03a000a1: 23, // ar-JO - 0x03a000a8: 24, // ar-KM - 0x03a000ac: 25, // ar-KW - 0x03a000b0: 26, // ar-LB - 0x03a000b9: 27, // ar-LY - 0x03a000ba: 28, // ar-MA - 0x03a000c9: 29, // ar-MR - 0x03a000e1: 30, // ar-OM - 0x03a000ed: 31, // ar-PS - 0x03a000f3: 32, // ar-QA - 0x03a00108: 33, // ar-SA - 0x03a0010b: 34, // ar-SD - 0x03a00115: 35, // ar-SO - 0x03a00117: 36, // ar-SS - 0x03a0011c: 37, // ar-SY - 0x03a00120: 38, // ar-TD - 0x03a00128: 39, // ar-TN - 0x03a0015e: 40, // ar-YE - 0x04000000: 41, // ars - 0x04300000: 42, // as - 0x04300099: 43, // as-IN - 0x04400000: 44, // asa - 0x0440012f: 45, // asa-TZ - 0x04800000: 46, // ast - 0x0480006e: 47, // ast-ES - 0x05800000: 48, // az - 0x0581f000: 49, // az-Cyrl - 0x0581f032: 50, // az-Cyrl-AZ - 0x05857000: 51, // az-Latn - 0x05857032: 52, // az-Latn-AZ - 0x05e00000: 53, // bas - 0x05e00052: 54, // bas-CM - 0x07100000: 55, // be - 0x07100047: 56, // be-BY - 0x07500000: 57, // bem - 0x07500162: 58, // bem-ZM - 0x07900000: 59, // bez - 0x0790012f: 60, // bez-TZ - 0x07e00000: 61, // bg - 0x07e00038: 62, // bg-BG - 0x08200000: 63, // bh - 0x0a000000: 64, // bm - 0x0a0000c3: 65, // bm-ML - 0x0a500000: 66, // bn - 0x0a500035: 67, // bn-BD - 0x0a500099: 68, // bn-IN - 0x0a900000: 69, // bo - 0x0a900053: 70, // bo-CN - 0x0a900099: 71, // bo-IN - 0x0b200000: 72, // br - 0x0b200078: 73, // br-FR - 0x0b500000: 74, // brx - 0x0b500099: 75, // brx-IN - 0x0b700000: 76, // bs - 0x0b71f000: 77, // bs-Cyrl - 0x0b71f033: 78, // bs-Cyrl-BA - 0x0b757000: 79, // bs-Latn - 0x0b757033: 80, // bs-Latn-BA - 0x0d700000: 81, // ca - 0x0d700022: 82, // ca-AD - 0x0d70006e: 83, // ca-ES - 0x0d700078: 84, // ca-FR - 0x0d70009e: 85, // ca-IT - 0x0db00000: 86, // ccp - 0x0db00035: 87, // ccp-BD - 0x0db00099: 88, // ccp-IN - 0x0dc00000: 89, // ce - 0x0dc00106: 90, // ce-RU - 0x0df00000: 91, // cgg - 0x0df00131: 92, // cgg-UG - 0x0e500000: 93, // chr - 0x0e500135: 94, // chr-US - 0x0e900000: 95, // ckb - 0x0e90009b: 96, // ckb-IQ - 0x0e90009c: 97, // ckb-IR - 0x0fa00000: 98, // cs - 0x0fa0005e: 99, // cs-CZ - 0x0fe00000: 100, // cu - 0x0fe00106: 101, // cu-RU - 0x10000000: 102, // cy - 0x1000007b: 103, // cy-GB - 0x10100000: 104, // da - 0x10100063: 105, // da-DK - 0x10100082: 106, // da-GL - 0x10800000: 107, // dav - 0x108000a4: 108, // dav-KE - 0x10d00000: 109, // de - 0x10d0002e: 110, // de-AT - 0x10d00036: 111, // de-BE - 0x10d0004e: 112, // de-CH - 0x10d00060: 113, // de-DE - 0x10d0009e: 114, // de-IT - 0x10d000b2: 115, // de-LI - 0x10d000b7: 116, // de-LU - 0x11700000: 117, // dje - 0x117000d4: 118, // dje-NE - 0x11f00000: 119, // dsb - 0x11f00060: 120, // dsb-DE - 0x12400000: 121, // dua - 0x12400052: 122, // dua-CM - 0x12800000: 123, // dv - 0x12b00000: 124, // dyo - 0x12b00114: 125, // dyo-SN - 0x12d00000: 126, // dz - 0x12d00043: 127, // dz-BT - 0x12f00000: 128, // ebu - 0x12f000a4: 129, // ebu-KE - 0x13000000: 130, // ee - 0x13000080: 131, // ee-GH - 0x13000122: 132, // ee-TG - 0x13600000: 133, // el - 0x1360005d: 134, // el-CY - 0x13600087: 135, // el-GR - 0x13900000: 136, // en - 0x13900001: 137, // en-001 - 0x1390001a: 138, // en-150 - 0x13900025: 139, // en-AG - 0x13900026: 140, // en-AI - 0x1390002d: 141, // en-AS - 0x1390002e: 142, // en-AT - 0x1390002f: 143, // en-AU - 0x13900034: 144, // en-BB - 0x13900036: 145, // en-BE - 0x1390003a: 146, // en-BI - 0x1390003d: 147, // en-BM - 0x13900042: 148, // en-BS - 0x13900046: 149, // en-BW - 0x13900048: 150, // en-BZ - 0x13900049: 151, // en-CA - 0x1390004a: 152, // en-CC - 0x1390004e: 153, // en-CH - 0x13900050: 154, // en-CK - 0x13900052: 155, // en-CM - 0x1390005c: 156, // en-CX - 0x1390005d: 157, // en-CY - 0x13900060: 158, // en-DE - 0x13900061: 159, // en-DG - 0x13900063: 160, // en-DK - 0x13900064: 161, // en-DM - 0x1390006d: 162, // en-ER - 0x13900072: 163, // en-FI - 0x13900073: 164, // en-FJ - 0x13900074: 165, // en-FK - 0x13900075: 166, // en-FM - 0x1390007b: 167, // en-GB - 0x1390007c: 168, // en-GD - 0x1390007f: 169, // en-GG - 0x13900080: 170, // en-GH - 0x13900081: 171, // en-GI - 0x13900083: 172, // en-GM - 0x1390008a: 173, // en-GU - 0x1390008c: 174, // en-GY - 0x1390008d: 175, // en-HK - 0x13900096: 176, // en-IE - 0x13900097: 177, // en-IL - 0x13900098: 178, // en-IM - 0x13900099: 179, // en-IN - 0x1390009a: 180, // en-IO - 0x1390009f: 181, // en-JE - 0x139000a0: 182, // en-JM - 0x139000a4: 183, // en-KE - 0x139000a7: 184, // en-KI - 0x139000a9: 185, // en-KN - 0x139000ad: 186, // en-KY - 0x139000b1: 187, // en-LC - 0x139000b4: 188, // en-LR - 0x139000b5: 189, // en-LS - 0x139000bf: 190, // en-MG - 0x139000c0: 191, // en-MH - 0x139000c6: 192, // en-MO - 0x139000c7: 193, // en-MP - 0x139000ca: 194, // en-MS - 0x139000cb: 195, // en-MT - 0x139000cc: 196, // en-MU - 0x139000ce: 197, // en-MW - 0x139000d0: 198, // en-MY - 0x139000d2: 199, // en-NA - 0x139000d5: 200, // en-NF - 0x139000d6: 201, // en-NG - 0x139000d9: 202, // en-NL - 0x139000dd: 203, // en-NR - 0x139000df: 204, // en-NU - 0x139000e0: 205, // en-NZ - 0x139000e6: 206, // en-PG - 0x139000e7: 207, // en-PH - 0x139000e8: 208, // en-PK - 0x139000eb: 209, // en-PN - 0x139000ec: 210, // en-PR - 0x139000f0: 211, // en-PW - 0x13900107: 212, // en-RW - 0x13900109: 213, // en-SB - 0x1390010a: 214, // en-SC - 0x1390010b: 215, // en-SD - 0x1390010c: 216, // en-SE - 0x1390010d: 217, // en-SG - 0x1390010e: 218, // en-SH - 0x1390010f: 219, // en-SI - 0x13900112: 220, // en-SL - 0x13900117: 221, // en-SS - 0x1390011b: 222, // en-SX - 0x1390011d: 223, // en-SZ - 0x1390011f: 224, // en-TC - 0x13900125: 225, // en-TK - 0x13900129: 226, // en-TO - 0x1390012c: 227, // en-TT - 0x1390012d: 228, // en-TV - 0x1390012f: 229, // en-TZ - 0x13900131: 230, // en-UG - 0x13900133: 231, // en-UM - 0x13900135: 232, // en-US - 0x13900139: 233, // en-VC - 0x1390013c: 234, // en-VG - 0x1390013d: 235, // en-VI - 0x1390013f: 236, // en-VU - 0x13900142: 237, // en-WS - 0x13900161: 238, // en-ZA - 0x13900162: 239, // en-ZM - 0x13900164: 240, // en-ZW - 0x13c00000: 241, // eo - 0x13c00001: 242, // eo-001 - 0x13e00000: 243, // es - 0x13e0001f: 244, // es-419 - 0x13e0002c: 245, // es-AR - 0x13e0003f: 246, // es-BO - 0x13e00041: 247, // es-BR - 0x13e00048: 248, // es-BZ - 0x13e00051: 249, // es-CL - 0x13e00054: 250, // es-CO - 0x13e00056: 251, // es-CR - 0x13e00059: 252, // es-CU - 0x13e00065: 253, // es-DO - 0x13e00068: 254, // es-EA - 0x13e00069: 255, // es-EC - 0x13e0006e: 256, // es-ES - 0x13e00086: 257, // es-GQ - 0x13e00089: 258, // es-GT - 0x13e0008f: 259, // es-HN - 0x13e00094: 260, // es-IC - 0x13e000cf: 261, // es-MX - 0x13e000d8: 262, // es-NI - 0x13e000e2: 263, // es-PA - 0x13e000e4: 264, // es-PE - 0x13e000e7: 265, // es-PH - 0x13e000ec: 266, // es-PR - 0x13e000f1: 267, // es-PY - 0x13e0011a: 268, // es-SV - 0x13e00135: 269, // es-US - 0x13e00136: 270, // es-UY - 0x13e0013b: 271, // es-VE - 0x14000000: 272, // et - 0x1400006a: 273, // et-EE - 0x14500000: 274, // eu - 0x1450006e: 275, // eu-ES - 0x14600000: 276, // ewo - 0x14600052: 277, // ewo-CM - 0x14800000: 278, // fa - 0x14800024: 279, // fa-AF - 0x1480009c: 280, // fa-IR - 0x14e00000: 281, // ff - 0x14e00052: 282, // ff-CM - 0x14e00084: 283, // ff-GN - 0x14e000c9: 284, // ff-MR - 0x14e00114: 285, // ff-SN - 0x15100000: 286, // fi - 0x15100072: 287, // fi-FI - 0x15300000: 288, // fil - 0x153000e7: 289, // fil-PH - 0x15800000: 290, // fo - 0x15800063: 291, // fo-DK - 0x15800076: 292, // fo-FO - 0x15e00000: 293, // fr - 0x15e00036: 294, // fr-BE - 0x15e00037: 295, // fr-BF - 0x15e0003a: 296, // fr-BI - 0x15e0003b: 297, // fr-BJ - 0x15e0003c: 298, // fr-BL - 0x15e00049: 299, // fr-CA - 0x15e0004b: 300, // fr-CD - 0x15e0004c: 301, // fr-CF - 0x15e0004d: 302, // fr-CG - 0x15e0004e: 303, // fr-CH - 0x15e0004f: 304, // fr-CI - 0x15e00052: 305, // fr-CM - 0x15e00062: 306, // fr-DJ - 0x15e00067: 307, // fr-DZ - 0x15e00078: 308, // fr-FR - 0x15e0007a: 309, // fr-GA - 0x15e0007e: 310, // fr-GF - 0x15e00084: 311, // fr-GN - 0x15e00085: 312, // fr-GP - 0x15e00086: 313, // fr-GQ - 0x15e00091: 314, // fr-HT - 0x15e000a8: 315, // fr-KM - 0x15e000b7: 316, // fr-LU - 0x15e000ba: 317, // fr-MA - 0x15e000bb: 318, // fr-MC - 0x15e000be: 319, // fr-MF - 0x15e000bf: 320, // fr-MG - 0x15e000c3: 321, // fr-ML - 0x15e000c8: 322, // fr-MQ - 0x15e000c9: 323, // fr-MR - 0x15e000cc: 324, // fr-MU - 0x15e000d3: 325, // fr-NC - 0x15e000d4: 326, // fr-NE - 0x15e000e5: 327, // fr-PF - 0x15e000ea: 328, // fr-PM - 0x15e00102: 329, // fr-RE - 0x15e00107: 330, // fr-RW - 0x15e0010a: 331, // fr-SC - 0x15e00114: 332, // fr-SN - 0x15e0011c: 333, // fr-SY - 0x15e00120: 334, // fr-TD - 0x15e00122: 335, // fr-TG - 0x15e00128: 336, // fr-TN - 0x15e0013f: 337, // fr-VU - 0x15e00140: 338, // fr-WF - 0x15e0015f: 339, // fr-YT - 0x16900000: 340, // fur - 0x1690009e: 341, // fur-IT - 0x16d00000: 342, // fy - 0x16d000d9: 343, // fy-NL - 0x16e00000: 344, // ga - 0x16e00096: 345, // ga-IE - 0x17e00000: 346, // gd - 0x17e0007b: 347, // gd-GB - 0x19000000: 348, // gl - 0x1900006e: 349, // gl-ES - 0x1a300000: 350, // gsw - 0x1a30004e: 351, // gsw-CH - 0x1a300078: 352, // gsw-FR - 0x1a3000b2: 353, // gsw-LI - 0x1a400000: 354, // gu - 0x1a400099: 355, // gu-IN - 0x1a900000: 356, // guw - 0x1ab00000: 357, // guz - 0x1ab000a4: 358, // guz-KE - 0x1ac00000: 359, // gv - 0x1ac00098: 360, // gv-IM - 0x1b400000: 361, // ha - 0x1b400080: 362, // ha-GH - 0x1b4000d4: 363, // ha-NE - 0x1b4000d6: 364, // ha-NG - 0x1b800000: 365, // haw - 0x1b800135: 366, // haw-US - 0x1bc00000: 367, // he - 0x1bc00097: 368, // he-IL - 0x1be00000: 369, // hi - 0x1be00099: 370, // hi-IN - 0x1d100000: 371, // hr - 0x1d100033: 372, // hr-BA - 0x1d100090: 373, // hr-HR - 0x1d200000: 374, // hsb - 0x1d200060: 375, // hsb-DE - 0x1d500000: 376, // hu - 0x1d500092: 377, // hu-HU - 0x1d700000: 378, // hy - 0x1d700028: 379, // hy-AM - 0x1e100000: 380, // id - 0x1e100095: 381, // id-ID - 0x1e700000: 382, // ig - 0x1e7000d6: 383, // ig-NG - 0x1ea00000: 384, // ii - 0x1ea00053: 385, // ii-CN - 0x1f500000: 386, // io - 0x1f800000: 387, // is - 0x1f80009d: 388, // is-IS - 0x1f900000: 389, // it - 0x1f90004e: 390, // it-CH - 0x1f90009e: 391, // it-IT - 0x1f900113: 392, // it-SM - 0x1f900138: 393, // it-VA - 0x1fa00000: 394, // iu - 0x20000000: 395, // ja - 0x200000a2: 396, // ja-JP - 0x20300000: 397, // jbo - 0x20700000: 398, // jgo - 0x20700052: 399, // jgo-CM - 0x20a00000: 400, // jmc - 0x20a0012f: 401, // jmc-TZ - 0x20e00000: 402, // jv - 0x21000000: 403, // ka - 0x2100007d: 404, // ka-GE - 0x21200000: 405, // kab - 0x21200067: 406, // kab-DZ - 0x21600000: 407, // kaj - 0x21700000: 408, // kam - 0x217000a4: 409, // kam-KE - 0x21f00000: 410, // kcg - 0x22300000: 411, // kde - 0x2230012f: 412, // kde-TZ - 0x22700000: 413, // kea - 0x2270005a: 414, // kea-CV - 0x23400000: 415, // khq - 0x234000c3: 416, // khq-ML - 0x23900000: 417, // ki - 0x239000a4: 418, // ki-KE - 0x24200000: 419, // kk - 0x242000ae: 420, // kk-KZ - 0x24400000: 421, // kkj - 0x24400052: 422, // kkj-CM - 0x24500000: 423, // kl - 0x24500082: 424, // kl-GL - 0x24600000: 425, // kln - 0x246000a4: 426, // kln-KE - 0x24a00000: 427, // km - 0x24a000a6: 428, // km-KH - 0x25100000: 429, // kn - 0x25100099: 430, // kn-IN - 0x25400000: 431, // ko - 0x254000aa: 432, // ko-KP - 0x254000ab: 433, // ko-KR - 0x25600000: 434, // kok - 0x25600099: 435, // kok-IN - 0x26a00000: 436, // ks - 0x26a00099: 437, // ks-IN - 0x26b00000: 438, // ksb - 0x26b0012f: 439, // ksb-TZ - 0x26d00000: 440, // ksf - 0x26d00052: 441, // ksf-CM - 0x26e00000: 442, // ksh - 0x26e00060: 443, // ksh-DE - 0x27400000: 444, // ku - 0x28100000: 445, // kw - 0x2810007b: 446, // kw-GB - 0x28a00000: 447, // ky - 0x28a000a5: 448, // ky-KG - 0x29100000: 449, // lag - 0x2910012f: 450, // lag-TZ - 0x29500000: 451, // lb - 0x295000b7: 452, // lb-LU - 0x2a300000: 453, // lg - 0x2a300131: 454, // lg-UG - 0x2af00000: 455, // lkt - 0x2af00135: 456, // lkt-US - 0x2b500000: 457, // ln - 0x2b50002a: 458, // ln-AO - 0x2b50004b: 459, // ln-CD - 0x2b50004c: 460, // ln-CF - 0x2b50004d: 461, // ln-CG - 0x2b800000: 462, // lo - 0x2b8000af: 463, // lo-LA - 0x2bf00000: 464, // lrc - 0x2bf0009b: 465, // lrc-IQ - 0x2bf0009c: 466, // lrc-IR - 0x2c000000: 467, // lt - 0x2c0000b6: 468, // lt-LT - 0x2c200000: 469, // lu - 0x2c20004b: 470, // lu-CD - 0x2c400000: 471, // luo - 0x2c4000a4: 472, // luo-KE - 0x2c500000: 473, // luy - 0x2c5000a4: 474, // luy-KE - 0x2c700000: 475, // lv - 0x2c7000b8: 476, // lv-LV - 0x2d100000: 477, // mas - 0x2d1000a4: 478, // mas-KE - 0x2d10012f: 479, // mas-TZ - 0x2e900000: 480, // mer - 0x2e9000a4: 481, // mer-KE - 0x2ed00000: 482, // mfe - 0x2ed000cc: 483, // mfe-MU - 0x2f100000: 484, // mg - 0x2f1000bf: 485, // mg-MG - 0x2f200000: 486, // mgh - 0x2f2000d1: 487, // mgh-MZ - 0x2f400000: 488, // mgo - 0x2f400052: 489, // mgo-CM - 0x2ff00000: 490, // mk - 0x2ff000c2: 491, // mk-MK - 0x30400000: 492, // ml - 0x30400099: 493, // ml-IN - 0x30b00000: 494, // mn - 0x30b000c5: 495, // mn-MN - 0x31b00000: 496, // mr - 0x31b00099: 497, // mr-IN - 0x31f00000: 498, // ms - 0x31f0003e: 499, // ms-BN - 0x31f000d0: 500, // ms-MY - 0x31f0010d: 501, // ms-SG - 0x32000000: 502, // mt - 0x320000cb: 503, // mt-MT - 0x32500000: 504, // mua - 0x32500052: 505, // mua-CM - 0x33100000: 506, // my - 0x331000c4: 507, // my-MM - 0x33a00000: 508, // mzn - 0x33a0009c: 509, // mzn-IR - 0x34100000: 510, // nah - 0x34500000: 511, // naq - 0x345000d2: 512, // naq-NA - 0x34700000: 513, // nb - 0x347000da: 514, // nb-NO - 0x34700110: 515, // nb-SJ - 0x34e00000: 516, // nd - 0x34e00164: 517, // nd-ZW - 0x35000000: 518, // nds - 0x35000060: 519, // nds-DE - 0x350000d9: 520, // nds-NL - 0x35100000: 521, // ne - 0x35100099: 522, // ne-IN - 0x351000db: 523, // ne-NP - 0x36700000: 524, // nl - 0x36700030: 525, // nl-AW - 0x36700036: 526, // nl-BE - 0x36700040: 527, // nl-BQ - 0x3670005b: 528, // nl-CW - 0x367000d9: 529, // nl-NL - 0x36700116: 530, // nl-SR - 0x3670011b: 531, // nl-SX - 0x36800000: 532, // nmg - 0x36800052: 533, // nmg-CM - 0x36a00000: 534, // nn - 0x36a000da: 535, // nn-NO - 0x36c00000: 536, // nnh - 0x36c00052: 537, // nnh-CM - 0x36f00000: 538, // no - 0x37500000: 539, // nqo - 0x37600000: 540, // nr - 0x37a00000: 541, // nso - 0x38000000: 542, // nus - 0x38000117: 543, // nus-SS - 0x38700000: 544, // ny - 0x38900000: 545, // nyn - 0x38900131: 546, // nyn-UG - 0x39000000: 547, // om - 0x3900006f: 548, // om-ET - 0x390000a4: 549, // om-KE - 0x39500000: 550, // or - 0x39500099: 551, // or-IN - 0x39800000: 552, // os - 0x3980007d: 553, // os-GE - 0x39800106: 554, // os-RU - 0x39d00000: 555, // pa - 0x39d05000: 556, // pa-Arab - 0x39d050e8: 557, // pa-Arab-PK - 0x39d33000: 558, // pa-Guru - 0x39d33099: 559, // pa-Guru-IN - 0x3a100000: 560, // pap - 0x3b300000: 561, // pl - 0x3b3000e9: 562, // pl-PL - 0x3bd00000: 563, // prg - 0x3bd00001: 564, // prg-001 - 0x3be00000: 565, // ps - 0x3be00024: 566, // ps-AF - 0x3c000000: 567, // pt - 0x3c00002a: 568, // pt-AO - 0x3c000041: 569, // pt-BR - 0x3c00004e: 570, // pt-CH - 0x3c00005a: 571, // pt-CV - 0x3c000086: 572, // pt-GQ - 0x3c00008b: 573, // pt-GW - 0x3c0000b7: 574, // pt-LU - 0x3c0000c6: 575, // pt-MO - 0x3c0000d1: 576, // pt-MZ - 0x3c0000ee: 577, // pt-PT - 0x3c000118: 578, // pt-ST - 0x3c000126: 579, // pt-TL - 0x3c400000: 580, // qu - 0x3c40003f: 581, // qu-BO - 0x3c400069: 582, // qu-EC - 0x3c4000e4: 583, // qu-PE - 0x3d400000: 584, // rm - 0x3d40004e: 585, // rm-CH - 0x3d900000: 586, // rn - 0x3d90003a: 587, // rn-BI - 0x3dc00000: 588, // ro - 0x3dc000bc: 589, // ro-MD - 0x3dc00104: 590, // ro-RO - 0x3de00000: 591, // rof - 0x3de0012f: 592, // rof-TZ - 0x3e200000: 593, // ru - 0x3e200047: 594, // ru-BY - 0x3e2000a5: 595, // ru-KG - 0x3e2000ae: 596, // ru-KZ - 0x3e2000bc: 597, // ru-MD - 0x3e200106: 598, // ru-RU - 0x3e200130: 599, // ru-UA - 0x3e500000: 600, // rw - 0x3e500107: 601, // rw-RW - 0x3e600000: 602, // rwk - 0x3e60012f: 603, // rwk-TZ - 0x3eb00000: 604, // sah - 0x3eb00106: 605, // sah-RU - 0x3ec00000: 606, // saq - 0x3ec000a4: 607, // saq-KE - 0x3f300000: 608, // sbp - 0x3f30012f: 609, // sbp-TZ - 0x3fa00000: 610, // sd - 0x3fa000e8: 611, // sd-PK - 0x3fc00000: 612, // sdh - 0x3fd00000: 613, // se - 0x3fd00072: 614, // se-FI - 0x3fd000da: 615, // se-NO - 0x3fd0010c: 616, // se-SE - 0x3ff00000: 617, // seh - 0x3ff000d1: 618, // seh-MZ - 0x40100000: 619, // ses - 0x401000c3: 620, // ses-ML - 0x40200000: 621, // sg - 0x4020004c: 622, // sg-CF - 0x40800000: 623, // shi - 0x40857000: 624, // shi-Latn - 0x408570ba: 625, // shi-Latn-MA - 0x408dc000: 626, // shi-Tfng - 0x408dc0ba: 627, // shi-Tfng-MA - 0x40c00000: 628, // si - 0x40c000b3: 629, // si-LK - 0x41200000: 630, // sk - 0x41200111: 631, // sk-SK - 0x41600000: 632, // sl - 0x4160010f: 633, // sl-SI - 0x41c00000: 634, // sma - 0x41d00000: 635, // smi - 0x41e00000: 636, // smj - 0x41f00000: 637, // smn - 0x41f00072: 638, // smn-FI - 0x42200000: 639, // sms - 0x42300000: 640, // sn - 0x42300164: 641, // sn-ZW - 0x42900000: 642, // so - 0x42900062: 643, // so-DJ - 0x4290006f: 644, // so-ET - 0x429000a4: 645, // so-KE - 0x42900115: 646, // so-SO - 0x43100000: 647, // sq - 0x43100027: 648, // sq-AL - 0x431000c2: 649, // sq-MK - 0x4310014d: 650, // sq-XK - 0x43200000: 651, // sr - 0x4321f000: 652, // sr-Cyrl - 0x4321f033: 653, // sr-Cyrl-BA - 0x4321f0bd: 654, // sr-Cyrl-ME - 0x4321f105: 655, // sr-Cyrl-RS - 0x4321f14d: 656, // sr-Cyrl-XK - 0x43257000: 657, // sr-Latn - 0x43257033: 658, // sr-Latn-BA - 0x432570bd: 659, // sr-Latn-ME - 0x43257105: 660, // sr-Latn-RS - 0x4325714d: 661, // sr-Latn-XK - 0x43700000: 662, // ss - 0x43a00000: 663, // ssy - 0x43b00000: 664, // st - 0x44400000: 665, // sv - 0x44400031: 666, // sv-AX - 0x44400072: 667, // sv-FI - 0x4440010c: 668, // sv-SE - 0x44500000: 669, // sw - 0x4450004b: 670, // sw-CD - 0x445000a4: 671, // sw-KE - 0x4450012f: 672, // sw-TZ - 0x44500131: 673, // sw-UG - 0x44e00000: 674, // syr - 0x45000000: 675, // ta - 0x45000099: 676, // ta-IN - 0x450000b3: 677, // ta-LK - 0x450000d0: 678, // ta-MY - 0x4500010d: 679, // ta-SG - 0x46100000: 680, // te - 0x46100099: 681, // te-IN - 0x46400000: 682, // teo - 0x464000a4: 683, // teo-KE - 0x46400131: 684, // teo-UG - 0x46700000: 685, // tg - 0x46700124: 686, // tg-TJ - 0x46b00000: 687, // th - 0x46b00123: 688, // th-TH - 0x46f00000: 689, // ti - 0x46f0006d: 690, // ti-ER - 0x46f0006f: 691, // ti-ET - 0x47100000: 692, // tig - 0x47600000: 693, // tk - 0x47600127: 694, // tk-TM - 0x48000000: 695, // tn - 0x48200000: 696, // to - 0x48200129: 697, // to-TO - 0x48a00000: 698, // tr - 0x48a0005d: 699, // tr-CY - 0x48a0012b: 700, // tr-TR - 0x48e00000: 701, // ts - 0x49400000: 702, // tt - 0x49400106: 703, // tt-RU - 0x4a400000: 704, // twq - 0x4a4000d4: 705, // twq-NE - 0x4a900000: 706, // tzm - 0x4a9000ba: 707, // tzm-MA - 0x4ac00000: 708, // ug - 0x4ac00053: 709, // ug-CN - 0x4ae00000: 710, // uk - 0x4ae00130: 711, // uk-UA - 0x4b400000: 712, // ur - 0x4b400099: 713, // ur-IN - 0x4b4000e8: 714, // ur-PK - 0x4bc00000: 715, // uz - 0x4bc05000: 716, // uz-Arab - 0x4bc05024: 717, // uz-Arab-AF - 0x4bc1f000: 718, // uz-Cyrl - 0x4bc1f137: 719, // uz-Cyrl-UZ - 0x4bc57000: 720, // uz-Latn - 0x4bc57137: 721, // uz-Latn-UZ - 0x4be00000: 722, // vai - 0x4be57000: 723, // vai-Latn - 0x4be570b4: 724, // vai-Latn-LR - 0x4bee3000: 725, // vai-Vaii - 0x4bee30b4: 726, // vai-Vaii-LR - 0x4c000000: 727, // ve - 0x4c300000: 728, // vi - 0x4c30013e: 729, // vi-VN - 0x4c900000: 730, // vo - 0x4c900001: 731, // vo-001 - 0x4cc00000: 732, // vun - 0x4cc0012f: 733, // vun-TZ - 0x4ce00000: 734, // wa - 0x4cf00000: 735, // wae - 0x4cf0004e: 736, // wae-CH - 0x4e500000: 737, // wo - 0x4e500114: 738, // wo-SN - 0x4f200000: 739, // xh - 0x4fb00000: 740, // xog - 0x4fb00131: 741, // xog-UG - 0x50900000: 742, // yav - 0x50900052: 743, // yav-CM - 0x51200000: 744, // yi - 0x51200001: 745, // yi-001 - 0x51800000: 746, // yo - 0x5180003b: 747, // yo-BJ - 0x518000d6: 748, // yo-NG - 0x51f00000: 749, // yue - 0x51f38000: 750, // yue-Hans - 0x51f38053: 751, // yue-Hans-CN - 0x51f39000: 752, // yue-Hant - 0x51f3908d: 753, // yue-Hant-HK - 0x52800000: 754, // zgh - 0x528000ba: 755, // zgh-MA - 0x52900000: 756, // zh - 0x52938000: 757, // zh-Hans - 0x52938053: 758, // zh-Hans-CN - 0x5293808d: 759, // zh-Hans-HK - 0x529380c6: 760, // zh-Hans-MO - 0x5293810d: 761, // zh-Hans-SG - 0x52939000: 762, // zh-Hant - 0x5293908d: 763, // zh-Hant-HK - 0x529390c6: 764, // zh-Hant-MO - 0x5293912e: 765, // zh-Hant-TW - 0x52f00000: 766, // zu - 0x52f00161: 767, // zu-ZA -} - -// Total table size 4676 bytes (4KiB); checksum: 17BE3673 diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go index b65e213ff8..abfa17f66d 100644 --- a/vendor/golang.org/x/text/language/language.go +++ b/vendor/golang.org/x/text/language/language.go @@ -2,8 +2,7 @@ // Use of this source code is governed by a BSD-style // license that can be found in the LICENSE file. -//go:generate go run gen.go gen_common.go -output tables.go -//go:generate go run gen_index.go +//go:generate go run gen.go -output tables.go package language @@ -11,47 +10,34 @@ package language // - verifying that tables are dropped correctly (most notably matcher tables). import ( - "errors" - "fmt" "strings" -) - -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 + "golang.org/x/text/internal/language" + "golang.org/x/text/internal/language/compact" ) // Tag represents a BCP 47 language tag. It is used to specify an instance of a // specific language or locale. All language tag values are guaranteed to be // well-formed. -type Tag struct { - lang langID - region regionID - // TODO: we will soon run out of positions for script. Idea: instead of - // storing lang, region, and script codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - script scriptID - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' - - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string +type Tag compact.Tag + +func makeTag(t language.Tag) (tag Tag) { + return Tag(compact.Make(t)) +} + +func (t *Tag) tag() language.Tag { + return (*compact.Tag)(t).Tag() +} + +func (t *Tag) isCompact() bool { + return (*compact.Tag)(t).IsCompact() } +// TODO: improve performance. +func (t *Tag) lang() language.Language { return t.tag().LangID } +func (t *Tag) region() language.Region { return t.tag().RegionID } +func (t *Tag) script() language.Script { return t.tag().ScriptID } + // Make is a convenience wrapper for Parse that omits the error. // In case of an error, a sensible default is returned. func Make(s string) Tag { @@ -68,25 +54,13 @@ func (c CanonType) Make(s string) Tag { // Raw returns the raw base language, script and region, without making an // attempt to infer their values. func (t Tag) Raw() (b Base, s Script, r Region) { - return Base{t.lang}, Script{t.script}, Region{t.region} -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.lang == a.lang && t.script == a.script && t.region == a.region + tt := t.tag() + return Base{tt.LangID}, Script{tt.ScriptID}, Region{tt.RegionID} } // IsRoot returns true if t is equal to language "und". func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(und) -} - -// private reports whether the Tag consists solely of a private use tag. -func (t Tag) private() bool { - return t.str != "" && t.pVariant == 0 + return compact.Tag(t).IsRoot() } // CanonType can be used to enable or disable various types of canonicalization. @@ -138,73 +112,73 @@ const ( // canonicalize returns the canonicalized equivalent of the tag and // whether there was any change. -func (t Tag) canonicalize(c CanonType) (Tag, bool) { +func canonicalize(c CanonType, t language.Tag) (language.Tag, bool) { if c == Raw { return t, false } changed := false if c&SuppressScript != 0 { - if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] { - t.script = 0 + if t.LangID.SuppressScript() == t.ScriptID { + t.ScriptID = 0 changed = true } } if c&canonLang != 0 { for { - if l, aliasType := normLang(t.lang); l != t.lang { + if l, aliasType := t.LangID.Canonicalize(); l != t.LangID { switch aliasType { - case langLegacy: + case language.Legacy: if c&Legacy != 0 { - if t.lang == _sh && t.script == 0 { - t.script = _Latn + if t.LangID == _sh && t.ScriptID == 0 { + t.ScriptID = _Latn } - t.lang = l + t.LangID = l changed = true } - case langMacro: + case language.Macro: if c&Macro != 0 { // We deviate here from CLDR. The mapping "nb" -> "no" // qualifies as a typical Macro language mapping. However, // for legacy reasons, CLDR maps "no", the macro language // code for Norwegian, to the dominant variant "nb". This // change is currently under consideration for CLDR as well. - // See http://unicode.org/cldr/trac/ticket/2698 and also - // http://unicode.org/cldr/trac/ticket/1790 for some of the + // See https://unicode.org/cldr/trac/ticket/2698 and also + // https://unicode.org/cldr/trac/ticket/1790 for some of the // practical implications. TODO: this check could be removed // if CLDR adopts this change. - if c&CLDR == 0 || t.lang != _nb { + if c&CLDR == 0 || t.LangID != _nb { changed = true - t.lang = l + t.LangID = l } } - case langDeprecated: + case language.Deprecated: if c&DeprecatedBase != 0 { - if t.lang == _mo && t.region == 0 { - t.region = _MD + if t.LangID == _mo && t.RegionID == 0 { + t.RegionID = _MD } - t.lang = l + t.LangID = l changed = true // Other canonicalization types may still apply. continue } } - } else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 { - t.lang = _nb + } else if c&Legacy != 0 && t.LangID == _no && c&CLDR != 0 { + t.LangID = _nb changed = true } break } } if c&DeprecatedScript != 0 { - if t.script == _Qaai { + if t.ScriptID == _Qaai { changed = true - t.script = _Zinh + t.ScriptID = _Zinh } } if c&DeprecatedRegion != 0 { - if r := normRegion(t.region); r != 0 { + if r := t.RegionID.Canonicalize(); r != t.RegionID { changed = true - t.region = r + t.RegionID = r } } return t, changed @@ -212,11 +186,20 @@ func (t Tag) canonicalize(c CanonType) (Tag, bool) { // Canonicalize returns the canonicalized equivalent of the tag. func (c CanonType) Canonicalize(t Tag) (Tag, error) { - t, changed := t.canonicalize(c) - if changed { - t.remakeString() + // First try fast path. + if t.isCompact() { + if _, changed := canonicalize(c, compact.Tag(t).Tag()); !changed { + return t, nil + } + } + // It is unlikely that one will canonicalize a tag after matching. So do + // a slow but simple approach here. + if tag, changed := canonicalize(c, t.tag()); changed { + tag.RemakeString() + return makeTag(tag), nil } return t, nil + } // Confidence indicates the level of certainty for a given return value. @@ -239,83 +222,21 @@ func (c Confidence) String() string { return confName[c] } -// remakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) remakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.lang.stringToBuf(buf[:]) - if t.script != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.script.String()) - } - if t.region != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.region.String()) - } - return n -} - // String returns the canonical string representation of the language tag. func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.script == 0 && t.region == 0 { - return t.lang.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) + return t.tag().String() } // MarshalText implements encoding.TextMarshaler. func (t Tag) MarshalText() (text []byte, err error) { - if t.str != "" { - text = append(text, t.str...) - } else if t.script == 0 && t.region == 0 { - text = append(text, t.lang.String()...) - } else { - buf := [maxCoreSize]byte{} - text = buf[:t.genCoreBytes(buf[:])] - } - return text, nil + return t.tag().MarshalText() } // UnmarshalText implements encoding.TextUnmarshaler. func (t *Tag) UnmarshalText(text []byte) error { - tag, err := Raw.Parse(string(text)) - *t = tag + var tag language.Tag + err := tag.UnmarshalText(text) + *t = makeTag(tag) return err } @@ -323,15 +244,16 @@ func (t *Tag) UnmarshalText(text []byte) error { // unspecified, an attempt will be made to infer it from the context. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Base() (Base, Confidence) { - if t.lang != 0 { - return Base{t.lang}, Exact + if b := t.lang(); b != 0 { + return Base{b}, Exact } + tt := t.tag() c := High - if t.script == 0 && !(Region{t.region}).IsCountry() { + if tt.ScriptID == 0 && !tt.RegionID.IsCountry() { c = Low } - if tag, err := addTags(t); err == nil && tag.lang != 0 { - return Base{tag.lang}, c + if tag, err := tt.Maximize(); err == nil && tag.LangID != 0 { + return Base{tag.LangID}, c } return Base{0}, No } @@ -344,35 +266,34 @@ func (t Tag) Base() (Base, Confidence) { // If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) // as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks // common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. -// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for +// See https://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for // unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. // Note that an inferred script is never guaranteed to be the correct one. Latin is // almost exclusively used for Afrikaans, but Arabic has been used for some texts // in the past. Also, the script that is commonly used may change over time. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Script() (Script, Confidence) { - if t.script != 0 { - return Script{t.script}, Exact - } - sc, c := scriptID(_Zzzz), No - if t.lang < langNoIndexOffset { - if scr := scriptID(suppressScript[t.lang]); scr != 0 { - // Note: it is not always the case that a language with a suppress - // script value is only written in one script (e.g. kk, ms, pa). - if t.region == 0 { - return Script{scriptID(scr)}, High - } - sc, c = scr, High + if scr := t.script(); scr != 0 { + return Script{scr}, Exact + } + tt := t.tag() + sc, c := language.Script(_Zzzz), No + if scr := tt.LangID.SuppressScript(); scr != 0 { + // Note: it is not always the case that a language with a suppress + // script value is only written in one script (e.g. kk, ms, pa). + if tt.RegionID == 0 { + return Script{scr}, High } + sc, c = scr, High } - if tag, err := addTags(t); err == nil { - if tag.script != sc { - sc, c = tag.script, Low + if tag, err := tt.Maximize(); err == nil { + if tag.ScriptID != sc { + sc, c = tag.ScriptID, Low } } else { - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil && tag.script != sc { - sc, c = tag.script, Low + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil && tag.ScriptID != sc { + sc, c = tag.ScriptID, Low } } return Script{sc}, c @@ -382,28 +303,31 @@ func (t Tag) Script() (Script, Confidence) { // infer a most likely candidate from the context. // It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. func (t Tag) Region() (Region, Confidence) { - if t.region != 0 { - return Region{t.region}, Exact + if r := t.region(); r != 0 { + return Region{r}, Exact } - if t, err := addTags(t); err == nil { - return Region{t.region}, Low // TODO: differentiate between high and low. + tt := t.tag() + if tt, err := tt.Maximize(); err == nil { + return Region{tt.RegionID}, Low // TODO: differentiate between high and low. } - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil { - return Region{tag.region}, Low + tt, _ = canonicalize(Deprecated|Macro, tt) + if tag, err := tt.Maximize(); err == nil { + return Region{tag.RegionID}, Low } return Region{_ZZ}, No // TODO: return world instead of undetermined? } -// Variant returns the variants specified explicitly for this language tag. +// Variants returns the variants specified explicitly for this language tag. // or nil if no variant was specified. func (t Tag) Variants() []Variant { + if !compact.Tag(t).MayHaveVariants() { + return nil + } v := []Variant{} - if int(t.pVariant) < int(t.pExt) { - for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; { - x, str = nextToken(str) - v = append(v, Variant{x}) - } + x, str := "", t.tag().Variants() + for str != "" { + x, str = nextToken(str) + v = append(v, Variant{x}) } return v } @@ -411,57 +335,13 @@ func (t Tag) Variants() []Variant { // Parent returns the CLDR parent of t. In CLDR, missing fields in data for a // specific language are substituted with fields from the parent language. // The parent for a language may change for newer versions of CLDR. +// +// Parent returns a tag for a less specific language that is mutually +// intelligible or Und if there is no such language. This may not be the same as +// simply stripping the last BCP 47 subtag. For instance, the parent of "zh-TW" +// is "zh-Hant", and the parent of "zh-Hant" is "und". func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - t, _ = Raw.Compose(t.Raw()) - if t.region == 0 && t.script != 0 && t.lang != 0 { - base, _ := addTags(Tag{lang: t.lang}) - if base.script == t.script { - return Tag{lang: t.lang} - } - } - return t - } - if t.lang != 0 { - if t.region != 0 { - maxScript := t.script - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.script - } - - for i := range parents { - if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if regionID(r) == t.region { - return Tag{ - lang: t.lang, - script: scriptID(parents[i].script), - region: regionID(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != maxScript { - return Tag{lang: t.lang, script: maxScript} - } - return Tag{lang: t.lang} - } else if t.script != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != t.script { - return und - } - return Tag{lang: t.lang} - } - } - return und + return Tag(compact.Tag(t).Parent()) } // returns token t and the rest of the string. @@ -487,17 +367,8 @@ func (e Extension) String() string { // ParseExtension parses s as an extension and returns it on success. func ParseExtension(s string) (e Extension, err error) { - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return Extension{}, errSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return Extension{}, errSyntax - } - return Extension{string(scan.b)}, nil + ext, err := language.ParseExtension(s) + return Extension{ext}, err } // Type returns the one-byte extension type of e. It returns 0 for the zero @@ -518,22 +389,20 @@ func (e Extension) Tokens() []string { // false for ok if t does not have the requested extension. The returned // extension will be invalid in this case. func (t Tag) Extension(x byte) (ext Extension, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return Extension{ext}, true - } + if !compact.Tag(t).MayHaveExtensions() { + return Extension{}, false } - return Extension{}, false + e, ok := t.tag().Extension(x) + return Extension{e}, ok } // Extensions returns all extensions of t. func (t Tag) Extensions() []Extension { + if !compact.Tag(t).MayHaveExtensions() { + return nil + } e := []Extension{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) + for _, ext := range t.tag().Extensions() { e = append(e, Extension{ext}) } return e @@ -541,259 +410,105 @@ func (t Tag) Extensions() []Extension { // TypeForKey returns the type associated with the given key, where key and type // are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // TypeForKey will traverse the inheritance chain to get the correct value. func (t Tag) TypeForKey(key string) string { - if start, end, _ := t.findTypeForKey(key); end != start { - return t.str[start:end] + if !compact.Tag(t).MayHaveExtensions() { + if key != "rg" && key != "va" { + return "" + } } - return "" + return t.tag().TypeForKey(key) } -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - // SetTypeForKey returns a new Tag with the key set to type, where key and type // are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // An empty value removes an existing pair with the same key. func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.private() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, end, _ := t.findTypeForKey(key) - if start != end { - // Remove key tag and leading '-'. - start -= 4 - - // Remove a possible empty extension. - if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, end, hasExt := t.findTypeForKey(key) - if start == end { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) - } - } - return t, nil + tt, err := t.tag().SetTypeForKey(key, value) + return makeTag(tt), err } -// findKeyAndType returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - // p points to the hyphen preceding the current token. - if p3 := p + 3; s[p3] == '-' { - // Found a key. - // Check whether we just processed the key that was requested. - if curKey == key { - return start, p, true - } - // Set to the next key and continue scanning type tokens. - curKey = s[p+1 : p3] - if curKey > key { - return p, p, true - } - // Start of the type token sequence. - start = p + 4 - // A type is at least 3 characters long. - p += 7 // 4 + 3 - } else { - // Attribute or type, which is at least 3 characters long. - p += 4 - } - // p points past the third character of a type or attribute. - max := p + 5 // maximum length of token plus hyphen. - if len(s) < max { - max = len(s) - } - for ; p < max && s[p] != '-'; p++ { - } - // Bail if we have exhausted all tokens or if the next token starts - // a new extension. - if p == len(s) || s[p+2] == '-' { - if curKey == key { - return start, p, true - } - return p, p, true - } - } -} +// NumCompactTags is the number of compact tags. The maximum tag is +// NumCompactTags-1. +const NumCompactTags = compact.NumCompactTags // CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository. The index will change over time -// and should not be stored in persistent storage. Extensions, except for the -// 'va' type of the 'u' extension, are ignored. It will return 0, false if no -// compact tag exists, where 0 is the index for the root language (Und). -func CompactIndex(t Tag) (index int, ok bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - b, s, r := t.Raw() - if len(t.str) > 0 { - if strings.HasPrefix(t.str, "x-") { - // We have no entries for user-defined tags. - return 0, false - } - if uint16(t.pVariant) != t.pExt { - // There are no tags with variants and an u-va type. - if t.TypeForKey("va") != "" { - return 0, false - } - t, _ = Raw.Compose(b, s, r, t.Variants()) - } else if _, ok := t.Extension('u'); ok { - // Strip all but the 'va' entry. - variant := t.TypeForKey("va") - t, _ = Raw.Compose(b, s, r) - t, _ = t.SetTypeForKey("va", variant) - } - if len(t.str) > 0 { - // We have some variants. - for i, s := range specialTags { - if s == t { - return i + 1, true - } - } - return 0, false - } - } - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - key := uint32(b.langID) << (8 + 12) - key |= uint32(s.scriptID) << 12 - key |= uint32(r.regionID) - x, ok := coreTags[key] - return int(x), ok +// for which data exists in the text repository.The index will change over time +// and should not be stored in persistent storage. If t does not match a compact +// index, exact will be false and the compact index will be returned for the +// first match after repeatedly taking the Parent of t. +func CompactIndex(t Tag) (index int, exact bool) { + id, exact := compact.LanguageID(compact.Tag(t)) + return int(id), exact } +var root = language.Tag{} + // Base is an ISO 639 language code, used for encoding the base language // of a language tag. type Base struct { - langID + langID language.Language } // ParseBase parses a 2- or 3-letter ISO 639 code. // It returns a ValueError if s is a well-formed but unknown language identifier // or another error if another error occurred. func ParseBase(s string) (Base, error) { - if n := len(s); n < 2 || 3 < n { - return Base{}, errSyntax - } - var buf [3]byte - l, err := getLangID(buf[:copy(buf[:], s)]) + l, err := language.ParseBase(s) return Base{l}, err } +// String returns the BCP 47 representation of the base language. +func (b Base) String() string { + return b.langID.String() +} + +// ISO3 returns the ISO 639-3 language code. +func (b Base) ISO3() string { + return b.langID.ISO3() +} + +// IsPrivateUse reports whether this language code is reserved for private use. +func (b Base) IsPrivateUse() bool { + return b.langID.IsPrivateUse() +} + // Script is a 4-letter ISO 15924 code for representing scripts. // It is idiomatically represented in title case. type Script struct { - scriptID + scriptID language.Script } // ParseScript parses a 4-letter ISO 15924 code. // It returns a ValueError if s is a well-formed but unknown script identifier // or another error if another error occurred. func ParseScript(s string) (Script, error) { - if len(s) != 4 { - return Script{}, errSyntax - } - var buf [4]byte - sc, err := getScriptID(script, buf[:copy(buf[:], s)]) + sc, err := language.ParseScript(s) return Script{sc}, err } +// String returns the script code in title case. +// It returns "Zzzz" for an unspecified script. +func (s Script) String() string { + return s.scriptID.String() +} + +// IsPrivateUse reports whether this script code is reserved for private use. +func (s Script) IsPrivateUse() bool { + return s.scriptID.IsPrivateUse() +} + // Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. type Region struct { - regionID + regionID language.Region } // EncodeM49 returns the Region for the given UN M.49 code. // It returns an error if r is not a valid code. func EncodeM49(r int) (Region, error) { - rid, err := getRegionM49(r) + rid, err := language.EncodeM49(r) return Region{rid}, err } @@ -801,62 +516,54 @@ func EncodeM49(r int) (Region, error) { // It returns a ValueError if s is a well-formed but unknown region identifier // or another error if another error occurred. func ParseRegion(s string) (Region, error) { - if n := len(s); n < 2 || 3 < n { - return Region{}, errSyntax - } - var buf [3]byte - r, err := getRegionID(buf[:copy(buf[:], s)]) + r, err := language.ParseRegion(s) return Region{r}, err } +// String returns the BCP 47 representation for the region. +// It returns "ZZ" for an unspecified region. +func (r Region) String() string { + return r.regionID.String() +} + +// ISO3 returns the 3-letter ISO code of r. +// Note that not all regions have a 3-letter ISO code. +// In such cases this method returns "ZZZ". +func (r Region) ISO3() string { + return r.regionID.ISO3() +} + +// M49 returns the UN M.49 encoding of r, or 0 if this encoding +// is not defined for r. +func (r Region) M49() int { + return r.regionID.M49() +} + +// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This +// may include private-use tags that are assigned by CLDR and used in this +// implementation. So IsPrivateUse and IsCountry can be simultaneously true. +func (r Region) IsPrivateUse() bool { + return r.regionID.IsPrivateUse() +} + // IsCountry returns whether this region is a country or autonomous area. This // includes non-standard definitions from CLDR. func (r Region) IsCountry() bool { - if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK { - return false - } - return true + return r.regionID.IsCountry() } // IsGroup returns whether this region defines a collection of regions. This // includes non-standard definitions from CLDR. func (r Region) IsGroup() bool { - if r.regionID == 0 { - return false - } - return int(regionInclusion[r.regionID]) < len(regionContainment) + return r.regionID.IsGroup() } // Contains returns whether Region c is contained by Region r. It returns true // if c == r. func (r Region) Contains(c Region) bool { - return r.regionID.contains(c.regionID) + return r.regionID.Contains(c.regionID) } -func (r regionID) contains(c regionID) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - // TLD returns the country code top-level domain (ccTLD). UK is returned for GB. // In all other cases it returns either the region itself or an error. // @@ -865,25 +572,15 @@ var errNoTLD = errors.New("language: region is not a valid ccTLD") // region will already be canonicalized it was obtained from a Tag that was // obtained using any of the default methods. func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r.regionID == _GB { - r = Region{_UK} - } - if (r.typ() & ccTLD) == 0 { - return Region{}, errNoTLD - } - return r, nil + tld, err := r.regionID.TLD() + return Region{tld}, err } // Canonicalize returns the region or a possible replacement if the region is // deprecated. It will not return a replacement for deprecated regions that // are split into multiple regions. func (r Region) Canonicalize() Region { - if cr := normRegion(r.regionID); cr != 0 { - return Region{cr} - } - return r + return Region{r.regionID.Canonicalize()} } // Variant represents a registered variant of a language as defined by BCP 47. @@ -894,11 +591,8 @@ type Variant struct { // ParseVariant parses and returns a Variant. An error is returned if s is not // a valid variant. func ParseVariant(s string) (Variant, error) { - s = strings.ToLower(s) - if _, ok := variantIndex[s]; ok { - return Variant{s}, nil - } - return Variant{}, mkErrInvalid([]byte(s)) + v, err := language.ParseVariant(s) + return Variant{v.String()}, err } // String returns the string representation of the variant. diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go index 15b74d125c..f734921349 100644 --- a/vendor/golang.org/x/text/language/match.go +++ b/vendor/golang.org/x/text/language/match.go @@ -4,7 +4,12 @@ package language -import "errors" +import ( + "errors" + "strings" + + "golang.org/x/text/internal/language" +) // A MatchOption configures a Matcher. type MatchOption func(*matcher) @@ -74,12 +79,13 @@ func NewMatcher(t []Tag, options ...MatchOption) Matcher { } func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { + var tt language.Tag match, w, c := m.getBest(want...) if match != nil { - t, index = match.tag, match.index + tt, index = match.tag, match.index } else { // TODO: this should be an option - t = m.default_.tag + tt = m.default_.tag if m.preferSameScript { outer: for _, w := range want { @@ -91,7 +97,7 @@ func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { } for i, h := range m.supported { if script.scriptID == h.maxScript { - t, index = h.tag, i + tt, index = h.tag, i break outer } } @@ -99,238 +105,45 @@ func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { } // TODO: select first language tag based on script. } - if w.region != 0 && t.region != 0 && t.region.contains(w.region) { - t, _ = Raw.Compose(t, Region{w.region}) + if w.RegionID != tt.RegionID && w.RegionID != 0 { + if w.RegionID != 0 && tt.RegionID != 0 && tt.RegionID.Contains(w.RegionID) { + tt.RegionID = w.RegionID + tt.RemakeString() + } else if r := w.RegionID.String(); len(r) == 2 { + // TODO: also filter macro and deprecated. + tt, _ = tt.SetTypeForKey("rg", strings.ToLower(r)+"zzzz") + } } // Copy options from the user-provided tag into the result tag. This is hard // to do after the fact, so we do it here. // TODO: add in alternative variants to -u-va-. // TODO: add preferred region to -u-rg-. if e := w.Extensions(); len(e) > 0 { - t, _ = Raw.Compose(t, e) - } - return t, index, c -} - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id langID) { - if t.lang == 0 { - t.lang = id - } -} - -func (t *Tag) setUndefinedScript(id scriptID) { - if t.script == 0 { - t.script = id - } -} - -func (t *Tag) setUndefinedRegion(id regionID) { - if t.region == 0 || t.region.contains(id) { - t.region = id + b := language.Builder{} + b.SetTag(tt) + for _, e := range e { + b.AddExt(e) + } + tt = b.Make() } + return makeTag(tt), index, c } // ErrMissingLikelyTagsData indicates no information was available // to compute likely values of missing tags. var ErrMissingLikelyTagsData = errors.New("missing likely tags data") -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns an ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.remakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if langID(x.lang) == t.lang && scriptID(x.script) == t.script { - t.region = regionID(x.region) - } - return true - } - return false -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.private() { - return t, nil - } - if t.script != 0 && t.region != 0 { - if t.lang != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.region : t.region+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if scriptID(x.script) == t.script { - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - } - if t.lang != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.script != 0 { - for _, x := range list { - if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(regionID(x.region)) - return t, nil - } - } - } else if t.region != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) { - tt.region = regionID(x.region) - tt.setUndefinedScript(scriptID(x.script)) - goodScript = goodScript && tt.script == scriptID(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.script = tt.script - } - } - } - } - } else { - // Search matches for und-script. - if t.script != 0 { - x := likelyScript[t.script] - if x.region != 0 { - t.setUndefinedRegion(regionID(x.region)) - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.region != 0 { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - t.region = regionID(x.region) - } - } else { - x := likelyRegion[t.region] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(scriptID(x.script)) - t.setUndefinedRegion(regionID(x.region)) - } - specializeRegion(&t) - if t.lang == 0 { - t.lang = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.lang = id.lang - t.script = id.script - t.region = id.region -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.remakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {lang: t.lang}, - {lang: t.lang, region: t.region}, - {lang: t.lang, script: t.script}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} +// func (t *Tag) setTagsFrom(id Tag) { +// t.LangID = id.LangID +// t.ScriptID = id.ScriptID +// t.RegionID = id.RegionID +// } // Tag Matching // CLDR defines an algorithm for finding the best match between two sets of language // tags. The basic algorithm defines how to score a possible match and then find // the match with the best score -// (see http://www.unicode.org/reports/tr35/#LanguageMatching). +// (see https://www.unicode.org/reports/tr35/#LanguageMatching). // Using scoring has several disadvantages. The scoring obfuscates the importance of // the various factors considered, making the algorithm harder to understand. Using // scoring also requires the full score to be computed for each pair of tags. @@ -441,7 +254,7 @@ func minimizeTags(t Tag) (Tag, error) { type matcher struct { default_ *haveTag supported []*haveTag - index map[langID]*matchHeader + index map[language.Language]*matchHeader passSettings bool preferSameScript bool } @@ -456,7 +269,7 @@ type matchHeader struct { // haveTag holds a supported Tag and its maximized script and region. The maximized // or canonicalized language is not stored as it is not needed during matching. type haveTag struct { - tag Tag + tag language.Tag // index of this tag in the original list of supported tags. index int @@ -466,37 +279,37 @@ type haveTag struct { conf Confidence // Maximized region and script. - maxRegion regionID - maxScript scriptID + maxRegion language.Region + maxScript language.Script // altScript may be checked as an alternative match to maxScript. If altScript // matches, the confidence level for this match is Low. Theoretically there // could be multiple alternative scripts. This does not occur in practice. - altScript scriptID + altScript language.Script // nextMax is the index of the next haveTag with the same maximized tags. nextMax uint16 } -func makeHaveTag(tag Tag, index int) (haveTag, langID) { +func makeHaveTag(tag language.Tag, index int) (haveTag, language.Language) { max := tag - if tag.lang != 0 || tag.region != 0 || tag.script != 0 { - max, _ = max.canonicalize(All) - max, _ = addTags(max) - max.remakeString() + if tag.LangID != 0 || tag.RegionID != 0 || tag.ScriptID != 0 { + max, _ = canonicalize(All, max) + max, _ = max.Maximize() + max.RemakeString() } - return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang + return haveTag{tag, index, Exact, max.RegionID, max.ScriptID, altScript(max.LangID, max.ScriptID), 0}, max.LangID } // altScript returns an alternative script that may match the given script with // a low confidence. At the moment, the langMatch data allows for at most one // script to map to another and we rely on this to keep the code simple. -func altScript(l langID, s scriptID) scriptID { +func altScript(l language.Language, s language.Script) language.Script { for _, alt := range matchScript { // TODO: also match cases where language is not the same. - if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) && - scriptID(alt.haveScript) == s { - return scriptID(alt.wantScript) + if (language.Language(alt.wantLang) == l || language.Language(alt.haveLang) == l) && + language.Script(alt.haveScript) == s { + return language.Script(alt.wantScript) } } return 0 @@ -508,7 +321,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { h.original = h.original || exact // Don't add new exact matches. for _, v := range h.haveTags { - if v.tag.equalsRest(n.tag) { + if equalsRest(v.tag, n.tag) { return } } @@ -517,7 +330,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { for i, v := range h.haveTags { if v.maxScript == n.maxScript && v.maxRegion == n.maxRegion && - v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() { + v.tag.VariantOrPrivateUseTags() == n.tag.VariantOrPrivateUseTags() { for h.haveTags[i].nextMax != 0 { i = int(h.haveTags[i].nextMax) } @@ -530,7 +343,7 @@ func (h *matchHeader) addIfNew(n haveTag, exact bool) { // header returns the matchHeader for the given language. It creates one if // it doesn't already exist. -func (m *matcher) header(l langID) *matchHeader { +func (m *matcher) header(l language.Language) *matchHeader { if h := m.index[l]; h != nil { return h } @@ -554,7 +367,7 @@ func toConf(d uint8) Confidence { // for a given tag. func newMatcher(supported []Tag, options []MatchOption) *matcher { m := &matcher{ - index: make(map[langID]*matchHeader), + index: make(map[language.Language]*matchHeader), preferSameScript: true, } for _, o := range options { @@ -567,16 +380,18 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // Add supported languages to the index. Add exact matches first to give // them precedence. for i, tag := range supported { - pair, _ := makeHaveTag(tag, i) - m.header(tag.lang).addIfNew(pair, true) + tt := tag.tag() + pair, _ := makeHaveTag(tt, i) + m.header(tt.LangID).addIfNew(pair, true) m.supported = append(m.supported, &pair) } - m.default_ = m.header(supported[0].lang).haveTags[0] + m.default_ = m.header(supported[0].lang()).haveTags[0] // Keep these in two different loops to support the case that two equivalent // languages are distinguished, such as iw and he. for i, tag := range supported { - pair, max := makeHaveTag(tag, i) - if max != tag.lang { + tt := tag.tag() + pair, max := makeHaveTag(tt, i) + if max != tt.LangID { m.header(max).addIfNew(pair, true) } } @@ -585,11 +400,11 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // update will only add entries to original indexes, thus not computing any // transitive relations. update := func(want, have uint16, conf Confidence) { - if hh := m.index[langID(have)]; hh != nil { + if hh := m.index[language.Language(have)]; hh != nil { if !hh.original { return } - hw := m.header(langID(want)) + hw := m.header(language.Language(want)) for _, ht := range hh.haveTags { v := *ht if conf < v.conf { @@ -597,7 +412,7 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { } v.nextMax = 0 // this value needs to be recomputed if v.altScript != 0 { - v.altScript = altScript(langID(want), v.maxScript) + v.altScript = altScript(language.Language(want), v.maxScript) } hw.addIfNew(v, conf == Exact && hh.original) } @@ -618,66 +433,67 @@ func newMatcher(supported []Tag, options []MatchOption) *matcher { // First we match deprecated equivalents. If they are perfect equivalents // (their canonicalization simply substitutes a different language code, but // nothing else), the match confidence is Exact, otherwise it is High. - for i, lm := range langAliasMap { + for i, lm := range language.AliasMap { // If deprecated codes match and there is no fiddling with the script or // or region, we consider it an exact match. conf := Exact - if langAliasTypes[i] != langMacro { - if !isExactEquivalent(langID(lm.from)) { + if language.AliasTypes[i] != language.Macro { + if !isExactEquivalent(language.Language(lm.From)) { conf = High } - update(lm.to, lm.from, conf) + update(lm.To, lm.From, conf) } - update(lm.from, lm.to, conf) + update(lm.From, lm.To, conf) } return m } // getBest gets the best matching tag in m for any of the given tags, taking into // account the order of preference of the given tags. -func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { +func (m *matcher) getBest(want ...Tag) (got *haveTag, orig language.Tag, c Confidence) { best := bestMatch{} - for i, w := range want { - var max Tag + for i, ww := range want { + w := ww.tag() + var max language.Tag // Check for exact match first. - h := m.index[w.lang] - if w.lang != 0 { + h := m.index[w.LangID] + if w.LangID != 0 { if h == nil { continue } // Base language is defined. - max, _ = w.canonicalize(Legacy | Deprecated | Macro) + max, _ = canonicalize(Legacy|Deprecated|Macro, w) // A region that is added through canonicalization is stronger than // a maximized region: set it in the original (e.g. mo -> ro-MD). - if w.region != max.region { - w.region = max.region + if w.RegionID != max.RegionID { + w.RegionID = max.RegionID } // TODO: should we do the same for scripts? // See test case: en, sr, nl ; sh ; sr - max, _ = addTags(max) + max, _ = max.Maximize() } else { // Base language is not defined. if h != nil { for i := range h.haveTags { have := h.haveTags[i] - if have.tag.equalsRest(w) { + if equalsRest(have.tag, w) { return have, w, Exact } } } - if w.script == 0 && w.region == 0 { + if w.ScriptID == 0 && w.RegionID == 0 { // We skip all tags matching und for approximate matching, including // private tags. continue } - max, _ = addTags(w) - if h = m.index[max.lang]; h == nil { + max, _ = w.Maximize() + if h = m.index[max.LangID]; h == nil { continue } } pin := true for _, t := range want[i+1:] { - if w.lang == t.lang { + if w.LangID == t.lang() { pin = false break } @@ -685,11 +501,11 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { // Check for match based on maximized tag. for i := range h.haveTags { have := h.haveTags[i] - best.update(have, w, max.script, max.region, pin) + best.update(have, w, max.ScriptID, max.RegionID, pin) if best.conf == Exact { for have.nextMax != 0 { have = h.haveTags[have.nextMax] - best.update(have, w, max.script, max.region, pin) + best.update(have, w, max.ScriptID, max.RegionID, pin) } return best.have, best.want, best.conf } @@ -697,9 +513,9 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { } if best.conf <= No { if len(want) != 0 { - return nil, want[0], No + return nil, want[0].tag(), No } - return nil, Tag{}, No + return nil, language.Tag{}, No } return best.have, best.want, best.conf } @@ -707,9 +523,9 @@ func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { // bestMatch accumulates the best match so far. type bestMatch struct { have *haveTag - want Tag + want language.Tag conf Confidence - pinnedRegion regionID + pinnedRegion language.Region pinLanguage bool sameRegionGroup bool // Cached results from applying tie-breaking rules. @@ -734,19 +550,19 @@ type bestMatch struct { // still prefer a second language over a dialect of the preferred language by // explicitly specifying dialects, e.g. "en, nl, en-GB". In this case pin should // be false. -func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID, pin bool) { +func (m *bestMatch) update(have *haveTag, tag language.Tag, maxScript language.Script, maxRegion language.Region, pin bool) { // Bail if the maximum attainable confidence is below that of the current best match. c := have.conf if c < m.conf { return } // Don't change the language once we already have found an exact match. - if m.pinLanguage && tag.lang != m.want.lang { + if m.pinLanguage && tag.LangID != m.want.LangID { return } // Pin the region group if we are comparing tags for the same language. - if tag.lang == m.want.lang && m.sameRegionGroup { - _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.lang) + if tag.LangID == m.want.LangID && m.sameRegionGroup { + _, sameGroup := regionGroupDist(m.pinnedRegion, have.maxRegion, have.maxScript, m.want.LangID) if !sameGroup { return } @@ -756,7 +572,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion // don't pin anything, otherwise pin the language. m.pinLanguage = pin } - if have.tag.equalsRest(tag) { + if equalsRest(have.tag, tag) { } else if have.maxScript != maxScript { // There is usually very little comprehension between different scripts. // In a few cases there may still be Low comprehension. This possibility @@ -786,7 +602,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion // Tie-breaker rules: // We prefer if the pre-maximized language was specified and identical. - origLang := have.tag.lang == tag.lang && tag.lang != 0 + origLang := have.tag.LangID == tag.LangID && tag.LangID != 0 if !beaten && m.origLang != origLang { if m.origLang { return @@ -795,7 +611,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion } // We prefer if the pre-maximized region was specified and identical. - origReg := have.tag.region == tag.region && tag.region != 0 + origReg := have.tag.RegionID == tag.RegionID && tag.RegionID != 0 if !beaten && m.origReg != origReg { if m.origReg { return @@ -803,7 +619,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang) + regGroupDist, sameGroup := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.LangID) if !beaten && m.regGroupDist != regGroupDist { if regGroupDist > m.regGroupDist { return @@ -811,7 +627,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion beaten = true } - paradigmReg := isParadigmLocale(tag.lang, have.maxRegion) + paradigmReg := isParadigmLocale(tag.LangID, have.maxRegion) if !beaten && m.paradigmReg != paradigmReg { if !paradigmReg { return @@ -820,7 +636,7 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion } // Next we prefer if the pre-maximized script was specified and identical. - origScript := have.tag.script == tag.script && tag.script != 0 + origScript := have.tag.ScriptID == tag.ScriptID && tag.ScriptID != 0 if !beaten && m.origScript != origScript { if m.origScript { return @@ -843,9 +659,9 @@ func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion } } -func isParadigmLocale(lang langID, r regionID) bool { +func isParadigmLocale(lang language.Language, r language.Region) bool { for _, e := range paradigmLocales { - if langID(e[0]) == lang && (r == regionID(e[1]) || r == regionID(e[2])) { + if language.Language(e[0]) == lang && (r == language.Region(e[1]) || r == language.Region(e[2])) { return true } } @@ -854,13 +670,13 @@ func isParadigmLocale(lang langID, r regionID) bool { // regionGroupDist computes the distance between two regions based on their // CLDR grouping. -func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, same bool) { +func regionGroupDist(a, b language.Region, script language.Script, lang language.Language) (dist uint8, same bool) { const defaultDistance = 4 aGroup := uint(regionToGroups[a]) << 1 bGroup := uint(regionToGroups[b]) << 1 for _, ri := range matchRegion { - if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) { + if language.Language(ri.lang) == lang && (ri.script == 0 || language.Script(ri.script) == script) { group := uint(1 << (ri.group &^ 0x80)) if 0x80&ri.group == 0 { if aGroup&bGroup&group != 0 { // Both regions are in the group. @@ -876,31 +692,16 @@ func regionGroupDist(a, b regionID, script scriptID, lang langID) (dist uint8, s return defaultDistance, true } -func (t Tag) variants() string { - if t.pVariant == 0 { - return "" - } - return t.str[t.pVariant:t.pExt] -} - -// variantOrPrivateTagStr returns variants or private use tags. -func (t Tag) variantOrPrivateTagStr() string { - if t.pExt > 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] -} - // equalsRest compares everything except the language. -func (a Tag) equalsRest(b Tag) bool { +func equalsRest(a, b language.Tag) bool { // TODO: don't include extensions in this comparison. To do this efficiently, // though, we should handle private tags separately. - return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr() + return a.ScriptID == b.ScriptID && a.RegionID == b.RegionID && a.VariantOrPrivateUseTags() == b.VariantOrPrivateUseTags() } // isExactEquivalent returns true if canonicalizing the language will not alter // the script or region of a tag. -func isExactEquivalent(l langID) bool { +func isExactEquivalent(l language.Language) bool { for _, o := range notEquivalent { if o == l { return false @@ -909,25 +710,26 @@ func isExactEquivalent(l langID) bool { return true } -var notEquivalent []langID +var notEquivalent []language.Language func init() { // Create a list of all languages for which canonicalization may alter the // script or region. - for _, lm := range langAliasMap { - tag := Tag{lang: langID(lm.from)} - if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 { - notEquivalent = append(notEquivalent, langID(lm.from)) + for _, lm := range language.AliasMap { + tag := language.Tag{LangID: language.Language(lm.From)} + if tag, _ = canonicalize(All, tag); tag.ScriptID != 0 || tag.RegionID != 0 { + notEquivalent = append(notEquivalent, language.Language(lm.From)) } } // Maximize undefined regions of paradigm locales. for i, v := range paradigmLocales { - max, _ := addTags(Tag{lang: langID(v[0])}) + t := language.Tag{LangID: language.Language(v[0])} + max, _ := t.Maximize() if v[1] == 0 { - paradigmLocales[i][1] = uint16(max.region) + paradigmLocales[i][1] = uint16(max.RegionID) } if v[2] == 0 { - paradigmLocales[i][2] = uint16(max.region) + paradigmLocales[i][2] = uint16(max.RegionID) } } } diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go index fca2d30e50..11acfd8856 100644 --- a/vendor/golang.org/x/text/language/parse.go +++ b/vendor/golang.org/x/text/language/parse.go @@ -5,216 +5,21 @@ package language import ( - "bytes" "errors" - "fmt" - "sort" "strconv" "strings" - "golang.org/x/text/internal/tag" + "golang.org/x/text/internal/language" ) -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// errSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var errSyntax = errors.New("language: tag is not well-formed") - // ValueError is returned by any of the parsing functions when the // input is well-formed but the respective subtag is not recognized // as a valid value. -type ValueError struct { - v [8]byte -} - -func mkErrInvalid(s []byte) error { - var e ValueError - copy(e.v[:], s) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} +type ValueError interface { + error -func (s *scanner) setError(e error) { - if s.err == nil || (e == errSyntax && s.err != errSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - if end < cap(s.b) { - b := make([]byte, len(s.b)+diff) - copy(b, s.b[:oldStart]) - copy(b[end:], s.b[oldEnd:]) - s.b = b - } else { - s.b = append(s.b[end:], s.b[oldEnd:]...) - } - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.setError(errSyntax) - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(errSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(errSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end + // Subtag returns the subtag for which the error occurred. + Subtag() string } // Parse parses the given BCP 47 string and returns a valid Tag. If parsing @@ -223,7 +28,7 @@ func (s *scanner) acceptMinSize(min int) (end int) { // ValueError. The Tag returned in this case is just stripped of the unknown // value. All other values are preserved. It accepts tags in the BCP 47 format // and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. // The resulting tag is canonicalized using the default canonicalization type. func Parse(s string) (t Tag, err error) { return Default.Parse(s) @@ -235,327 +40,18 @@ func Parse(s string) (t Tag, err error) { // ValueError. The Tag returned in this case is just stripped of the unknown // value. All other values are preserved. It accepts tags in the BCP 47 format // and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the the canonicalization type c. +// https://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. +// The resulting tag is canonicalized using the canonicalization type c. func (c CanonType) Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return und, errSyntax - } - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } + tt, err := language.Parse(s) + if err != nil { + return makeTag(tt), err } - scan := makeScannerString(s) - t, err = parse(&scan, s) - t, changed := t.canonicalize(c) + tt, changed := canonicalize(c, tt) if changed { - t.remakeString() - } - return t, err -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, errSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return und, errSyntax - } else { // the usual case - t, end = parseTag(scan) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(errSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -func parseTag(scan *scanner) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.lang, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.lang.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent - // to a tag of the form <extlang>. - lang, e := getLangID(scan.token) - if lang != 0 { - t.lang = lang - copy(scan.b[langStart:], lang.String()) - scan.b[langStart+3] = '-' - scan.start = langStart + 4 - } - scan.gobble(e) - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.script, e = getScriptID(script, scan.token) - if t.script == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.region, e = getRegionID(scan.token) - if t.region == 0 { - scan.gobble(e) - } else { - scan.replace(t.region.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(mkErrInvalid(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort [][]byte - -func (b bytesSort) Len() int { - return len(b) -} - -func (b bytesSort) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bytesSort) Less(i, j int) bool { - return bytes.Compare(b[i], b[j]) == -1 -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(errSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) + tt.RemakeString() } - sort.Sort(bytesSort(exts)) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort(attrs)) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - keyEnd := scan.end - end = scan.acceptMinSize(3) - // TODO: check key value validity - if keyEnd == end || bytes.Compare(key, last) != 1 { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart, keyEnd := scan.start, scan.end - end = scan.acceptMinSize(3) - if keyEnd != end { - keys = append(keys, scan.b[keyStart:end]) - } else { - scan.setError(errSyntax) - end = keyStart - } - } - sort.Sort(bytesSort(keys)) - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], bytes.Join(keys, separator)) - break - } - } - case 't': - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end + return makeTag(tt), err } // Compose creates a Tag from individual parts, which may be of type Tag, Base, @@ -563,10 +59,11 @@ func parseExtension(scan *scanner) int { // Base, Script or Region or slice of type Variant or Extension is passed more // than once, the latter will overwrite the former. Variants and Extensions are // accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using the Default CanonType. If one or more errors are -// encountered, one of the errors is returned. +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using the Default CanonType. If one or +// more errors are encountered, one of the errors is returned. func Compose(part ...interface{}) (t Tag, err error) { return Default.Compose(part...) } @@ -576,191 +73,63 @@ func Compose(part ...interface{}) (t Tag, err error) { // Base, Script or Region or slice of type Variant or Extension is passed more // than once, the latter will overwrite the former. Variants and Extensions are // accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using CanonType c. If one or more errors are encountered, -// one of the errors is returned. +// will replace the former. For -u extensions, though, the key-type pairs are +// added, where later values overwrite older ones. A Tag overwrites all former +// values and typically only makes sense as the first argument. The resulting +// tag is returned after canonicalizing using CanonType c. If one or more errors +// are encountered, one of the errors is returned. func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { - var b builder - if err = b.update(part...); err != nil { + var b language.Builder + if err = update(&b, part...); err != nil { return und, err } - t, _ = b.tag.canonicalize(c) - - if len(b.ext) > 0 || len(b.variant) > 0 { - sort.Sort(sortVariant(b.variant)) - sort.Strings(b.ext) - if b.private != "" { - b.ext = append(b.ext, b.private) - } - n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variant...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.ext...) - t.str = string(buf[:p]) - } else if b.private != "" { - t.str = b.private - t.remakeString() - } - return -} - -type builder struct { - tag Tag - - private string // the x extension - ext []string - variant []string - - err error -} - -func (b *builder) addExt(e string) { - if e == "" { - } else if e[0] == 'x' { - b.private = e - } else { - b.ext = append(b.ext, e) - } + b.Tag, _ = canonicalize(c, b.Tag) + return makeTag(b.Make()), err } var errInvalidArgument = errors.New("invalid Extension or Variant") -func (b *builder) update(part ...interface{}) (err error) { - replace := func(l *[]string, s string, eq func(a, b string) bool) bool { - if s == "" { - b.err = errInvalidArgument - return true - } - for i, v := range *l { - if eq(v, s) { - (*l)[i] = s - return true - } - } - return false - } +func update(b *language.Builder, part ...interface{}) (err error) { for _, x := range part { switch v := x.(type) { case Tag: - b.tag.lang = v.lang - b.tag.region = v.region - b.tag.script = v.script - if v.str != "" { - b.variant = nil - for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; { - x, s = nextToken(s) - b.variant = append(b.variant, x) - } - b.ext, b.private = nil, "" - for i, e := int(v.pExt), ""; i < len(v.str); { - i, e = getExtension(v.str, i) - b.addExt(e) - } - } + b.SetTag(v.tag()) case Base: - b.tag.lang = v.langID + b.Tag.LangID = v.langID case Script: - b.tag.script = v.scriptID + b.Tag.ScriptID = v.scriptID case Region: - b.tag.region = v.regionID + b.Tag.RegionID = v.regionID case Variant: - if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) { - b.variant = append(b.variant, v.variant) + if v.variant == "" { + err = errInvalidArgument + break } + b.AddVariant(v.variant) case Extension: - if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) { - b.addExt(v.s) + if v.s == "" { + err = errInvalidArgument + break } + b.SetExt(v.s) case []Variant: - b.variant = nil - for _, x := range v { - b.update(x) + b.ClearVariants() + for _, v := range v { + b.AddVariant(v.variant) } case []Extension: - b.ext, b.private = nil, "" + b.ClearExtensions() for _, e := range v { - b.update(e) + b.SetExt(e.s) } // TODO: support parsing of raw strings based on morphology or just extensions? case error: - err = v - } - } - return -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariant []string - -func (s sortVariant) Len() int { - return len(s) -} - -func (s sortVariant) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariant) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} - -func findExt(list []string, x byte) int { - for i, e := range list { - if e[0] == x { - return i - } - } - return -1 -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -<char>- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p + if v != nil { + err = v } - p += 3 - } else { - p++ } } - return len(s) + return } var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") @@ -788,7 +157,7 @@ func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { if !ok { return nil, nil, err } - t = Tag{lang: id} + t = makeTag(language.Tag{LangID: id}) } // Scan the optional weight. @@ -830,9 +199,9 @@ func split(s string, c byte) (head, tail string) { return strings.TrimSpace(s), "" } -// Add hack mapping to deal with a small number of cases that that occur +// Add hack mapping to deal with a small number of cases that occur // in Accept-Language (with reasonable frequency). -var acceptFallback = map[string]langID{ +var acceptFallback = map[string]language.Language{ "english": _en, "deutsch": _de, "italian": _it, diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go index b738d457b5..e22807719e 100644 --- a/vendor/golang.org/x/text/language/tables.go +++ b/vendor/golang.org/x/text/language/tables.go @@ -2,997 +2,22 @@ package language -import "golang.org/x/text/internal/tag" - // CLDRVersion is the CLDR version from which the tables in this package are derived. const CLDRVersion = "32" -const numLanguages = 8665 - -const numScripts = 242 - -const numRegions = 357 - -type fromTo struct { - from uint16 - to uint16 -} - -const nonCanonicalUnd = 1201 const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 250 - _da = 257 _de = 269 - _el = 310 _en = 313 - _es = 318 - _et = 320 - _fa = 328 - _fi = 337 - _fil = 339 _fr = 350 - _gu = 420 - _he = 444 - _hi = 446 - _hr = 465 - _hu = 469 - _hy = 471 - _id = 481 - _is = 504 _it = 505 - _ja = 512 - _ka = 528 - _kk = 578 - _km = 586 - _kn = 593 - _ko = 596 - _ky = 650 - _lo = 696 - _lt = 704 - _lv = 711 - _mk = 767 - _ml = 772 - _mn = 779 _mo = 784 - _mr = 795 - _ms = 799 - _mul = 806 - _my = 817 - _nb = 839 - _ne = 849 - _nl = 871 _no = 879 - _pa = 925 - _pl = 947 + _nb = 839 _pt = 960 - _ro = 988 - _ru = 994 _sh = 1031 - _si = 1036 - _sk = 1042 - _sl = 1046 - _sq = 1073 - _sr = 1074 - _sv = 1092 - _sw = 1093 - _ta = 1104 - _te = 1121 - _th = 1131 - _tl = 1146 - _tn = 1152 - _tr = 1162 - _uk = 1198 - _ur = 1204 - _uz = 1212 - _vi = 1219 - _zh = 1321 - _zu = 1327 - _jbo = 515 - _ami = 1650 - _bnn = 2357 - _hak = 438 - _tlh = 14467 - _lb = 661 - _nv = 899 - _pwn = 12055 - _tao = 14188 - _tay = 14198 - _tsu = 14662 - _nn = 874 - _sfb = 13629 - _vgt = 15701 - _sgg = 13660 - _cmn = 3007 - _nan = 835 - _hsn = 467 -) - -const langPrivateStart = 0x2f72 - -const langPrivateEnd = 0x3179 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5324 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cmg\x00cooscop\x00cps\x00crrecrh\x00cr" + - "j\x00crk\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymda" + - "andad\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00" + - "ddn\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia" + - "\x00dje\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm" + - "\x00dtp\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00d" + - "yo\x00dyu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00el" + - "llema\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr" + - "\x00ett\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai" + - "\x00fan\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00" + - "foaofod\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00f" + - "ub\x00fud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyr" + - "ygalegaa\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gba" + - "\x00gbf\x00gbm\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00g" + - "ej\x00gel\x00gez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju" + - "\x00gkn\x00gkp\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof" + - "\x00goi\x00gom\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw" + - "\x00gsw\x00guujgub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf" + - "\x00gvr\x00gvs\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00h" + - "aw\x00haz\x00hbb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hi" + - "l\x00hla\x00hlu\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homo" + - "hoc\x00hoj\x00hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian" + - "\x00iar\x00iba\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00i" + - "eleife\x00igboigb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00i" + - "lo\x00imo\x00inndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00i" + - "ws\x00izh\x00izi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo" + - "\x00ji\x00\x06jib\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab" + - "\x00kac\x00kad\x00kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq" + - "\x00kbx\x00kby\x00kcg\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt" + - "\x00kea\x00ken\x00kez\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00k" + - "ha\x00khb\x00khn\x00khq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu" + - "\x00kiw\x00kjuakjd\x00kjg\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00" + - "klq\x00klt\x00klx\x00kmhmkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knank" + - "nf\x00knp\x00koorkoi\x00kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo" + - "\x00kpr\x00kpx\x00kqb\x00kqf\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00k" + - "rl\x00krs\x00kru\x00ksasksb\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb" + - "\x00ktm\x00kto\x00kuurkub\x00kud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00k" + - "us\x00kvomkvg\x00kvr\x00kvx\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm" + - "\x00kxp\x00kxw\x00kxz\x00kyirkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag" + - "\x00lah\x00laj\x00las\x00lbtzlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00l" + - "ed\x00lee\x00lem\x00lep\x00leq\x00leu\x00lez\x00lguglgg\x00liimlia\x00li" + - "d\x00lif\x00lig\x00lih\x00lij\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln" + - "\x00lmn\x00lmo\x00lmp\x00lninlns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor" + - "\x00los\x00loz\x00lrc\x00ltitltg\x00luublua\x00luo\x00luy\x00luz\x00lvav" + - "lwl\x00lzh\x00lzz\x00mad\x00maf\x00mag\x00mai\x00mak\x00man\x00mas\x00ma" + - "w\x00maz\x00mbh\x00mbo\x00mbq\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr" + - "\x00mcu\x00mda\x00mde\x00mdf\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee" + - "\x00mek\x00men\x00mer\x00met\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq" + - "\x00mglgmgh\x00mgl\x00mgo\x00mgp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00" + - "min\x00mis\x00miw\x00mkkdmki\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00m" + - "ls\x00mmo\x00mmu\x00mmx\x00mnonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00mo" + - "e\x00moh\x00mos\x00mox\x00mpp\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00" + - "mrj\x00mro\x00mssamtltmtc\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00m" + - "us\x00mva\x00mvn\x00mvy\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk" + - "\x00mym\x00myv\x00myw\x00myx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw" + - "\x00mzz\x00naaunac\x00naf\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00n" + - "bobnca\x00nce\x00ncf\x00nch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb" + - "\x00new\x00nex\x00nfr\x00ngdonga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00n" + - "if\x00nii\x00nij\x00nin\x00niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nll" + - "dnmg\x00nmz\x00nnnonnf\x00nnh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00" + - "nop\x00nou\x00nqo\x00nrblnrb\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr" + - "\x00nui\x00nup\x00nus\x00nuv\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym" + - "\x00nyn\x00nzi\x00occiogc\x00ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00" + - "opm\x00orrioro\x00oru\x00osssosa\x00ota\x00otk\x00ozm\x00paanpag\x00pal" + - "\x00pam\x00pap\x00pau\x00pbi\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo" + - "\x00pex\x00pfl\x00phl\x00phn\x00pilipil\x00pip\x00pka\x00pko\x00plolpla" + - "\x00pms\x00png\x00pnn\x00pnt\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psusp" + - "ss\x00ptorptp\x00puu\x00pwa\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rc" + - "f\x00rej\x00rel\x00res\x00rgn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmoh" + - "rmf\x00rmo\x00rmt\x00rmu\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00r" + - "ro\x00rtm\x00ruusrue\x00rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf" + - "\x00sah\x00saq\x00sas\x00sat\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrds" + - "ck\x00scl\x00scn\x00sco\x00scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00se" + - "i\x00ses\x00sgagsga\x00sgs\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn" + - "\x00shu\x00siinsid\x00sig\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks" + - "\x00sllvsld\x00sli\x00sll\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp" + - "\x00smq\x00sms\x00snnasnc\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq" + - "\x00sou\x00soy\x00spd\x00spl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx" + - "\x00ssswssd\x00ssg\x00ssy\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00" + - "sur\x00sus\x00svweswwaswb\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00s" + - "yl\x00syr\x00szl\x00taamtaj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf" + - "\x00tbg\x00tbo\x00tbw\x00tbz\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelt" + - "ed\x00tem\x00teo\x00tet\x00tfi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00th" + - "q\x00thr\x00tiirtif\x00tig\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr" + - "\x00tkt\x00tlgltlf\x00tlx\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00" + - "tog\x00toq\x00tpi\x00tpm\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssot" + - "sd\x00tsf\x00tsg\x00tsj\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts" + - "\x00ttt\x00tuh\x00tul\x00tum\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00t" + - "wq\x00txg\x00tyahtya\x00tyv\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli" + - "\x00umb\x00und\x00unr\x00unx\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00u" + - "vh\x00uvl\x00uzzbvag\x00vai\x00van\x00veenvec\x00vep\x00viievic\x00viv" + - "\x00vls\x00vmf\x00vmw\x00voolvot\x00vro\x00vun\x00vut\x00walnwae\x00waj" + - "\x00wal\x00wan\x00war\x00wbp\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg" + - "\x00wib\x00wiu\x00wiv\x00wja\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu" + - "\x00woolwob\x00wos\x00wrs\x00wsk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00x" + - "bi\x00xcr\x00xes\x00xhhoxla\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna" + - "\x00xnr\x00xog\x00xon\x00xpr\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe" + - "\x00yam\x00yao\x00yap\x00yas\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb" + - "\x00yby\x00yer\x00ygr\x00ygw\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00y" + - "ooryon\x00yrb\x00yre\x00yrl\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw" + - "\x00zahazag\x00zbl\x00zdj\x00zea\x00zgh\x00zhhozhx\x00zia\x00zlm\x00zmi" + - "\x00zne\x00zuulzxx\x00zza\x00\xff\xff\xff\xff" - -const langNoIndexOffset = 1330 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, - 0x05, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, - 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, - 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, - 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7a, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xdf, 0xe0, 0xdf, - 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe7, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, - 0x86, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, - 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8f, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x06, 0xc4, - // Entry 480 - 4BF - 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x98, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x92, 0xf1, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0xcc, 0x58, 0xd5, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, - 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xb0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, - 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x01, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, - 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x21, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x0281, 0x0407, 0x01fb, 0x03e5, 0x013e, 0x0208, -} - -// langAliasMap maps langIDs to their suggested replacements. -// Size: 656 bytes, 164 elements -var langAliasMap = [164]fromTo{ - 0: {from: 0x82, to: 0x88}, - 1: {from: 0x187, to: 0x1ae}, - 2: {from: 0x1f3, to: 0x1e1}, - 3: {from: 0x1fb, to: 0x1bc}, - 4: {from: 0x208, to: 0x512}, - 5: {from: 0x20f, to: 0x20e}, - 6: {from: 0x310, to: 0x3dc}, - 7: {from: 0x347, to: 0x36f}, - 8: {from: 0x407, to: 0x432}, - 9: {from: 0x47a, to: 0x153}, - 10: {from: 0x490, to: 0x451}, - 11: {from: 0x4a2, to: 0x21}, - 12: {from: 0x53e, to: 0x544}, - 13: {from: 0x58f, to: 0x12d}, - 14: {from: 0x630, to: 0x1eb1}, - 15: {from: 0x651, to: 0x431}, - 16: {from: 0x662, to: 0x431}, - 17: {from: 0x6ed, to: 0x3a}, - 18: {from: 0x6f8, to: 0x1d7}, - 19: {from: 0x73e, to: 0x21a1}, - 20: {from: 0x7b3, to: 0x56}, - 21: {from: 0x7b9, to: 0x299b}, - 22: {from: 0x7c5, to: 0x58}, - 23: {from: 0x7e6, to: 0x145}, - 24: {from: 0x80c, to: 0x5a}, - 25: {from: 0x815, to: 0x8d}, - 26: {from: 0x87e, to: 0x810}, - 27: {from: 0x8c3, to: 0xee3}, - 28: {from: 0x9ef, to: 0x331}, - 29: {from: 0xa36, to: 0x2c5}, - 30: {from: 0xa3d, to: 0xbf}, - 31: {from: 0xabe, to: 0x3322}, - 32: {from: 0xb38, to: 0x529}, - 33: {from: 0xb75, to: 0x265a}, - 34: {from: 0xb7e, to: 0xbc3}, - 35: {from: 0xb9b, to: 0x44e}, - 36: {from: 0xbbc, to: 0x4229}, - 37: {from: 0xbbf, to: 0x529}, - 38: {from: 0xbfe, to: 0x2da7}, - 39: {from: 0xc2e, to: 0x3181}, - 40: {from: 0xcb9, to: 0xf3}, - 41: {from: 0xd08, to: 0xfa}, - 42: {from: 0xdc8, to: 0x11a}, - 43: {from: 0xdd7, to: 0x32d}, - 44: {from: 0xdf8, to: 0xdfb}, - 45: {from: 0xdfe, to: 0x531}, - 46: {from: 0xedf, to: 0x205a}, - 47: {from: 0xeee, to: 0x2e9a}, - 48: {from: 0xf39, to: 0x367}, - 49: {from: 0x10d0, to: 0x140}, - 50: {from: 0x1104, to: 0x2d0}, - 51: {from: 0x11a0, to: 0x1ec}, - 52: {from: 0x1279, to: 0x21}, - 53: {from: 0x1424, to: 0x15e}, - 54: {from: 0x1470, to: 0x14e}, - 55: {from: 0x151f, to: 0xd9b}, - 56: {from: 0x1523, to: 0x390}, - 57: {from: 0x1532, to: 0x19f}, - 58: {from: 0x1580, to: 0x210}, - 59: {from: 0x1583, to: 0x10d}, - 60: {from: 0x15a3, to: 0x3caf}, - 61: {from: 0x166a, to: 0x19b}, - 62: {from: 0x16c8, to: 0x136}, - 63: {from: 0x1700, to: 0x29f8}, - 64: {from: 0x1718, to: 0x194}, - 65: {from: 0x1727, to: 0xf3f}, - 66: {from: 0x177a, to: 0x178}, - 67: {from: 0x1809, to: 0x17b6}, - 68: {from: 0x1816, to: 0x18f3}, - 69: {from: 0x188a, to: 0x436}, - 70: {from: 0x1979, to: 0x1d01}, - 71: {from: 0x1a74, to: 0x2bb0}, - 72: {from: 0x1a8a, to: 0x1f8}, - 73: {from: 0x1b5a, to: 0x1fa}, - 74: {from: 0x1b86, to: 0x1515}, - 75: {from: 0x1d64, to: 0x2c9b}, - 76: {from: 0x2038, to: 0x37b1}, - 77: {from: 0x203d, to: 0x20dd}, - 78: {from: 0x205a, to: 0x30b}, - 79: {from: 0x20e3, to: 0x274}, - 80: {from: 0x20ee, to: 0x263}, - 81: {from: 0x20f2, to: 0x22d}, - 82: {from: 0x20f9, to: 0x256}, - 83: {from: 0x210f, to: 0x21eb}, - 84: {from: 0x2135, to: 0x27d}, - 85: {from: 0x2160, to: 0x913}, - 86: {from: 0x2199, to: 0x121}, - 87: {from: 0x21ce, to: 0x1561}, - 88: {from: 0x21e6, to: 0x504}, - 89: {from: 0x21f4, to: 0x49f}, - 90: {from: 0x222d, to: 0x121}, - 91: {from: 0x2237, to: 0x121}, - 92: {from: 0x2262, to: 0x92a}, - 93: {from: 0x2316, to: 0x3226}, - 94: {from: 0x2382, to: 0x3365}, - 95: {from: 0x2472, to: 0x2c7}, - 96: {from: 0x24e4, to: 0x2ff}, - 97: {from: 0x24f0, to: 0x2fa}, - 98: {from: 0x24fa, to: 0x31f}, - 99: {from: 0x2550, to: 0xb5b}, - 100: {from: 0x25a9, to: 0xe2}, - 101: {from: 0x263e, to: 0x2d0}, - 102: {from: 0x26c9, to: 0x26b4}, - 103: {from: 0x26f9, to: 0x3c8}, - 104: {from: 0x2727, to: 0x3caf}, - 105: {from: 0x2765, to: 0x26b4}, - 106: {from: 0x2789, to: 0x4358}, - 107: {from: 0x28ef, to: 0x2837}, - 108: {from: 0x2914, to: 0x351}, - 109: {from: 0x2986, to: 0x2da7}, - 110: {from: 0x2b1a, to: 0x38d}, - 111: {from: 0x2bfc, to: 0x395}, - 112: {from: 0x2c3f, to: 0x3caf}, - 113: {from: 0x2cfc, to: 0x3be}, - 114: {from: 0x2d13, to: 0x597}, - 115: {from: 0x2d47, to: 0x148}, - 116: {from: 0x2d48, to: 0x148}, - 117: {from: 0x2dff, to: 0x2f1}, - 118: {from: 0x2e08, to: 0x19cc}, - 119: {from: 0x2e1a, to: 0x2d95}, - 120: {from: 0x2e21, to: 0x292}, - 121: {from: 0x2e54, to: 0x7d}, - 122: {from: 0x2e65, to: 0x2282}, - 123: {from: 0x2ea0, to: 0x2e9b}, - 124: {from: 0x2eef, to: 0x2ed7}, - 125: {from: 0x3193, to: 0x3c4}, - 126: {from: 0x3366, to: 0x338e}, - 127: {from: 0x342a, to: 0x3dc}, - 128: {from: 0x34ee, to: 0x18d0}, - 129: {from: 0x35c8, to: 0x2c9b}, - 130: {from: 0x35e6, to: 0x412}, - 131: {from: 0x3658, to: 0x246}, - 132: {from: 0x3676, to: 0x3f4}, - 133: {from: 0x36fd, to: 0x445}, - 134: {from: 0x37c0, to: 0x121}, - 135: {from: 0x3816, to: 0x38f2}, - 136: {from: 0x382b, to: 0x2c9b}, - 137: {from: 0x382f, to: 0xa9}, - 138: {from: 0x3832, to: 0x3228}, - 139: {from: 0x386c, to: 0x39a6}, - 140: {from: 0x3892, to: 0x3fc0}, - 141: {from: 0x38a5, to: 0x39d7}, - 142: {from: 0x38b4, to: 0x1fa4}, - 143: {from: 0x38b5, to: 0x2e9a}, - 144: {from: 0x395c, to: 0x47e}, - 145: {from: 0x3b4e, to: 0xd91}, - 146: {from: 0x3b78, to: 0x137}, - 147: {from: 0x3c99, to: 0x4bc}, - 148: {from: 0x3fbd, to: 0x100}, - 149: {from: 0x4208, to: 0xa91}, - 150: {from: 0x42be, to: 0x573}, - 151: {from: 0x42f9, to: 0x3f60}, - 152: {from: 0x4378, to: 0x25a}, - 153: {from: 0x43cb, to: 0x36cb}, - 154: {from: 0x43cd, to: 0x10f}, - 155: {from: 0x44af, to: 0x3322}, - 156: {from: 0x44e3, to: 0x512}, - 157: {from: 0x45ca, to: 0x2409}, - 158: {from: 0x45dd, to: 0x26dc}, - 159: {from: 0x4610, to: 0x48ae}, - 160: {from: 0x46ae, to: 0x46a0}, - 161: {from: 0x473e, to: 0x4745}, - 162: {from: 0x4916, to: 0x31f}, - 163: {from: 0x49a7, to: 0x523}, -} - -// Size: 164 bytes, 164 elements -var langAliasTypes = [164]langAliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, - 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, - 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, - // Entry 40 - 7F - 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 0, 1, 1, - 1, 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, - 2, 2, 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, - 0, 1, 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, - // Entry 80 - BF - 0, 0, 2, 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, - 1, 1, 0, 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, - 0, 1, 1, 1, -} - -const ( - _Latn = 87 - _Hani = 54 - _Hans = 56 - _Hant = 57 - _Qaaa = 139 - _Qaai = 147 - _Qabx = 188 - _Zinh = 236 - _Zyyy = 241 - _Zzzz = 242 + _mul = 806 + _und = 0 ) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 976 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCpmnCprtCyrlCyrsDevaDogrDsrt" + - "DuplEgydEgyhEgypElbaEthiGeokGeorGlagGongGonmGothGranGrekGujrGuruHanbHang" + - "HaniHanoHansHantHatrHebrHiraHluwHmngHmnpHrktHungIndsItalJamoJavaJpanJurc" + - "KaliKanaKharKhmrKhojKitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepc" + - "LimbLinaLinbLisuLomaLyciLydiMahjMakaMandManiMarcMayaMedfMendMercMeroMlym" + - "ModiMongMoonMrooMteiMultMymrNarbNbatNewaNkdbNkgbNkooNshuOgamOlckOrkhOrya" + - "OsgeOsmaPalmPaucPermPhagPhliPhlpPhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaae" + - "QaafQaagQaahQaaiQaajQaakQaalQaamQaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaaw" + - "QaaxQaayQaazQabaQabbQabcQabdQabeQabfQabgQabhQabiQabjQabkQablQabmQabnQabo" + - "QabpQabqQabrQabsQabtQabuQabvQabwQabxRjngRoroRunrSamrSaraSarbSaurSgnwShaw" + - "ShrdShuiSiddSindSinhSoraSoyoSundSyloSyrcSyreSyrjSyrnTagbTakrTaleTaluTaml" + - "TangTavtTeluTengTfngTglgThaaThaiTibtTirhUgarVaiiVispWaraWchoWoleXpeoXsux" + - "YiiiZanbZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1330 bytes, 1330 elements -var suppressScript = [1330]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x1f, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xde, 0x00, 0x00, 0x00, 0x00, 0xe0, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x31, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x57, 0x00, - // Entry 140 - 17F - 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x57, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x32, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x3b, 0x00, 0x21, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x57, 0x00, 0x57, 0x57, 0x00, 0x08, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x57, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, - // Entry 200 - 23F - 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x2b, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x4b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x4f, 0x00, 0x00, 0x50, 0x00, 0x21, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x54, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 2C0 - 2FF - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x21, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, - // Entry 300 - 33F - 0x00, 0x00, 0x00, 0x00, 0x6b, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x21, 0x00, 0x00, 0x00, 0x57, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x72, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x57, 0x21, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x78, 0x57, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x7d, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x33, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, - // Entry 3C0 - 3FF - 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x1f, 0x00, 0x00, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0xca, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x00, 0x00, 0x57, 0x57, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0xd7, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xda, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0xdf, 0x00, 0x00, 0x00, 0x29, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - // Entry 480 - 4BF - 0x57, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x57, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 4C0 - 4FF - 0x57, 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x57, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x3b, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x57, - 0x00, 0x00, -} - const ( _001 = 1 _419 = 31 @@ -1009,2290 +34,20 @@ const ( _XC = 325 _XK = 333 ) +const ( + _Latn = 87 + _Hani = 54 + _Hans = 56 + _Hant = 57 + _Qaaa = 139 + _Qaai = 147 + _Qabx = 188 + _Zinh = 236 + _Zyyy = 241 + _Zzzz = 242 +) -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 32 - -// regionTypes defines the status of a region for various standards. -// Size: 358 bytes, 358 elements -var regionTypes = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, - 0x06, 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0057, 0x0070, 0x0088, 0x00a8, 0x00aa, 0x00ad, 0x00ea, 0x0105, - 0x0121, 0x015f, 0x00dc, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]fromTo{ - 0: {from: 0x44, to: 0xc4}, - 1: {from: 0x58, to: 0xa7}, - 2: {from: 0x5f, to: 0x60}, - 3: {from: 0x66, to: 0x3b}, - 4: {from: 0x79, to: 0x78}, - 5: {from: 0x93, to: 0x37}, - 6: {from: 0xa3, to: 0x133}, - 7: {from: 0xc1, to: 0x133}, - 8: {from: 0xd7, to: 0x13f}, - 9: {from: 0xdc, to: 0x2b}, - 10: {from: 0xef, to: 0x133}, - 11: {from: 0xf2, to: 0xe2}, - 12: {from: 0xfc, to: 0x70}, - 13: {from: 0x103, to: 0x164}, - 14: {from: 0x12a, to: 0x126}, - 15: {from: 0x132, to: 0x7b}, - 16: {from: 0x13a, to: 0x13e}, - 17: {from: 0x141, to: 0x133}, - 18: {from: 0x15d, to: 0x15e}, - 19: {from: 0x163, to: 0x4b}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 716 bytes, 358 elements -var m49 = [358]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 202, 419, - 958, 0, 20, 784, 4, 28, 660, 8, - 51, 530, 24, 10, 32, 16, 40, 36, - 533, 248, 31, 70, 52, 50, 56, 854, - 100, 48, 108, 204, 652, 60, 96, 68, - // Entry 40 - 7F - 535, 76, 44, 64, 104, 74, 72, 112, - 84, 124, 166, 180, 140, 178, 756, 384, - 184, 152, 120, 156, 170, 0, 188, 891, - 296, 192, 132, 531, 162, 196, 203, 278, - 276, 0, 262, 208, 212, 214, 204, 12, - 0, 218, 233, 818, 732, 232, 724, 231, - 967, 0, 246, 242, 238, 583, 234, 0, - 250, 249, 266, 826, 308, 268, 254, 831, - // Entry 80 - BF - 288, 292, 304, 270, 324, 312, 226, 300, - 239, 320, 316, 624, 328, 344, 334, 340, - 191, 332, 348, 854, 0, 360, 372, 376, - 833, 356, 86, 368, 364, 352, 380, 832, - 388, 400, 392, 581, 404, 417, 116, 296, - 174, 659, 408, 410, 414, 136, 398, 418, - 422, 662, 438, 144, 430, 426, 440, 442, - 428, 434, 504, 492, 498, 499, 663, 450, - // Entry C0 - FF - 584, 581, 807, 466, 104, 496, 446, 580, - 474, 478, 500, 470, 480, 462, 454, 484, - 458, 508, 516, 540, 562, 574, 566, 548, - 558, 528, 578, 524, 10, 520, 536, 570, - 554, 512, 591, 0, 604, 258, 598, 608, - 586, 616, 666, 612, 630, 275, 620, 581, - 585, 600, 591, 634, 959, 960, 961, 962, - 963, 964, 965, 966, 967, 968, 969, 970, - // Entry 100 - 13F - 971, 972, 638, 716, 642, 688, 643, 646, - 682, 90, 690, 729, 752, 702, 654, 705, - 744, 703, 694, 674, 686, 706, 740, 728, - 678, 810, 222, 534, 760, 748, 0, 796, - 148, 260, 768, 764, 762, 772, 626, 795, - 788, 776, 626, 792, 780, 798, 158, 834, - 804, 800, 826, 581, 0, 840, 858, 860, - 336, 670, 704, 862, 92, 850, 704, 548, - // Entry 140 - 17F - 876, 581, 882, 973, 974, 975, 976, 977, - 978, 979, 980, 981, 982, 983, 984, 985, - 986, 987, 988, 989, 990, 991, 992, 993, - 994, 995, 996, 997, 998, 720, 887, 175, - 891, 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 108, 143, 181, 220, 259, 291, - 333, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 666 bytes, 333 elements -var fromM49 = [333]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0824, 0x0a04, 0x1027, 0x1205, 0x142b, - 0x1606, 0x1867, 0x1a07, 0x1c08, 0x1e09, 0x202d, 0x220a, 0x240b, - 0x260c, 0x2822, 0x2a0d, 0x302a, 0x3825, 0x3a0e, 0x3c0f, 0x3e32, - 0x402c, 0x4410, 0x4611, 0x482f, 0x4e12, 0x502e, 0x5842, 0x6039, - 0x6435, 0x6628, 0x6834, 0x6a13, 0x6c14, 0x7036, 0x7215, 0x783d, - 0x7a16, 0x8043, 0x883f, 0x8c33, 0x9046, 0x9445, 0x9841, 0xa848, - 0xac9a, 0xb509, 0xb93c, 0xc03e, 0xc838, 0xd0c4, 0xd83a, 0xe047, - 0xe8a6, 0xf052, 0xf849, 0x085a, 0x10ad, 0x184c, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b3, 0x2219, 0x2920, 0x2c1a, 0x2e1b, 0x3051, 0x341c, 0x361d, - 0x3853, 0x3d2e, 0x445c, 0x4c4a, 0x5454, 0x5ca8, 0x5f5f, 0x644d, - 0x684b, 0x7050, 0x7856, 0x7e90, 0x8059, 0x885d, 0x941e, 0x965e, - 0x983b, 0xa063, 0xa864, 0xac65, 0xb469, 0xbd1a, 0xc486, 0xcc6f, - 0xce6f, 0xd06d, 0xd26a, 0xd476, 0xdc74, 0xde88, 0xe473, 0xec72, - 0xf031, 0xf279, 0xf478, 0xfc7e, 0x04e5, 0x0921, 0x0c62, 0x147a, - 0x187d, 0x1c83, 0x26ed, 0x2860, 0x2c5f, 0x3060, 0x4080, 0x4881, - 0x50a7, 0x5887, 0x6082, 0x687c, 0x7085, 0x788a, 0x8089, 0x8884, - // Entry 80 - BF - 0x908c, 0x9891, 0x9c8e, 0xa138, 0xa88f, 0xb08d, 0xb892, 0xc09d, - 0xc899, 0xd095, 0xd89c, 0xe09b, 0xe896, 0xf097, 0xf89e, 0x004f, - 0x08a0, 0x10a2, 0x1cae, 0x20a1, 0x28a4, 0x30aa, 0x34ab, 0x3cac, - 0x42a5, 0x44af, 0x461f, 0x4cb0, 0x54b5, 0x58b8, 0x5cb4, 0x64b9, - 0x6cb2, 0x70b6, 0x74b7, 0x7cc6, 0x84bf, 0x8cce, 0x94d0, 0x9ccd, - 0xa4c3, 0xaccb, 0xb4c8, 0xbcc9, 0xc0cc, 0xc8cf, 0xd8bb, 0xe0c5, - 0xe4bc, 0xe6bd, 0xe8ca, 0xf0ba, 0xf8d1, 0x00e1, 0x08d2, 0x10dd, - 0x18db, 0x20d9, 0x2429, 0x265b, 0x2a30, 0x2d1b, 0x2e40, 0x30de, - // Entry C0 - FF - 0x38d3, 0x493f, 0x54e0, 0x5cd8, 0x64d4, 0x6cd6, 0x74df, 0x7cd5, - 0x84da, 0x88c7, 0x8b33, 0x8e75, 0x90c0, 0x92f0, 0x94e8, 0x9ee2, - 0xace6, 0xb0f1, 0xb8e4, 0xc0e7, 0xc8eb, 0xd0e9, 0xd8ee, 0xe08b, - 0xe526, 0xecec, 0xf4f3, 0xfd02, 0x0504, 0x0706, 0x0d07, 0x183c, - 0x1d0e, 0x26a9, 0x2826, 0x2cb1, 0x2ebe, 0x34ea, 0x3d39, 0x4513, - 0x4d18, 0x5508, 0x5d14, 0x6105, 0x650a, 0x6d12, 0x7d0d, 0x7f11, - 0x813e, 0x830f, 0x8515, 0x8d61, 0x9964, 0xa15d, 0xa86e, 0xb117, - 0xb30b, 0xb86c, 0xc10b, 0xc916, 0xd110, 0xd91d, 0xe10c, 0xe84e, - // Entry 100 - 13F - 0xf11c, 0xf524, 0xf923, 0x0122, 0x0925, 0x1129, 0x192c, 0x2023, - 0x2928, 0x312b, 0x3727, 0x391f, 0x3d2d, 0x4131, 0x4930, 0x4ec2, - 0x5519, 0x646b, 0x747b, 0x7e7f, 0x809f, 0x8298, 0x852f, 0x9135, - 0xa53d, 0xac37, 0xb536, 0xb937, 0xbd3b, 0xd940, 0xe542, 0xed5e, - 0xef5e, 0xf657, 0xfd62, 0x7c20, 0x7ef4, 0x80f5, 0x82f6, 0x84f7, - 0x86f8, 0x88f9, 0x8afa, 0x8cfb, 0x8e70, 0x90fd, 0x92fe, 0x94ff, - 0x9700, 0x9901, 0x9b43, 0x9d44, 0x9f45, 0xa146, 0xa347, 0xa548, - 0xa749, 0xa94a, 0xab4b, 0xad4c, 0xaf4d, 0xb14e, 0xb34f, 0xb550, - // Entry 140 - 17F - 0xb751, 0xb952, 0xbb53, 0xbd54, 0xbf55, 0xc156, 0xc357, 0xc558, - 0xc759, 0xc95a, 0xcb5b, 0xcd5c, 0xcf65, -} - -// Size: 1615 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x4d, - "1996": 0x4, - "abl1943": 0x5, - "akuapem": 0x6, - "alalc97": 0x4f, - "aluku": 0x7, - "ao1990": 0x8, - "arevela": 0x9, - "arevmda": 0xa, - "asante": 0xb, - "baku1926": 0xc, - "balanka": 0xd, - "barla": 0xe, - "basiceng": 0xf, - "bauddha": 0x10, - "biscayan": 0x11, - "biske": 0x48, - "bohoric": 0x12, - "boont": 0x13, - "colb1945": 0x14, - "cornu": 0x15, - "dajnko": 0x16, - "ekavsk": 0x17, - "emodeng": 0x18, - "fonipa": 0x50, - "fonnapa": 0x51, - "fonupa": 0x52, - "fonxsamp": 0x53, - "hepburn": 0x19, - "heploc": 0x4e, - "hognorsk": 0x1a, - "hsistemo": 0x1b, - "ijekavsk": 0x1c, - "itihasa": 0x1d, - "jauer": 0x1e, - "jyutping": 0x1f, - "kkcor": 0x20, - "kociewie": 0x21, - "kscor": 0x22, - "laukika": 0x23, - "lipaw": 0x49, - "luna1918": 0x24, - "metelko": 0x25, - "monoton": 0x26, - "ndyuka": 0x27, - "nedis": 0x28, - "newfound": 0x29, - "njiva": 0x4a, - "nulik": 0x2a, - "osojs": 0x4b, - "oxendict": 0x2b, - "pahawh2": 0x2c, - "pahawh3": 0x2d, - "pahawh4": 0x2e, - "pamaka": 0x2f, - "petr1708": 0x30, - "pinyin": 0x31, - "polyton": 0x32, - "puter": 0x33, - "rigik": 0x34, - "rozaj": 0x35, - "rumgr": 0x36, - "scotland": 0x37, - "scouse": 0x38, - "simple": 0x54, - "solba": 0x4c, - "sotav": 0x39, - "spanglis": 0x3a, - "surmiran": 0x3b, - "sursilv": 0x3c, - "sutsilv": 0x3d, - "tarask": 0x3e, - "uccor": 0x3f, - "ucrcor": 0x40, - "ulster": 0x41, - "unifon": 0x42, - "vaidika": 0x43, - "valencia": 0x44, - "vallader": 0x45, - "wadegile": 0x46, - "xsistemo": 0x47, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 79 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 33 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 976 bytes, 244 elements -var likelyScript = [244]likelyLangRegion{ - 1: {lang: 0x14e, region: 0x84}, - 3: {lang: 0x2a2, region: 0x106}, - 4: {lang: 0x1f, region: 0x99}, - 5: {lang: 0x3a, region: 0x6b}, - 7: {lang: 0x3b, region: 0x9c}, - 8: {lang: 0x1d7, region: 0x28}, - 9: {lang: 0x13, region: 0x9c}, - 10: {lang: 0x5b, region: 0x95}, - 11: {lang: 0x60, region: 0x52}, - 12: {lang: 0xb9, region: 0xb4}, - 13: {lang: 0x63, region: 0x95}, - 14: {lang: 0xa5, region: 0x35}, - 15: {lang: 0x3e9, region: 0x99}, - 17: {lang: 0x529, region: 0x12e}, - 18: {lang: 0x3b1, region: 0x99}, - 19: {lang: 0x15e, region: 0x78}, - 20: {lang: 0xc2, region: 0x95}, - 21: {lang: 0x9d, region: 0xe7}, - 22: {lang: 0xdb, region: 0x35}, - 23: {lang: 0xf3, region: 0x49}, - 24: {lang: 0x4f0, region: 0x12b}, - 25: {lang: 0xe7, region: 0x13e}, - 26: {lang: 0xe5, region: 0x135}, - 28: {lang: 0xf1, region: 0x6b}, - 30: {lang: 0x1a0, region: 0x5d}, - 31: {lang: 0x3e2, region: 0x106}, - 33: {lang: 0x1be, region: 0x99}, - 36: {lang: 0x15e, region: 0x78}, - 39: {lang: 0x133, region: 0x6b}, - 40: {lang: 0x431, region: 0x27}, - 41: {lang: 0x27, region: 0x6f}, - 43: {lang: 0x210, region: 0x7d}, - 44: {lang: 0xfe, region: 0x38}, - 46: {lang: 0x19b, region: 0x99}, - 47: {lang: 0x19e, region: 0x130}, - 48: {lang: 0x3e9, region: 0x99}, - 49: {lang: 0x136, region: 0x87}, - 50: {lang: 0x1a4, region: 0x99}, - 51: {lang: 0x39d, region: 0x99}, - 52: {lang: 0x529, region: 0x12e}, - 53: {lang: 0x254, region: 0xab}, - 54: {lang: 0x529, region: 0x53}, - 55: {lang: 0x1cb, region: 0xe7}, - 56: {lang: 0x529, region: 0x53}, - 57: {lang: 0x529, region: 0x12e}, - 58: {lang: 0x2fd, region: 0x9b}, - 59: {lang: 0x1bc, region: 0x97}, - 60: {lang: 0x200, region: 0xa2}, - 61: {lang: 0x1c5, region: 0x12b}, - 62: {lang: 0x1ca, region: 0xaf}, - 65: {lang: 0x1d5, region: 0x92}, - 67: {lang: 0x142, region: 0x9e}, - 68: {lang: 0x254, region: 0xab}, - 69: {lang: 0x20e, region: 0x95}, - 70: {lang: 0x200, region: 0xa2}, - 72: {lang: 0x135, region: 0xc4}, - 73: {lang: 0x200, region: 0xa2}, - 74: {lang: 0x3bb, region: 0xe8}, - 75: {lang: 0x24a, region: 0xa6}, - 76: {lang: 0x3fa, region: 0x99}, - 79: {lang: 0x251, region: 0x99}, - 80: {lang: 0x254, region: 0xab}, - 82: {lang: 0x88, region: 0x99}, - 83: {lang: 0x370, region: 0x123}, - 84: {lang: 0x2b8, region: 0xaf}, - 89: {lang: 0x29f, region: 0x99}, - 90: {lang: 0x2a8, region: 0x99}, - 91: {lang: 0x28f, region: 0x87}, - 92: {lang: 0x1a0, region: 0x87}, - 93: {lang: 0x2ac, region: 0x53}, - 95: {lang: 0x4f4, region: 0x12b}, - 96: {lang: 0x4f5, region: 0x12b}, - 97: {lang: 0x1be, region: 0x99}, - 99: {lang: 0x337, region: 0x9c}, - 100: {lang: 0x4f7, region: 0x53}, - 101: {lang: 0xa9, region: 0x53}, - 104: {lang: 0x2e8, region: 0x112}, - 105: {lang: 0x4f8, region: 0x10b}, - 106: {lang: 0x4f8, region: 0x10b}, - 107: {lang: 0x304, region: 0x99}, - 108: {lang: 0x31b, region: 0x99}, - 109: {lang: 0x30b, region: 0x53}, - 111: {lang: 0x31e, region: 0x35}, - 112: {lang: 0x30e, region: 0x99}, - 113: {lang: 0x414, region: 0xe8}, - 114: {lang: 0x331, region: 0xc4}, - 115: {lang: 0x4f9, region: 0x108}, - 116: {lang: 0x3b, region: 0xa1}, - 117: {lang: 0x353, region: 0xdb}, - 120: {lang: 0x2d0, region: 0x84}, - 121: {lang: 0x52a, region: 0x53}, - 122: {lang: 0x403, region: 0x96}, - 123: {lang: 0x3ee, region: 0x99}, - 124: {lang: 0x39b, region: 0xc5}, - 125: {lang: 0x395, region: 0x99}, - 126: {lang: 0x399, region: 0x135}, - 127: {lang: 0x429, region: 0x115}, - 128: {lang: 0x3b, region: 0x11c}, - 129: {lang: 0xfd, region: 0xc4}, - 130: {lang: 0x27d, region: 0x106}, - 131: {lang: 0x2c9, region: 0x53}, - 132: {lang: 0x39f, region: 0x9c}, - 133: {lang: 0x39f, region: 0x53}, - 135: {lang: 0x3ad, region: 0xb0}, - 137: {lang: 0x1c6, region: 0x53}, - 138: {lang: 0x4fd, region: 0x9c}, - 189: {lang: 0x3cb, region: 0x95}, - 191: {lang: 0x372, region: 0x10c}, - 192: {lang: 0x420, region: 0x97}, - 194: {lang: 0x4ff, region: 0x15e}, - 195: {lang: 0x3f0, region: 0x99}, - 196: {lang: 0x45, region: 0x135}, - 197: {lang: 0x139, region: 0x7b}, - 198: {lang: 0x3e9, region: 0x99}, - 200: {lang: 0x3e9, region: 0x99}, - 201: {lang: 0x3fa, region: 0x99}, - 202: {lang: 0x40c, region: 0xb3}, - 203: {lang: 0x433, region: 0x99}, - 204: {lang: 0xef, region: 0xc5}, - 205: {lang: 0x43e, region: 0x95}, - 206: {lang: 0x44d, region: 0x35}, - 207: {lang: 0x44e, region: 0x9b}, - 211: {lang: 0x45a, region: 0xe7}, - 212: {lang: 0x11a, region: 0x99}, - 213: {lang: 0x45e, region: 0x53}, - 214: {lang: 0x232, region: 0x53}, - 215: {lang: 0x450, region: 0x99}, - 216: {lang: 0x4a5, region: 0x53}, - 217: {lang: 0x9f, region: 0x13e}, - 218: {lang: 0x461, region: 0x99}, - 220: {lang: 0x528, region: 0xba}, - 221: {lang: 0x153, region: 0xe7}, - 222: {lang: 0x128, region: 0xcd}, - 223: {lang: 0x46b, region: 0x123}, - 224: {lang: 0xa9, region: 0x53}, - 225: {lang: 0x2ce, region: 0x99}, - 226: {lang: 0x4ad, region: 0x11c}, - 227: {lang: 0x4be, region: 0xb4}, - 229: {lang: 0x1ce, region: 0x99}, - 232: {lang: 0x3a9, region: 0x9c}, - 233: {lang: 0x22, region: 0x9b}, - 234: {lang: 0x1ea, region: 0x53}, - 235: {lang: 0xef, region: 0xc5}, -} - -type likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 5320 bytes, 1330 elements -var likelyLang = [1330]likelyScriptRegion{ - 0: {region: 0x135, script: 0x57, flags: 0x0}, - 1: {region: 0x6f, script: 0x57, flags: 0x0}, - 2: {region: 0x165, script: 0x57, flags: 0x0}, - 3: {region: 0x165, script: 0x57, flags: 0x0}, - 4: {region: 0x165, script: 0x57, flags: 0x0}, - 5: {region: 0x7d, script: 0x1f, flags: 0x0}, - 6: {region: 0x165, script: 0x57, flags: 0x0}, - 7: {region: 0x165, script: 0x1f, flags: 0x0}, - 8: {region: 0x80, script: 0x57, flags: 0x0}, - 9: {region: 0x165, script: 0x57, flags: 0x0}, - 10: {region: 0x165, script: 0x57, flags: 0x0}, - 11: {region: 0x165, script: 0x57, flags: 0x0}, - 12: {region: 0x95, script: 0x57, flags: 0x0}, - 13: {region: 0x131, script: 0x57, flags: 0x0}, - 14: {region: 0x80, script: 0x57, flags: 0x0}, - 15: {region: 0x165, script: 0x57, flags: 0x0}, - 16: {region: 0x165, script: 0x57, flags: 0x0}, - 17: {region: 0x106, script: 0x1f, flags: 0x0}, - 18: {region: 0x165, script: 0x57, flags: 0x0}, - 19: {region: 0x9c, script: 0x9, flags: 0x0}, - 20: {region: 0x128, script: 0x5, flags: 0x0}, - 21: {region: 0x165, script: 0x57, flags: 0x0}, - 22: {region: 0x161, script: 0x57, flags: 0x0}, - 23: {region: 0x165, script: 0x57, flags: 0x0}, - 24: {region: 0x165, script: 0x57, flags: 0x0}, - 25: {region: 0x165, script: 0x57, flags: 0x0}, - 26: {region: 0x165, script: 0x57, flags: 0x0}, - 27: {region: 0x165, script: 0x57, flags: 0x0}, - 28: {region: 0x52, script: 0x57, flags: 0x0}, - 29: {region: 0x165, script: 0x57, flags: 0x0}, - 30: {region: 0x165, script: 0x57, flags: 0x0}, - 31: {region: 0x99, script: 0x4, flags: 0x0}, - 32: {region: 0x165, script: 0x57, flags: 0x0}, - 33: {region: 0x80, script: 0x57, flags: 0x0}, - 34: {region: 0x9b, script: 0xe9, flags: 0x0}, - 35: {region: 0x165, script: 0x57, flags: 0x0}, - 36: {region: 0x165, script: 0x57, flags: 0x0}, - 37: {region: 0x14d, script: 0x57, flags: 0x0}, - 38: {region: 0x106, script: 0x1f, flags: 0x0}, - 39: {region: 0x6f, script: 0x29, flags: 0x0}, - 40: {region: 0x165, script: 0x57, flags: 0x0}, - 41: {region: 0x165, script: 0x57, flags: 0x0}, - 42: {region: 0xd6, script: 0x57, flags: 0x0}, - 43: {region: 0x165, script: 0x57, flags: 0x0}, - 45: {region: 0x165, script: 0x57, flags: 0x0}, - 46: {region: 0x165, script: 0x57, flags: 0x0}, - 47: {region: 0x165, script: 0x57, flags: 0x0}, - 48: {region: 0x165, script: 0x57, flags: 0x0}, - 49: {region: 0x165, script: 0x57, flags: 0x0}, - 50: {region: 0x165, script: 0x57, flags: 0x0}, - 51: {region: 0x95, script: 0x57, flags: 0x0}, - 52: {region: 0x165, script: 0x5, flags: 0x0}, - 53: {region: 0x122, script: 0x5, flags: 0x0}, - 54: {region: 0x165, script: 0x57, flags: 0x0}, - 55: {region: 0x165, script: 0x57, flags: 0x0}, - 56: {region: 0x165, script: 0x57, flags: 0x0}, - 57: {region: 0x165, script: 0x57, flags: 0x0}, - 58: {region: 0x6b, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x165, script: 0x57, flags: 0x0}, - 61: {region: 0x51, script: 0x57, flags: 0x0}, - 62: {region: 0x3f, script: 0x57, flags: 0x0}, - 63: {region: 0x67, script: 0x5, flags: 0x0}, - 65: {region: 0xba, script: 0x5, flags: 0x0}, - 66: {region: 0x6b, script: 0x5, flags: 0x0}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0x12f, script: 0x57, flags: 0x0}, - 69: {region: 0x135, script: 0xc4, flags: 0x0}, - 70: {region: 0x165, script: 0x57, flags: 0x0}, - 71: {region: 0x165, script: 0x57, flags: 0x0}, - 72: {region: 0x6e, script: 0x57, flags: 0x0}, - 73: {region: 0x165, script: 0x57, flags: 0x0}, - 74: {region: 0x165, script: 0x57, flags: 0x0}, - 75: {region: 0x49, script: 0x57, flags: 0x0}, - 76: {region: 0x165, script: 0x57, flags: 0x0}, - 77: {region: 0x106, script: 0x1f, flags: 0x0}, - 78: {region: 0x165, script: 0x5, flags: 0x0}, - 79: {region: 0x165, script: 0x57, flags: 0x0}, - 80: {region: 0x165, script: 0x57, flags: 0x0}, - 81: {region: 0x165, script: 0x57, flags: 0x0}, - 82: {region: 0x99, script: 0x21, flags: 0x0}, - 83: {region: 0x165, script: 0x57, flags: 0x0}, - 84: {region: 0x165, script: 0x57, flags: 0x0}, - 85: {region: 0x165, script: 0x57, flags: 0x0}, - 86: {region: 0x3f, script: 0x57, flags: 0x0}, - 87: {region: 0x165, script: 0x57, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x106, script: 0x1f, flags: 0x0}, - 90: {region: 0xe8, script: 0x5, flags: 0x0}, - 91: {region: 0x95, script: 0x57, flags: 0x0}, - 92: {region: 0xdb, script: 0x21, flags: 0x0}, - 93: {region: 0x2e, script: 0x57, flags: 0x0}, - 94: {region: 0x52, script: 0x57, flags: 0x0}, - 95: {region: 0x165, script: 0x57, flags: 0x0}, - 96: {region: 0x52, script: 0xb, flags: 0x0}, - 97: {region: 0x165, script: 0x57, flags: 0x0}, - 98: {region: 0x165, script: 0x57, flags: 0x0}, - 99: {region: 0x95, script: 0x57, flags: 0x0}, - 100: {region: 0x165, script: 0x57, flags: 0x0}, - 101: {region: 0x52, script: 0x57, flags: 0x0}, - 102: {region: 0x165, script: 0x57, flags: 0x0}, - 103: {region: 0x165, script: 0x57, flags: 0x0}, - 104: {region: 0x165, script: 0x57, flags: 0x0}, - 105: {region: 0x165, script: 0x57, flags: 0x0}, - 106: {region: 0x4f, script: 0x57, flags: 0x0}, - 107: {region: 0x165, script: 0x57, flags: 0x0}, - 108: {region: 0x165, script: 0x57, flags: 0x0}, - 109: {region: 0x165, script: 0x57, flags: 0x0}, - 110: {region: 0x165, script: 0x29, flags: 0x0}, - 111: {region: 0x165, script: 0x57, flags: 0x0}, - 112: {region: 0x165, script: 0x57, flags: 0x0}, - 113: {region: 0x47, script: 0x1f, flags: 0x0}, - 114: {region: 0x165, script: 0x57, flags: 0x0}, - 115: {region: 0x165, script: 0x57, flags: 0x0}, - 116: {region: 0x10b, script: 0x5, flags: 0x0}, - 117: {region: 0x162, script: 0x57, flags: 0x0}, - 118: {region: 0x165, script: 0x57, flags: 0x0}, - 119: {region: 0x95, script: 0x57, flags: 0x0}, - 120: {region: 0x165, script: 0x57, flags: 0x0}, - 121: {region: 0x12f, script: 0x57, flags: 0x0}, - 122: {region: 0x52, script: 0x57, flags: 0x0}, - 123: {region: 0x99, script: 0xd7, flags: 0x0}, - 124: {region: 0xe8, script: 0x5, flags: 0x0}, - 125: {region: 0x99, script: 0x21, flags: 0x0}, - 126: {region: 0x38, script: 0x1f, flags: 0x0}, - 127: {region: 0x99, script: 0x21, flags: 0x0}, - 128: {region: 0xe8, script: 0x5, flags: 0x0}, - 129: {region: 0x12b, script: 0x31, flags: 0x0}, - 131: {region: 0x99, script: 0x21, flags: 0x0}, - 132: {region: 0x165, script: 0x57, flags: 0x0}, - 133: {region: 0x99, script: 0x21, flags: 0x0}, - 134: {region: 0xe7, script: 0x57, flags: 0x0}, - 135: {region: 0x165, script: 0x57, flags: 0x0}, - 136: {region: 0x99, script: 0x21, flags: 0x0}, - 137: {region: 0x165, script: 0x57, flags: 0x0}, - 138: {region: 0x13f, script: 0x57, flags: 0x0}, - 139: {region: 0x165, script: 0x57, flags: 0x0}, - 140: {region: 0x165, script: 0x57, flags: 0x0}, - 141: {region: 0xe7, script: 0x57, flags: 0x0}, - 142: {region: 0x165, script: 0x57, flags: 0x0}, - 143: {region: 0xd6, script: 0x57, flags: 0x0}, - 144: {region: 0x165, script: 0x57, flags: 0x0}, - 145: {region: 0x165, script: 0x57, flags: 0x0}, - 146: {region: 0x165, script: 0x57, flags: 0x0}, - 147: {region: 0x165, script: 0x29, flags: 0x0}, - 148: {region: 0x99, script: 0x21, flags: 0x0}, - 149: {region: 0x95, script: 0x57, flags: 0x0}, - 150: {region: 0x165, script: 0x57, flags: 0x0}, - 151: {region: 0x165, script: 0x57, flags: 0x0}, - 152: {region: 0x114, script: 0x57, flags: 0x0}, - 153: {region: 0x165, script: 0x57, flags: 0x0}, - 154: {region: 0x165, script: 0x57, flags: 0x0}, - 155: {region: 0x52, script: 0x57, flags: 0x0}, - 156: {region: 0x165, script: 0x57, flags: 0x0}, - 157: {region: 0xe7, script: 0x57, flags: 0x0}, - 158: {region: 0x165, script: 0x57, flags: 0x0}, - 159: {region: 0x13e, script: 0xd9, flags: 0x0}, - 160: {region: 0xc3, script: 0x57, flags: 0x0}, - 161: {region: 0x165, script: 0x57, flags: 0x0}, - 162: {region: 0x165, script: 0x57, flags: 0x0}, - 163: {region: 0xc3, script: 0x57, flags: 0x0}, - 164: {region: 0x165, script: 0x57, flags: 0x0}, - 165: {region: 0x35, script: 0xe, flags: 0x0}, - 166: {region: 0x165, script: 0x57, flags: 0x0}, - 167: {region: 0x165, script: 0x57, flags: 0x0}, - 168: {region: 0x165, script: 0x57, flags: 0x0}, - 169: {region: 0x53, script: 0xe0, flags: 0x0}, - 170: {region: 0x165, script: 0x57, flags: 0x0}, - 171: {region: 0x165, script: 0x57, flags: 0x0}, - 172: {region: 0x165, script: 0x57, flags: 0x0}, - 173: {region: 0x99, script: 0xe, flags: 0x0}, - 174: {region: 0x165, script: 0x57, flags: 0x0}, - 175: {region: 0x9c, script: 0x5, flags: 0x0}, - 176: {region: 0x165, script: 0x57, flags: 0x0}, - 177: {region: 0x4f, script: 0x57, flags: 0x0}, - 178: {region: 0x78, script: 0x57, flags: 0x0}, - 179: {region: 0x99, script: 0x21, flags: 0x0}, - 180: {region: 0xe8, script: 0x5, flags: 0x0}, - 181: {region: 0x99, script: 0x21, flags: 0x0}, - 182: {region: 0x165, script: 0x57, flags: 0x0}, - 183: {region: 0x33, script: 0x57, flags: 0x0}, - 184: {region: 0x165, script: 0x57, flags: 0x0}, - 185: {region: 0xb4, script: 0xc, flags: 0x0}, - 186: {region: 0x52, script: 0x57, flags: 0x0}, - 187: {region: 0x165, script: 0x29, flags: 0x0}, - 188: {region: 0xe7, script: 0x57, flags: 0x0}, - 189: {region: 0x165, script: 0x57, flags: 0x0}, - 190: {region: 0xe8, script: 0x21, flags: 0x0}, - 191: {region: 0x106, script: 0x1f, flags: 0x0}, - 192: {region: 0x15f, script: 0x57, flags: 0x0}, - 193: {region: 0x165, script: 0x57, flags: 0x0}, - 194: {region: 0x95, script: 0x57, flags: 0x0}, - 195: {region: 0x165, script: 0x57, flags: 0x0}, - 196: {region: 0x52, script: 0x57, flags: 0x0}, - 197: {region: 0x165, script: 0x57, flags: 0x0}, - 198: {region: 0x165, script: 0x57, flags: 0x0}, - 199: {region: 0x165, script: 0x57, flags: 0x0}, - 200: {region: 0x86, script: 0x57, flags: 0x0}, - 201: {region: 0x165, script: 0x57, flags: 0x0}, - 202: {region: 0x165, script: 0x57, flags: 0x0}, - 203: {region: 0x165, script: 0x57, flags: 0x0}, - 204: {region: 0x165, script: 0x57, flags: 0x0}, - 205: {region: 0x6d, script: 0x29, flags: 0x0}, - 206: {region: 0x165, script: 0x57, flags: 0x0}, - 207: {region: 0x165, script: 0x57, flags: 0x0}, - 208: {region: 0x52, script: 0x57, flags: 0x0}, - 209: {region: 0x165, script: 0x57, flags: 0x0}, - 210: {region: 0x165, script: 0x57, flags: 0x0}, - 211: {region: 0xc3, script: 0x57, flags: 0x0}, - 212: {region: 0x165, script: 0x57, flags: 0x0}, - 213: {region: 0x165, script: 0x57, flags: 0x0}, - 214: {region: 0x165, script: 0x57, flags: 0x0}, - 215: {region: 0x6e, script: 0x57, flags: 0x0}, - 216: {region: 0x165, script: 0x57, flags: 0x0}, - 217: {region: 0x165, script: 0x57, flags: 0x0}, - 218: {region: 0xd6, script: 0x57, flags: 0x0}, - 219: {region: 0x35, script: 0x16, flags: 0x0}, - 220: {region: 0x106, script: 0x1f, flags: 0x0}, - 221: {region: 0xe7, script: 0x57, flags: 0x0}, - 222: {region: 0x165, script: 0x57, flags: 0x0}, - 223: {region: 0x131, script: 0x57, flags: 0x0}, - 224: {region: 0x8a, script: 0x57, flags: 0x0}, - 225: {region: 0x75, script: 0x57, flags: 0x0}, - 226: {region: 0x106, script: 0x1f, flags: 0x0}, - 227: {region: 0x135, script: 0x57, flags: 0x0}, - 228: {region: 0x49, script: 0x57, flags: 0x0}, - 229: {region: 0x135, script: 0x1a, flags: 0x0}, - 230: {region: 0xa6, script: 0x5, flags: 0x0}, - 231: {region: 0x13e, script: 0x19, flags: 0x0}, - 232: {region: 0x165, script: 0x57, flags: 0x0}, - 233: {region: 0x9b, script: 0x5, flags: 0x0}, - 234: {region: 0x165, script: 0x57, flags: 0x0}, - 235: {region: 0x165, script: 0x57, flags: 0x0}, - 236: {region: 0x165, script: 0x57, flags: 0x0}, - 237: {region: 0x165, script: 0x57, flags: 0x0}, - 238: {region: 0x165, script: 0x57, flags: 0x0}, - 239: {region: 0xc5, script: 0xcc, flags: 0x0}, - 240: {region: 0x78, script: 0x57, flags: 0x0}, - 241: {region: 0x6b, script: 0x1c, flags: 0x0}, - 242: {region: 0xe7, script: 0x57, flags: 0x0}, - 243: {region: 0x49, script: 0x17, flags: 0x0}, - 244: {region: 0x130, script: 0x1f, flags: 0x0}, - 245: {region: 0x49, script: 0x17, flags: 0x0}, - 246: {region: 0x49, script: 0x17, flags: 0x0}, - 247: {region: 0x49, script: 0x17, flags: 0x0}, - 248: {region: 0x49, script: 0x17, flags: 0x0}, - 249: {region: 0x10a, script: 0x57, flags: 0x0}, - 250: {region: 0x5e, script: 0x57, flags: 0x0}, - 251: {region: 0xe9, script: 0x57, flags: 0x0}, - 252: {region: 0x49, script: 0x17, flags: 0x0}, - 253: {region: 0xc4, script: 0x81, flags: 0x0}, - 254: {region: 0x8, script: 0x2, flags: 0x1}, - 255: {region: 0x106, script: 0x1f, flags: 0x0}, - 256: {region: 0x7b, script: 0x57, flags: 0x0}, - 257: {region: 0x63, script: 0x57, flags: 0x0}, - 258: {region: 0x165, script: 0x57, flags: 0x0}, - 259: {region: 0x165, script: 0x57, flags: 0x0}, - 260: {region: 0x165, script: 0x57, flags: 0x0}, - 261: {region: 0x165, script: 0x57, flags: 0x0}, - 262: {region: 0x135, script: 0x57, flags: 0x0}, - 263: {region: 0x106, script: 0x1f, flags: 0x0}, - 264: {region: 0xa4, script: 0x57, flags: 0x0}, - 265: {region: 0x165, script: 0x57, flags: 0x0}, - 266: {region: 0x165, script: 0x57, flags: 0x0}, - 267: {region: 0x99, script: 0x5, flags: 0x0}, - 268: {region: 0x165, script: 0x57, flags: 0x0}, - 269: {region: 0x60, script: 0x57, flags: 0x0}, - 270: {region: 0x165, script: 0x57, flags: 0x0}, - 271: {region: 0x49, script: 0x57, flags: 0x0}, - 272: {region: 0x165, script: 0x57, flags: 0x0}, - 273: {region: 0x165, script: 0x57, flags: 0x0}, - 274: {region: 0x165, script: 0x57, flags: 0x0}, - 275: {region: 0x165, script: 0x5, flags: 0x0}, - 276: {region: 0x49, script: 0x57, flags: 0x0}, - 277: {region: 0x165, script: 0x57, flags: 0x0}, - 278: {region: 0x165, script: 0x57, flags: 0x0}, - 279: {region: 0xd4, script: 0x57, flags: 0x0}, - 280: {region: 0x4f, script: 0x57, flags: 0x0}, - 281: {region: 0x165, script: 0x57, flags: 0x0}, - 282: {region: 0x99, script: 0x5, flags: 0x0}, - 283: {region: 0x165, script: 0x57, flags: 0x0}, - 284: {region: 0x165, script: 0x57, flags: 0x0}, - 285: {region: 0x165, script: 0x57, flags: 0x0}, - 286: {region: 0x165, script: 0x29, flags: 0x0}, - 287: {region: 0x60, script: 0x57, flags: 0x0}, - 288: {region: 0xc3, script: 0x57, flags: 0x0}, - 289: {region: 0xd0, script: 0x57, flags: 0x0}, - 290: {region: 0x165, script: 0x57, flags: 0x0}, - 291: {region: 0xdb, script: 0x21, flags: 0x0}, - 292: {region: 0x52, script: 0x57, flags: 0x0}, - 293: {region: 0x165, script: 0x57, flags: 0x0}, - 294: {region: 0x165, script: 0x57, flags: 0x0}, - 295: {region: 0x165, script: 0x57, flags: 0x0}, - 296: {region: 0xcd, script: 0xde, flags: 0x0}, - 297: {region: 0x165, script: 0x57, flags: 0x0}, - 298: {region: 0x165, script: 0x57, flags: 0x0}, - 299: {region: 0x114, script: 0x57, flags: 0x0}, - 300: {region: 0x37, script: 0x57, flags: 0x0}, - 301: {region: 0x43, script: 0xe0, flags: 0x0}, - 302: {region: 0x165, script: 0x57, flags: 0x0}, - 303: {region: 0xa4, script: 0x57, flags: 0x0}, - 304: {region: 0x80, script: 0x57, flags: 0x0}, - 305: {region: 0xd6, script: 0x57, flags: 0x0}, - 306: {region: 0x9e, script: 0x57, flags: 0x0}, - 307: {region: 0x6b, script: 0x27, flags: 0x0}, - 308: {region: 0x165, script: 0x57, flags: 0x0}, - 309: {region: 0xc4, script: 0x48, flags: 0x0}, - 310: {region: 0x87, script: 0x31, flags: 0x0}, - 311: {region: 0x165, script: 0x57, flags: 0x0}, - 312: {region: 0x165, script: 0x57, flags: 0x0}, - 313: {region: 0xa, script: 0x2, flags: 0x1}, - 314: {region: 0x165, script: 0x57, flags: 0x0}, - 315: {region: 0x165, script: 0x57, flags: 0x0}, - 316: {region: 0x1, script: 0x57, flags: 0x0}, - 317: {region: 0x165, script: 0x57, flags: 0x0}, - 318: {region: 0x6e, script: 0x57, flags: 0x0}, - 319: {region: 0x135, script: 0x57, flags: 0x0}, - 320: {region: 0x6a, script: 0x57, flags: 0x0}, - 321: {region: 0x165, script: 0x57, flags: 0x0}, - 322: {region: 0x9e, script: 0x43, flags: 0x0}, - 323: {region: 0x165, script: 0x57, flags: 0x0}, - 324: {region: 0x165, script: 0x57, flags: 0x0}, - 325: {region: 0x6e, script: 0x57, flags: 0x0}, - 326: {region: 0x52, script: 0x57, flags: 0x0}, - 327: {region: 0x6e, script: 0x57, flags: 0x0}, - 328: {region: 0x9c, script: 0x5, flags: 0x0}, - 329: {region: 0x165, script: 0x57, flags: 0x0}, - 330: {region: 0x165, script: 0x57, flags: 0x0}, - 331: {region: 0x165, script: 0x57, flags: 0x0}, - 332: {region: 0x165, script: 0x57, flags: 0x0}, - 333: {region: 0x86, script: 0x57, flags: 0x0}, - 334: {region: 0xc, script: 0x2, flags: 0x1}, - 335: {region: 0x165, script: 0x57, flags: 0x0}, - 336: {region: 0xc3, script: 0x57, flags: 0x0}, - 337: {region: 0x72, script: 0x57, flags: 0x0}, - 338: {region: 0x10b, script: 0x5, flags: 0x0}, - 339: {region: 0xe7, script: 0x57, flags: 0x0}, - 340: {region: 0x10c, script: 0x57, flags: 0x0}, - 341: {region: 0x73, script: 0x57, flags: 0x0}, - 342: {region: 0x165, script: 0x57, flags: 0x0}, - 343: {region: 0x165, script: 0x57, flags: 0x0}, - 344: {region: 0x76, script: 0x57, flags: 0x0}, - 345: {region: 0x165, script: 0x57, flags: 0x0}, - 346: {region: 0x3b, script: 0x57, flags: 0x0}, - 347: {region: 0x165, script: 0x57, flags: 0x0}, - 348: {region: 0x165, script: 0x57, flags: 0x0}, - 349: {region: 0x165, script: 0x57, flags: 0x0}, - 350: {region: 0x78, script: 0x57, flags: 0x0}, - 351: {region: 0x135, script: 0x57, flags: 0x0}, - 352: {region: 0x78, script: 0x57, flags: 0x0}, - 353: {region: 0x60, script: 0x57, flags: 0x0}, - 354: {region: 0x60, script: 0x57, flags: 0x0}, - 355: {region: 0x52, script: 0x5, flags: 0x0}, - 356: {region: 0x140, script: 0x57, flags: 0x0}, - 357: {region: 0x165, script: 0x57, flags: 0x0}, - 358: {region: 0x84, script: 0x57, flags: 0x0}, - 359: {region: 0x165, script: 0x57, flags: 0x0}, - 360: {region: 0xd4, script: 0x57, flags: 0x0}, - 361: {region: 0x9e, script: 0x57, flags: 0x0}, - 362: {region: 0xd6, script: 0x57, flags: 0x0}, - 363: {region: 0x165, script: 0x57, flags: 0x0}, - 364: {region: 0x10b, script: 0x57, flags: 0x0}, - 365: {region: 0xd9, script: 0x57, flags: 0x0}, - 366: {region: 0x96, script: 0x57, flags: 0x0}, - 367: {region: 0x80, script: 0x57, flags: 0x0}, - 368: {region: 0x165, script: 0x57, flags: 0x0}, - 369: {region: 0xbc, script: 0x57, flags: 0x0}, - 370: {region: 0x165, script: 0x57, flags: 0x0}, - 371: {region: 0x165, script: 0x57, flags: 0x0}, - 372: {region: 0x165, script: 0x57, flags: 0x0}, - 373: {region: 0x53, script: 0x38, flags: 0x0}, - 374: {region: 0x165, script: 0x57, flags: 0x0}, - 375: {region: 0x95, script: 0x57, flags: 0x0}, - 376: {region: 0x165, script: 0x57, flags: 0x0}, - 377: {region: 0x165, script: 0x57, flags: 0x0}, - 378: {region: 0x99, script: 0x21, flags: 0x0}, - 379: {region: 0x165, script: 0x57, flags: 0x0}, - 380: {region: 0x9c, script: 0x5, flags: 0x0}, - 381: {region: 0x7e, script: 0x57, flags: 0x0}, - 382: {region: 0x7b, script: 0x57, flags: 0x0}, - 383: {region: 0x165, script: 0x57, flags: 0x0}, - 384: {region: 0x165, script: 0x57, flags: 0x0}, - 385: {region: 0x165, script: 0x57, flags: 0x0}, - 386: {region: 0x165, script: 0x57, flags: 0x0}, - 387: {region: 0x165, script: 0x57, flags: 0x0}, - 388: {region: 0x165, script: 0x57, flags: 0x0}, - 389: {region: 0x6f, script: 0x29, flags: 0x0}, - 390: {region: 0x165, script: 0x57, flags: 0x0}, - 391: {region: 0xdb, script: 0x21, flags: 0x0}, - 392: {region: 0x165, script: 0x57, flags: 0x0}, - 393: {region: 0xa7, script: 0x57, flags: 0x0}, - 394: {region: 0x165, script: 0x57, flags: 0x0}, - 395: {region: 0xe8, script: 0x5, flags: 0x0}, - 396: {region: 0x165, script: 0x57, flags: 0x0}, - 397: {region: 0xe8, script: 0x5, flags: 0x0}, - 398: {region: 0x165, script: 0x57, flags: 0x0}, - 399: {region: 0x165, script: 0x57, flags: 0x0}, - 400: {region: 0x6e, script: 0x57, flags: 0x0}, - 401: {region: 0x9c, script: 0x5, flags: 0x0}, - 402: {region: 0x165, script: 0x57, flags: 0x0}, - 403: {region: 0x165, script: 0x29, flags: 0x0}, - 404: {region: 0xf1, script: 0x57, flags: 0x0}, - 405: {region: 0x165, script: 0x57, flags: 0x0}, - 406: {region: 0x165, script: 0x57, flags: 0x0}, - 407: {region: 0x165, script: 0x57, flags: 0x0}, - 408: {region: 0x165, script: 0x29, flags: 0x0}, - 409: {region: 0x165, script: 0x57, flags: 0x0}, - 410: {region: 0x99, script: 0x21, flags: 0x0}, - 411: {region: 0x99, script: 0xda, flags: 0x0}, - 412: {region: 0x95, script: 0x57, flags: 0x0}, - 413: {region: 0xd9, script: 0x57, flags: 0x0}, - 414: {region: 0x130, script: 0x2f, flags: 0x0}, - 415: {region: 0x165, script: 0x57, flags: 0x0}, - 416: {region: 0xe, script: 0x2, flags: 0x1}, - 417: {region: 0x99, script: 0xe, flags: 0x0}, - 418: {region: 0x165, script: 0x57, flags: 0x0}, - 419: {region: 0x4e, script: 0x57, flags: 0x0}, - 420: {region: 0x99, script: 0x32, flags: 0x0}, - 421: {region: 0x41, script: 0x57, flags: 0x0}, - 422: {region: 0x54, script: 0x57, flags: 0x0}, - 423: {region: 0x165, script: 0x57, flags: 0x0}, - 424: {region: 0x80, script: 0x57, flags: 0x0}, - 425: {region: 0x165, script: 0x57, flags: 0x0}, - 426: {region: 0x165, script: 0x57, flags: 0x0}, - 427: {region: 0xa4, script: 0x57, flags: 0x0}, - 428: {region: 0x98, script: 0x57, flags: 0x0}, - 429: {region: 0x165, script: 0x57, flags: 0x0}, - 430: {region: 0xdb, script: 0x21, flags: 0x0}, - 431: {region: 0x165, script: 0x57, flags: 0x0}, - 432: {region: 0x165, script: 0x5, flags: 0x0}, - 433: {region: 0x49, script: 0x57, flags: 0x0}, - 434: {region: 0x165, script: 0x5, flags: 0x0}, - 435: {region: 0x165, script: 0x57, flags: 0x0}, - 436: {region: 0x10, script: 0x3, flags: 0x1}, - 437: {region: 0x165, script: 0x57, flags: 0x0}, - 438: {region: 0x53, script: 0x38, flags: 0x0}, - 439: {region: 0x165, script: 0x57, flags: 0x0}, - 440: {region: 0x135, script: 0x57, flags: 0x0}, - 441: {region: 0x24, script: 0x5, flags: 0x0}, - 442: {region: 0x165, script: 0x57, flags: 0x0}, - 443: {region: 0x165, script: 0x29, flags: 0x0}, - 444: {region: 0x97, script: 0x3b, flags: 0x0}, - 445: {region: 0x165, script: 0x57, flags: 0x0}, - 446: {region: 0x99, script: 0x21, flags: 0x0}, - 447: {region: 0x165, script: 0x57, flags: 0x0}, - 448: {region: 0x73, script: 0x57, flags: 0x0}, - 449: {region: 0x165, script: 0x57, flags: 0x0}, - 450: {region: 0x165, script: 0x57, flags: 0x0}, - 451: {region: 0xe7, script: 0x57, flags: 0x0}, - 452: {region: 0x165, script: 0x57, flags: 0x0}, - 453: {region: 0x12b, script: 0x3d, flags: 0x0}, - 454: {region: 0x53, script: 0x89, flags: 0x0}, - 455: {region: 0x165, script: 0x57, flags: 0x0}, - 456: {region: 0xe8, script: 0x5, flags: 0x0}, - 457: {region: 0x99, script: 0x21, flags: 0x0}, - 458: {region: 0xaf, script: 0x3e, flags: 0x0}, - 459: {region: 0xe7, script: 0x57, flags: 0x0}, - 460: {region: 0xe8, script: 0x5, flags: 0x0}, - 461: {region: 0xe6, script: 0x57, flags: 0x0}, - 462: {region: 0x99, script: 0x21, flags: 0x0}, - 463: {region: 0x99, script: 0x21, flags: 0x0}, - 464: {region: 0x165, script: 0x57, flags: 0x0}, - 465: {region: 0x90, script: 0x57, flags: 0x0}, - 466: {region: 0x60, script: 0x57, flags: 0x0}, - 467: {region: 0x53, script: 0x38, flags: 0x0}, - 468: {region: 0x91, script: 0x57, flags: 0x0}, - 469: {region: 0x92, script: 0x57, flags: 0x0}, - 470: {region: 0x165, script: 0x57, flags: 0x0}, - 471: {region: 0x28, script: 0x8, flags: 0x0}, - 472: {region: 0xd2, script: 0x57, flags: 0x0}, - 473: {region: 0x78, script: 0x57, flags: 0x0}, - 474: {region: 0x165, script: 0x57, flags: 0x0}, - 475: {region: 0x165, script: 0x57, flags: 0x0}, - 476: {region: 0xd0, script: 0x57, flags: 0x0}, - 477: {region: 0xd6, script: 0x57, flags: 0x0}, - 478: {region: 0x165, script: 0x57, flags: 0x0}, - 479: {region: 0x165, script: 0x57, flags: 0x0}, - 480: {region: 0x165, script: 0x57, flags: 0x0}, - 481: {region: 0x95, script: 0x57, flags: 0x0}, - 482: {region: 0x165, script: 0x57, flags: 0x0}, - 483: {region: 0x165, script: 0x57, flags: 0x0}, - 484: {region: 0x165, script: 0x57, flags: 0x0}, - 486: {region: 0x122, script: 0x57, flags: 0x0}, - 487: {region: 0xd6, script: 0x57, flags: 0x0}, - 488: {region: 0x165, script: 0x57, flags: 0x0}, - 489: {region: 0x165, script: 0x57, flags: 0x0}, - 490: {region: 0x53, script: 0xea, flags: 0x0}, - 491: {region: 0x165, script: 0x57, flags: 0x0}, - 492: {region: 0x135, script: 0x57, flags: 0x0}, - 493: {region: 0x165, script: 0x57, flags: 0x0}, - 494: {region: 0x49, script: 0x57, flags: 0x0}, - 495: {region: 0x165, script: 0x57, flags: 0x0}, - 496: {region: 0x165, script: 0x57, flags: 0x0}, - 497: {region: 0xe7, script: 0x57, flags: 0x0}, - 498: {region: 0x165, script: 0x57, flags: 0x0}, - 499: {region: 0x95, script: 0x57, flags: 0x0}, - 500: {region: 0x106, script: 0x1f, flags: 0x0}, - 501: {region: 0x1, script: 0x57, flags: 0x0}, - 502: {region: 0x165, script: 0x57, flags: 0x0}, - 503: {region: 0x165, script: 0x57, flags: 0x0}, - 504: {region: 0x9d, script: 0x57, flags: 0x0}, - 505: {region: 0x9e, script: 0x57, flags: 0x0}, - 506: {region: 0x49, script: 0x17, flags: 0x0}, - 507: {region: 0x97, script: 0x3b, flags: 0x0}, - 508: {region: 0x165, script: 0x57, flags: 0x0}, - 509: {region: 0x165, script: 0x57, flags: 0x0}, - 510: {region: 0x106, script: 0x57, flags: 0x0}, - 511: {region: 0x165, script: 0x57, flags: 0x0}, - 512: {region: 0xa2, script: 0x46, flags: 0x0}, - 513: {region: 0x165, script: 0x57, flags: 0x0}, - 514: {region: 0xa0, script: 0x57, flags: 0x0}, - 515: {region: 0x1, script: 0x57, flags: 0x0}, - 516: {region: 0x165, script: 0x57, flags: 0x0}, - 517: {region: 0x165, script: 0x57, flags: 0x0}, - 518: {region: 0x165, script: 0x57, flags: 0x0}, - 519: {region: 0x52, script: 0x57, flags: 0x0}, - 520: {region: 0x130, script: 0x3b, flags: 0x0}, - 521: {region: 0x165, script: 0x57, flags: 0x0}, - 522: {region: 0x12f, script: 0x57, flags: 0x0}, - 523: {region: 0xdb, script: 0x21, flags: 0x0}, - 524: {region: 0x165, script: 0x57, flags: 0x0}, - 525: {region: 0x63, script: 0x57, flags: 0x0}, - 526: {region: 0x95, script: 0x57, flags: 0x0}, - 527: {region: 0x95, script: 0x57, flags: 0x0}, - 528: {region: 0x7d, script: 0x2b, flags: 0x0}, - 529: {region: 0x137, script: 0x1f, flags: 0x0}, - 530: {region: 0x67, script: 0x57, flags: 0x0}, - 531: {region: 0xc4, script: 0x57, flags: 0x0}, - 532: {region: 0x165, script: 0x57, flags: 0x0}, - 533: {region: 0x165, script: 0x57, flags: 0x0}, - 534: {region: 0xd6, script: 0x57, flags: 0x0}, - 535: {region: 0xa4, script: 0x57, flags: 0x0}, - 536: {region: 0xc3, script: 0x57, flags: 0x0}, - 537: {region: 0x106, script: 0x1f, flags: 0x0}, - 538: {region: 0x165, script: 0x57, flags: 0x0}, - 539: {region: 0x165, script: 0x57, flags: 0x0}, - 540: {region: 0x165, script: 0x57, flags: 0x0}, - 541: {region: 0x165, script: 0x57, flags: 0x0}, - 542: {region: 0xd4, script: 0x5, flags: 0x0}, - 543: {region: 0xd6, script: 0x57, flags: 0x0}, - 544: {region: 0x164, script: 0x57, flags: 0x0}, - 545: {region: 0x165, script: 0x57, flags: 0x0}, - 546: {region: 0x165, script: 0x57, flags: 0x0}, - 547: {region: 0x12f, script: 0x57, flags: 0x0}, - 548: {region: 0x122, script: 0x5, flags: 0x0}, - 549: {region: 0x165, script: 0x57, flags: 0x0}, - 550: {region: 0x123, script: 0xdf, flags: 0x0}, - 551: {region: 0x5a, script: 0x57, flags: 0x0}, - 552: {region: 0x52, script: 0x57, flags: 0x0}, - 553: {region: 0x165, script: 0x57, flags: 0x0}, - 554: {region: 0x4f, script: 0x57, flags: 0x0}, - 555: {region: 0x99, script: 0x21, flags: 0x0}, - 556: {region: 0x99, script: 0x21, flags: 0x0}, - 557: {region: 0x4b, script: 0x57, flags: 0x0}, - 558: {region: 0x95, script: 0x57, flags: 0x0}, - 559: {region: 0x165, script: 0x57, flags: 0x0}, - 560: {region: 0x41, script: 0x57, flags: 0x0}, - 561: {region: 0x99, script: 0x57, flags: 0x0}, - 562: {region: 0x53, script: 0xd6, flags: 0x0}, - 563: {region: 0x99, script: 0x21, flags: 0x0}, - 564: {region: 0xc3, script: 0x57, flags: 0x0}, - 565: {region: 0x165, script: 0x57, flags: 0x0}, - 566: {region: 0x99, script: 0x72, flags: 0x0}, - 567: {region: 0xe8, script: 0x5, flags: 0x0}, - 568: {region: 0x165, script: 0x57, flags: 0x0}, - 569: {region: 0xa4, script: 0x57, flags: 0x0}, - 570: {region: 0x165, script: 0x57, flags: 0x0}, - 571: {region: 0x12b, script: 0x57, flags: 0x0}, - 572: {region: 0x165, script: 0x57, flags: 0x0}, - 573: {region: 0xd2, script: 0x57, flags: 0x0}, - 574: {region: 0x165, script: 0x57, flags: 0x0}, - 575: {region: 0xaf, script: 0x54, flags: 0x0}, - 576: {region: 0x165, script: 0x57, flags: 0x0}, - 577: {region: 0x165, script: 0x57, flags: 0x0}, - 578: {region: 0x13, script: 0x6, flags: 0x1}, - 579: {region: 0x165, script: 0x57, flags: 0x0}, - 580: {region: 0x52, script: 0x57, flags: 0x0}, - 581: {region: 0x82, script: 0x57, flags: 0x0}, - 582: {region: 0xa4, script: 0x57, flags: 0x0}, - 583: {region: 0x165, script: 0x57, flags: 0x0}, - 584: {region: 0x165, script: 0x57, flags: 0x0}, - 585: {region: 0x165, script: 0x57, flags: 0x0}, - 586: {region: 0xa6, script: 0x4b, flags: 0x0}, - 587: {region: 0x2a, script: 0x57, flags: 0x0}, - 588: {region: 0x165, script: 0x57, flags: 0x0}, - 589: {region: 0x165, script: 0x57, flags: 0x0}, - 590: {region: 0x165, script: 0x57, flags: 0x0}, - 591: {region: 0x165, script: 0x57, flags: 0x0}, - 592: {region: 0x165, script: 0x57, flags: 0x0}, - 593: {region: 0x99, script: 0x4f, flags: 0x0}, - 594: {region: 0x8b, script: 0x57, flags: 0x0}, - 595: {region: 0x165, script: 0x57, flags: 0x0}, - 596: {region: 0xab, script: 0x50, flags: 0x0}, - 597: {region: 0x106, script: 0x1f, flags: 0x0}, - 598: {region: 0x99, script: 0x21, flags: 0x0}, - 599: {region: 0x165, script: 0x57, flags: 0x0}, - 600: {region: 0x75, script: 0x57, flags: 0x0}, - 601: {region: 0x165, script: 0x57, flags: 0x0}, - 602: {region: 0xb4, script: 0x57, flags: 0x0}, - 603: {region: 0x165, script: 0x57, flags: 0x0}, - 604: {region: 0x165, script: 0x57, flags: 0x0}, - 605: {region: 0x165, script: 0x57, flags: 0x0}, - 606: {region: 0x165, script: 0x57, flags: 0x0}, - 607: {region: 0x165, script: 0x57, flags: 0x0}, - 608: {region: 0x165, script: 0x57, flags: 0x0}, - 609: {region: 0x165, script: 0x57, flags: 0x0}, - 610: {region: 0x165, script: 0x29, flags: 0x0}, - 611: {region: 0x165, script: 0x57, flags: 0x0}, - 612: {region: 0x106, script: 0x1f, flags: 0x0}, - 613: {region: 0x112, script: 0x57, flags: 0x0}, - 614: {region: 0xe7, script: 0x57, flags: 0x0}, - 615: {region: 0x106, script: 0x57, flags: 0x0}, - 616: {region: 0x165, script: 0x57, flags: 0x0}, - 617: {region: 0x99, script: 0x21, flags: 0x0}, - 618: {region: 0x99, script: 0x5, flags: 0x0}, - 619: {region: 0x12f, script: 0x57, flags: 0x0}, - 620: {region: 0x165, script: 0x57, flags: 0x0}, - 621: {region: 0x52, script: 0x57, flags: 0x0}, - 622: {region: 0x60, script: 0x57, flags: 0x0}, - 623: {region: 0x165, script: 0x57, flags: 0x0}, - 624: {region: 0x165, script: 0x57, flags: 0x0}, - 625: {region: 0x165, script: 0x29, flags: 0x0}, - 626: {region: 0x165, script: 0x57, flags: 0x0}, - 627: {region: 0x165, script: 0x57, flags: 0x0}, - 628: {region: 0x19, script: 0x3, flags: 0x1}, - 629: {region: 0x165, script: 0x57, flags: 0x0}, - 630: {region: 0x165, script: 0x57, flags: 0x0}, - 631: {region: 0x165, script: 0x57, flags: 0x0}, - 632: {region: 0x165, script: 0x57, flags: 0x0}, - 633: {region: 0x106, script: 0x1f, flags: 0x0}, - 634: {region: 0x165, script: 0x57, flags: 0x0}, - 635: {region: 0x165, script: 0x57, flags: 0x0}, - 636: {region: 0x165, script: 0x57, flags: 0x0}, - 637: {region: 0x106, script: 0x1f, flags: 0x0}, - 638: {region: 0x165, script: 0x57, flags: 0x0}, - 639: {region: 0x95, script: 0x57, flags: 0x0}, - 640: {region: 0xe8, script: 0x5, flags: 0x0}, - 641: {region: 0x7b, script: 0x57, flags: 0x0}, - 642: {region: 0x165, script: 0x57, flags: 0x0}, - 643: {region: 0x165, script: 0x57, flags: 0x0}, - 644: {region: 0x165, script: 0x57, flags: 0x0}, - 645: {region: 0x165, script: 0x29, flags: 0x0}, - 646: {region: 0x123, script: 0xdf, flags: 0x0}, - 647: {region: 0xe8, script: 0x5, flags: 0x0}, - 648: {region: 0x165, script: 0x57, flags: 0x0}, - 649: {region: 0x165, script: 0x57, flags: 0x0}, - 650: {region: 0x1c, script: 0x5, flags: 0x1}, - 651: {region: 0x165, script: 0x57, flags: 0x0}, - 652: {region: 0x165, script: 0x57, flags: 0x0}, - 653: {region: 0x165, script: 0x57, flags: 0x0}, - 654: {region: 0x138, script: 0x57, flags: 0x0}, - 655: {region: 0x87, script: 0x5b, flags: 0x0}, - 656: {region: 0x97, script: 0x3b, flags: 0x0}, - 657: {region: 0x12f, script: 0x57, flags: 0x0}, - 658: {region: 0xe8, script: 0x5, flags: 0x0}, - 659: {region: 0x131, script: 0x57, flags: 0x0}, - 660: {region: 0x165, script: 0x57, flags: 0x0}, - 661: {region: 0xb7, script: 0x57, flags: 0x0}, - 662: {region: 0x106, script: 0x1f, flags: 0x0}, - 663: {region: 0x165, script: 0x57, flags: 0x0}, - 664: {region: 0x95, script: 0x57, flags: 0x0}, - 665: {region: 0x165, script: 0x57, flags: 0x0}, - 666: {region: 0x53, script: 0xdf, flags: 0x0}, - 667: {region: 0x165, script: 0x57, flags: 0x0}, - 668: {region: 0x165, script: 0x57, flags: 0x0}, - 669: {region: 0x165, script: 0x57, flags: 0x0}, - 670: {region: 0x165, script: 0x57, flags: 0x0}, - 671: {region: 0x99, script: 0x59, flags: 0x0}, - 672: {region: 0x165, script: 0x57, flags: 0x0}, - 673: {region: 0x165, script: 0x57, flags: 0x0}, - 674: {region: 0x106, script: 0x1f, flags: 0x0}, - 675: {region: 0x131, script: 0x57, flags: 0x0}, - 676: {region: 0x165, script: 0x57, flags: 0x0}, - 677: {region: 0xd9, script: 0x57, flags: 0x0}, - 678: {region: 0x165, script: 0x57, flags: 0x0}, - 679: {region: 0x165, script: 0x57, flags: 0x0}, - 680: {region: 0x21, script: 0x2, flags: 0x1}, - 681: {region: 0x165, script: 0x57, flags: 0x0}, - 682: {region: 0x165, script: 0x57, flags: 0x0}, - 683: {region: 0x9e, script: 0x57, flags: 0x0}, - 684: {region: 0x53, script: 0x5d, flags: 0x0}, - 685: {region: 0x95, script: 0x57, flags: 0x0}, - 686: {region: 0x9c, script: 0x5, flags: 0x0}, - 687: {region: 0x135, script: 0x57, flags: 0x0}, - 688: {region: 0x165, script: 0x57, flags: 0x0}, - 689: {region: 0x165, script: 0x57, flags: 0x0}, - 690: {region: 0x99, script: 0xda, flags: 0x0}, - 691: {region: 0x9e, script: 0x57, flags: 0x0}, - 692: {region: 0x165, script: 0x57, flags: 0x0}, - 693: {region: 0x4b, script: 0x57, flags: 0x0}, - 694: {region: 0x165, script: 0x57, flags: 0x0}, - 695: {region: 0x165, script: 0x57, flags: 0x0}, - 696: {region: 0xaf, script: 0x54, flags: 0x0}, - 697: {region: 0x165, script: 0x57, flags: 0x0}, - 698: {region: 0x165, script: 0x57, flags: 0x0}, - 699: {region: 0x4b, script: 0x57, flags: 0x0}, - 700: {region: 0x165, script: 0x57, flags: 0x0}, - 701: {region: 0x165, script: 0x57, flags: 0x0}, - 702: {region: 0x162, script: 0x57, flags: 0x0}, - 703: {region: 0x9c, script: 0x5, flags: 0x0}, - 704: {region: 0xb6, script: 0x57, flags: 0x0}, - 705: {region: 0xb8, script: 0x57, flags: 0x0}, - 706: {region: 0x4b, script: 0x57, flags: 0x0}, - 707: {region: 0x4b, script: 0x57, flags: 0x0}, - 708: {region: 0xa4, script: 0x57, flags: 0x0}, - 709: {region: 0xa4, script: 0x57, flags: 0x0}, - 710: {region: 0x9c, script: 0x5, flags: 0x0}, - 711: {region: 0xb8, script: 0x57, flags: 0x0}, - 712: {region: 0x123, script: 0xdf, flags: 0x0}, - 713: {region: 0x53, script: 0x38, flags: 0x0}, - 714: {region: 0x12b, script: 0x57, flags: 0x0}, - 715: {region: 0x95, script: 0x57, flags: 0x0}, - 716: {region: 0x52, script: 0x57, flags: 0x0}, - 717: {region: 0x99, script: 0x21, flags: 0x0}, - 718: {region: 0x99, script: 0x21, flags: 0x0}, - 719: {region: 0x95, script: 0x57, flags: 0x0}, - 720: {region: 0x23, script: 0x3, flags: 0x1}, - 721: {region: 0xa4, script: 0x57, flags: 0x0}, - 722: {region: 0x165, script: 0x57, flags: 0x0}, - 723: {region: 0xcf, script: 0x57, flags: 0x0}, - 724: {region: 0x165, script: 0x57, flags: 0x0}, - 725: {region: 0x165, script: 0x57, flags: 0x0}, - 726: {region: 0x165, script: 0x57, flags: 0x0}, - 727: {region: 0x165, script: 0x57, flags: 0x0}, - 728: {region: 0x165, script: 0x57, flags: 0x0}, - 729: {region: 0x165, script: 0x57, flags: 0x0}, - 730: {region: 0x165, script: 0x57, flags: 0x0}, - 731: {region: 0x165, script: 0x57, flags: 0x0}, - 732: {region: 0x165, script: 0x57, flags: 0x0}, - 733: {region: 0x165, script: 0x57, flags: 0x0}, - 734: {region: 0x165, script: 0x57, flags: 0x0}, - 735: {region: 0x165, script: 0x5, flags: 0x0}, - 736: {region: 0x106, script: 0x1f, flags: 0x0}, - 737: {region: 0xe7, script: 0x57, flags: 0x0}, - 738: {region: 0x165, script: 0x57, flags: 0x0}, - 739: {region: 0x95, script: 0x57, flags: 0x0}, - 740: {region: 0x165, script: 0x29, flags: 0x0}, - 741: {region: 0x165, script: 0x57, flags: 0x0}, - 742: {region: 0x165, script: 0x57, flags: 0x0}, - 743: {region: 0x165, script: 0x57, flags: 0x0}, - 744: {region: 0x112, script: 0x57, flags: 0x0}, - 745: {region: 0xa4, script: 0x57, flags: 0x0}, - 746: {region: 0x165, script: 0x57, flags: 0x0}, - 747: {region: 0x165, script: 0x57, flags: 0x0}, - 748: {region: 0x123, script: 0x5, flags: 0x0}, - 749: {region: 0xcc, script: 0x57, flags: 0x0}, - 750: {region: 0x165, script: 0x57, flags: 0x0}, - 751: {region: 0x165, script: 0x57, flags: 0x0}, - 752: {region: 0x165, script: 0x57, flags: 0x0}, - 753: {region: 0xbf, script: 0x57, flags: 0x0}, - 754: {region: 0xd1, script: 0x57, flags: 0x0}, - 755: {region: 0x165, script: 0x57, flags: 0x0}, - 756: {region: 0x52, script: 0x57, flags: 0x0}, - 757: {region: 0xdb, script: 0x21, flags: 0x0}, - 758: {region: 0x12f, script: 0x57, flags: 0x0}, - 759: {region: 0xc0, script: 0x57, flags: 0x0}, - 760: {region: 0x165, script: 0x57, flags: 0x0}, - 761: {region: 0x165, script: 0x57, flags: 0x0}, - 762: {region: 0xe0, script: 0x57, flags: 0x0}, - 763: {region: 0x165, script: 0x57, flags: 0x0}, - 764: {region: 0x95, script: 0x57, flags: 0x0}, - 765: {region: 0x9b, script: 0x3a, flags: 0x0}, - 766: {region: 0x165, script: 0x57, flags: 0x0}, - 767: {region: 0xc2, script: 0x1f, flags: 0x0}, - 768: {region: 0x165, script: 0x5, flags: 0x0}, - 769: {region: 0x165, script: 0x57, flags: 0x0}, - 770: {region: 0x165, script: 0x57, flags: 0x0}, - 771: {region: 0x165, script: 0x57, flags: 0x0}, - 772: {region: 0x99, script: 0x6b, flags: 0x0}, - 773: {region: 0x165, script: 0x57, flags: 0x0}, - 774: {region: 0x165, script: 0x57, flags: 0x0}, - 775: {region: 0x10b, script: 0x57, flags: 0x0}, - 776: {region: 0x165, script: 0x57, flags: 0x0}, - 777: {region: 0x165, script: 0x57, flags: 0x0}, - 778: {region: 0x165, script: 0x57, flags: 0x0}, - 779: {region: 0x26, script: 0x3, flags: 0x1}, - 780: {region: 0x165, script: 0x57, flags: 0x0}, - 781: {region: 0x165, script: 0x57, flags: 0x0}, - 782: {region: 0x99, script: 0xe, flags: 0x0}, - 783: {region: 0xc4, script: 0x72, flags: 0x0}, - 785: {region: 0x165, script: 0x57, flags: 0x0}, - 786: {region: 0x49, script: 0x57, flags: 0x0}, - 787: {region: 0x49, script: 0x57, flags: 0x0}, - 788: {region: 0x37, script: 0x57, flags: 0x0}, - 789: {region: 0x165, script: 0x57, flags: 0x0}, - 790: {region: 0x165, script: 0x57, flags: 0x0}, - 791: {region: 0x165, script: 0x57, flags: 0x0}, - 792: {region: 0x165, script: 0x57, flags: 0x0}, - 793: {region: 0x165, script: 0x57, flags: 0x0}, - 794: {region: 0x165, script: 0x57, flags: 0x0}, - 795: {region: 0x99, script: 0x21, flags: 0x0}, - 796: {region: 0xdb, script: 0x21, flags: 0x0}, - 797: {region: 0x106, script: 0x1f, flags: 0x0}, - 798: {region: 0x35, script: 0x6f, flags: 0x0}, - 799: {region: 0x29, script: 0x3, flags: 0x1}, - 800: {region: 0xcb, script: 0x57, flags: 0x0}, - 801: {region: 0x165, script: 0x57, flags: 0x0}, - 802: {region: 0x165, script: 0x57, flags: 0x0}, - 803: {region: 0x165, script: 0x57, flags: 0x0}, - 804: {region: 0x99, script: 0x21, flags: 0x0}, - 805: {region: 0x52, script: 0x57, flags: 0x0}, - 807: {region: 0x165, script: 0x57, flags: 0x0}, - 808: {region: 0x135, script: 0x57, flags: 0x0}, - 809: {region: 0x165, script: 0x57, flags: 0x0}, - 810: {region: 0x165, script: 0x57, flags: 0x0}, - 811: {region: 0xe8, script: 0x5, flags: 0x0}, - 812: {region: 0xc3, script: 0x57, flags: 0x0}, - 813: {region: 0x99, script: 0x21, flags: 0x0}, - 814: {region: 0x95, script: 0x57, flags: 0x0}, - 815: {region: 0x164, script: 0x57, flags: 0x0}, - 816: {region: 0x165, script: 0x57, flags: 0x0}, - 817: {region: 0xc4, script: 0x72, flags: 0x0}, - 818: {region: 0x165, script: 0x57, flags: 0x0}, - 819: {region: 0x165, script: 0x29, flags: 0x0}, - 820: {region: 0x106, script: 0x1f, flags: 0x0}, - 821: {region: 0x165, script: 0x57, flags: 0x0}, - 822: {region: 0x131, script: 0x57, flags: 0x0}, - 823: {region: 0x9c, script: 0x63, flags: 0x0}, - 824: {region: 0x165, script: 0x57, flags: 0x0}, - 825: {region: 0x165, script: 0x57, flags: 0x0}, - 826: {region: 0x9c, script: 0x5, flags: 0x0}, - 827: {region: 0x165, script: 0x57, flags: 0x0}, - 828: {region: 0x165, script: 0x57, flags: 0x0}, - 829: {region: 0x165, script: 0x57, flags: 0x0}, - 830: {region: 0xdd, script: 0x57, flags: 0x0}, - 831: {region: 0x165, script: 0x57, flags: 0x0}, - 832: {region: 0x165, script: 0x57, flags: 0x0}, - 834: {region: 0x165, script: 0x57, flags: 0x0}, - 835: {region: 0x53, script: 0x38, flags: 0x0}, - 836: {region: 0x9e, script: 0x57, flags: 0x0}, - 837: {region: 0xd2, script: 0x57, flags: 0x0}, - 838: {region: 0x165, script: 0x57, flags: 0x0}, - 839: {region: 0xda, script: 0x57, flags: 0x0}, - 840: {region: 0x165, script: 0x57, flags: 0x0}, - 841: {region: 0x165, script: 0x57, flags: 0x0}, - 842: {region: 0x165, script: 0x57, flags: 0x0}, - 843: {region: 0xcf, script: 0x57, flags: 0x0}, - 844: {region: 0x165, script: 0x57, flags: 0x0}, - 845: {region: 0x165, script: 0x57, flags: 0x0}, - 846: {region: 0x164, script: 0x57, flags: 0x0}, - 847: {region: 0xd1, script: 0x57, flags: 0x0}, - 848: {region: 0x60, script: 0x57, flags: 0x0}, - 849: {region: 0xdb, script: 0x21, flags: 0x0}, - 850: {region: 0x165, script: 0x57, flags: 0x0}, - 851: {region: 0xdb, script: 0x21, flags: 0x0}, - 852: {region: 0x165, script: 0x57, flags: 0x0}, - 853: {region: 0x165, script: 0x57, flags: 0x0}, - 854: {region: 0xd2, script: 0x57, flags: 0x0}, - 855: {region: 0x165, script: 0x57, flags: 0x0}, - 856: {region: 0x165, script: 0x57, flags: 0x0}, - 857: {region: 0xd1, script: 0x57, flags: 0x0}, - 858: {region: 0x165, script: 0x57, flags: 0x0}, - 859: {region: 0xcf, script: 0x57, flags: 0x0}, - 860: {region: 0xcf, script: 0x57, flags: 0x0}, - 861: {region: 0x165, script: 0x57, flags: 0x0}, - 862: {region: 0x165, script: 0x57, flags: 0x0}, - 863: {region: 0x95, script: 0x57, flags: 0x0}, - 864: {region: 0x165, script: 0x57, flags: 0x0}, - 865: {region: 0xdf, script: 0x57, flags: 0x0}, - 866: {region: 0x165, script: 0x57, flags: 0x0}, - 867: {region: 0x165, script: 0x57, flags: 0x0}, - 868: {region: 0x99, script: 0x57, flags: 0x0}, - 869: {region: 0x165, script: 0x57, flags: 0x0}, - 870: {region: 0x165, script: 0x57, flags: 0x0}, - 871: {region: 0xd9, script: 0x57, flags: 0x0}, - 872: {region: 0x52, script: 0x57, flags: 0x0}, - 873: {region: 0x165, script: 0x57, flags: 0x0}, - 874: {region: 0xda, script: 0x57, flags: 0x0}, - 875: {region: 0x165, script: 0x57, flags: 0x0}, - 876: {region: 0x52, script: 0x57, flags: 0x0}, - 877: {region: 0x165, script: 0x57, flags: 0x0}, - 878: {region: 0x165, script: 0x57, flags: 0x0}, - 879: {region: 0xda, script: 0x57, flags: 0x0}, - 880: {region: 0x123, script: 0x53, flags: 0x0}, - 881: {region: 0x99, script: 0x21, flags: 0x0}, - 882: {region: 0x10c, script: 0xbf, flags: 0x0}, - 883: {region: 0x165, script: 0x57, flags: 0x0}, - 884: {region: 0x165, script: 0x57, flags: 0x0}, - 885: {region: 0x84, script: 0x78, flags: 0x0}, - 886: {region: 0x161, script: 0x57, flags: 0x0}, - 887: {region: 0x165, script: 0x57, flags: 0x0}, - 888: {region: 0x49, script: 0x17, flags: 0x0}, - 889: {region: 0x165, script: 0x57, flags: 0x0}, - 890: {region: 0x161, script: 0x57, flags: 0x0}, - 891: {region: 0x165, script: 0x57, flags: 0x0}, - 892: {region: 0x165, script: 0x57, flags: 0x0}, - 893: {region: 0x165, script: 0x57, flags: 0x0}, - 894: {region: 0x165, script: 0x57, flags: 0x0}, - 895: {region: 0x165, script: 0x57, flags: 0x0}, - 896: {region: 0x117, script: 0x57, flags: 0x0}, - 897: {region: 0x165, script: 0x57, flags: 0x0}, - 898: {region: 0x165, script: 0x57, flags: 0x0}, - 899: {region: 0x135, script: 0x57, flags: 0x0}, - 900: {region: 0x165, script: 0x57, flags: 0x0}, - 901: {region: 0x53, script: 0x57, flags: 0x0}, - 902: {region: 0x165, script: 0x57, flags: 0x0}, - 903: {region: 0xce, script: 0x57, flags: 0x0}, - 904: {region: 0x12f, script: 0x57, flags: 0x0}, - 905: {region: 0x131, script: 0x57, flags: 0x0}, - 906: {region: 0x80, script: 0x57, flags: 0x0}, - 907: {region: 0x78, script: 0x57, flags: 0x0}, - 908: {region: 0x165, script: 0x57, flags: 0x0}, - 910: {region: 0x165, script: 0x57, flags: 0x0}, - 911: {region: 0x165, script: 0x57, flags: 0x0}, - 912: {region: 0x6f, script: 0x57, flags: 0x0}, - 913: {region: 0x165, script: 0x57, flags: 0x0}, - 914: {region: 0x165, script: 0x57, flags: 0x0}, - 915: {region: 0x165, script: 0x57, flags: 0x0}, - 916: {region: 0x165, script: 0x57, flags: 0x0}, - 917: {region: 0x99, script: 0x7d, flags: 0x0}, - 918: {region: 0x165, script: 0x57, flags: 0x0}, - 919: {region: 0x165, script: 0x5, flags: 0x0}, - 920: {region: 0x7d, script: 0x1f, flags: 0x0}, - 921: {region: 0x135, script: 0x7e, flags: 0x0}, - 922: {region: 0x165, script: 0x5, flags: 0x0}, - 923: {region: 0xc5, script: 0x7c, flags: 0x0}, - 924: {region: 0x165, script: 0x57, flags: 0x0}, - 925: {region: 0x2c, script: 0x3, flags: 0x1}, - 926: {region: 0xe7, script: 0x57, flags: 0x0}, - 927: {region: 0x2f, script: 0x2, flags: 0x1}, - 928: {region: 0xe7, script: 0x57, flags: 0x0}, - 929: {region: 0x30, script: 0x57, flags: 0x0}, - 930: {region: 0xf0, script: 0x57, flags: 0x0}, - 931: {region: 0x165, script: 0x57, flags: 0x0}, - 932: {region: 0x78, script: 0x57, flags: 0x0}, - 933: {region: 0xd6, script: 0x57, flags: 0x0}, - 934: {region: 0x135, script: 0x57, flags: 0x0}, - 935: {region: 0x49, script: 0x57, flags: 0x0}, - 936: {region: 0x165, script: 0x57, flags: 0x0}, - 937: {region: 0x9c, script: 0xe8, flags: 0x0}, - 938: {region: 0x165, script: 0x57, flags: 0x0}, - 939: {region: 0x60, script: 0x57, flags: 0x0}, - 940: {region: 0x165, script: 0x5, flags: 0x0}, - 941: {region: 0xb0, script: 0x87, flags: 0x0}, - 943: {region: 0x165, script: 0x57, flags: 0x0}, - 944: {region: 0x165, script: 0x57, flags: 0x0}, - 945: {region: 0x99, script: 0x12, flags: 0x0}, - 946: {region: 0xa4, script: 0x57, flags: 0x0}, - 947: {region: 0xe9, script: 0x57, flags: 0x0}, - 948: {region: 0x165, script: 0x57, flags: 0x0}, - 949: {region: 0x9e, script: 0x57, flags: 0x0}, - 950: {region: 0x165, script: 0x57, flags: 0x0}, - 951: {region: 0x165, script: 0x57, flags: 0x0}, - 952: {region: 0x87, script: 0x31, flags: 0x0}, - 953: {region: 0x75, script: 0x57, flags: 0x0}, - 954: {region: 0x165, script: 0x57, flags: 0x0}, - 955: {region: 0xe8, script: 0x4a, flags: 0x0}, - 956: {region: 0x9c, script: 0x5, flags: 0x0}, - 957: {region: 0x1, script: 0x57, flags: 0x0}, - 958: {region: 0x24, script: 0x5, flags: 0x0}, - 959: {region: 0x165, script: 0x57, flags: 0x0}, - 960: {region: 0x41, script: 0x57, flags: 0x0}, - 961: {region: 0x165, script: 0x57, flags: 0x0}, - 962: {region: 0x7a, script: 0x57, flags: 0x0}, - 963: {region: 0x165, script: 0x57, flags: 0x0}, - 964: {region: 0xe4, script: 0x57, flags: 0x0}, - 965: {region: 0x89, script: 0x57, flags: 0x0}, - 966: {region: 0x69, script: 0x57, flags: 0x0}, - 967: {region: 0x165, script: 0x57, flags: 0x0}, - 968: {region: 0x99, script: 0x21, flags: 0x0}, - 969: {region: 0x165, script: 0x57, flags: 0x0}, - 970: {region: 0x102, script: 0x57, flags: 0x0}, - 971: {region: 0x95, script: 0x57, flags: 0x0}, - 972: {region: 0x165, script: 0x57, flags: 0x0}, - 973: {region: 0x165, script: 0x57, flags: 0x0}, - 974: {region: 0x9e, script: 0x57, flags: 0x0}, - 975: {region: 0x165, script: 0x5, flags: 0x0}, - 976: {region: 0x99, script: 0x57, flags: 0x0}, - 977: {region: 0x31, script: 0x2, flags: 0x1}, - 978: {region: 0xdb, script: 0x21, flags: 0x0}, - 979: {region: 0x35, script: 0xe, flags: 0x0}, - 980: {region: 0x4e, script: 0x57, flags: 0x0}, - 981: {region: 0x72, script: 0x57, flags: 0x0}, - 982: {region: 0x4e, script: 0x57, flags: 0x0}, - 983: {region: 0x9c, script: 0x5, flags: 0x0}, - 984: {region: 0x10c, script: 0x57, flags: 0x0}, - 985: {region: 0x3a, script: 0x57, flags: 0x0}, - 986: {region: 0x165, script: 0x57, flags: 0x0}, - 987: {region: 0xd1, script: 0x57, flags: 0x0}, - 988: {region: 0x104, script: 0x57, flags: 0x0}, - 989: {region: 0x95, script: 0x57, flags: 0x0}, - 990: {region: 0x12f, script: 0x57, flags: 0x0}, - 991: {region: 0x165, script: 0x57, flags: 0x0}, - 992: {region: 0x165, script: 0x57, flags: 0x0}, - 993: {region: 0x73, script: 0x57, flags: 0x0}, - 994: {region: 0x106, script: 0x1f, flags: 0x0}, - 995: {region: 0x130, script: 0x1f, flags: 0x0}, - 996: {region: 0x109, script: 0x57, flags: 0x0}, - 997: {region: 0x107, script: 0x57, flags: 0x0}, - 998: {region: 0x12f, script: 0x57, flags: 0x0}, - 999: {region: 0x165, script: 0x57, flags: 0x0}, - 1000: {region: 0xa2, script: 0x49, flags: 0x0}, - 1001: {region: 0x99, script: 0x21, flags: 0x0}, - 1002: {region: 0x80, script: 0x57, flags: 0x0}, - 1003: {region: 0x106, script: 0x1f, flags: 0x0}, - 1004: {region: 0xa4, script: 0x57, flags: 0x0}, - 1005: {region: 0x95, script: 0x57, flags: 0x0}, - 1006: {region: 0x99, script: 0x57, flags: 0x0}, - 1007: {region: 0x114, script: 0x57, flags: 0x0}, - 1008: {region: 0x99, script: 0xc3, flags: 0x0}, - 1009: {region: 0x165, script: 0x57, flags: 0x0}, - 1010: {region: 0x165, script: 0x57, flags: 0x0}, - 1011: {region: 0x12f, script: 0x57, flags: 0x0}, - 1012: {region: 0x9e, script: 0x57, flags: 0x0}, - 1013: {region: 0x99, script: 0x21, flags: 0x0}, - 1014: {region: 0x165, script: 0x5, flags: 0x0}, - 1015: {region: 0x9e, script: 0x57, flags: 0x0}, - 1016: {region: 0x7b, script: 0x57, flags: 0x0}, - 1017: {region: 0x49, script: 0x57, flags: 0x0}, - 1018: {region: 0x33, script: 0x4, flags: 0x1}, - 1019: {region: 0x9e, script: 0x57, flags: 0x0}, - 1020: {region: 0x9c, script: 0x5, flags: 0x0}, - 1021: {region: 0xda, script: 0x57, flags: 0x0}, - 1022: {region: 0x4f, script: 0x57, flags: 0x0}, - 1023: {region: 0xd1, script: 0x57, flags: 0x0}, - 1024: {region: 0xcf, script: 0x57, flags: 0x0}, - 1025: {region: 0xc3, script: 0x57, flags: 0x0}, - 1026: {region: 0x4c, script: 0x57, flags: 0x0}, - 1027: {region: 0x96, script: 0x7a, flags: 0x0}, - 1028: {region: 0xb6, script: 0x57, flags: 0x0}, - 1029: {region: 0x165, script: 0x29, flags: 0x0}, - 1030: {region: 0x165, script: 0x57, flags: 0x0}, - 1032: {region: 0xba, script: 0xdc, flags: 0x0}, - 1033: {region: 0x165, script: 0x57, flags: 0x0}, - 1034: {region: 0xc4, script: 0x72, flags: 0x0}, - 1035: {region: 0x165, script: 0x5, flags: 0x0}, - 1036: {region: 0xb3, script: 0xca, flags: 0x0}, - 1037: {region: 0x6f, script: 0x57, flags: 0x0}, - 1038: {region: 0x165, script: 0x57, flags: 0x0}, - 1039: {region: 0x165, script: 0x57, flags: 0x0}, - 1040: {region: 0x165, script: 0x57, flags: 0x0}, - 1041: {region: 0x165, script: 0x57, flags: 0x0}, - 1042: {region: 0x111, script: 0x57, flags: 0x0}, - 1043: {region: 0x165, script: 0x57, flags: 0x0}, - 1044: {region: 0xe8, script: 0x5, flags: 0x0}, - 1045: {region: 0x165, script: 0x57, flags: 0x0}, - 1046: {region: 0x10f, script: 0x57, flags: 0x0}, - 1047: {region: 0x165, script: 0x57, flags: 0x0}, - 1048: {region: 0xe9, script: 0x57, flags: 0x0}, - 1049: {region: 0x165, script: 0x57, flags: 0x0}, - 1050: {region: 0x95, script: 0x57, flags: 0x0}, - 1051: {region: 0x142, script: 0x57, flags: 0x0}, - 1052: {region: 0x10c, script: 0x57, flags: 0x0}, - 1054: {region: 0x10c, script: 0x57, flags: 0x0}, - 1055: {region: 0x72, script: 0x57, flags: 0x0}, - 1056: {region: 0x97, script: 0xc0, flags: 0x0}, - 1057: {region: 0x165, script: 0x57, flags: 0x0}, - 1058: {region: 0x72, script: 0x57, flags: 0x0}, - 1059: {region: 0x164, script: 0x57, flags: 0x0}, - 1060: {region: 0x165, script: 0x57, flags: 0x0}, - 1061: {region: 0xc3, script: 0x57, flags: 0x0}, - 1062: {region: 0x165, script: 0x57, flags: 0x0}, - 1063: {region: 0x165, script: 0x57, flags: 0x0}, - 1064: {region: 0x165, script: 0x57, flags: 0x0}, - 1065: {region: 0x115, script: 0x57, flags: 0x0}, - 1066: {region: 0x165, script: 0x57, flags: 0x0}, - 1067: {region: 0x165, script: 0x57, flags: 0x0}, - 1068: {region: 0x123, script: 0xdf, flags: 0x0}, - 1069: {region: 0x165, script: 0x57, flags: 0x0}, - 1070: {region: 0x165, script: 0x57, flags: 0x0}, - 1071: {region: 0x165, script: 0x57, flags: 0x0}, - 1072: {region: 0x165, script: 0x57, flags: 0x0}, - 1073: {region: 0x27, script: 0x57, flags: 0x0}, - 1074: {region: 0x37, script: 0x5, flags: 0x1}, - 1075: {region: 0x99, script: 0xcb, flags: 0x0}, - 1076: {region: 0x116, script: 0x57, flags: 0x0}, - 1077: {region: 0x114, script: 0x57, flags: 0x0}, - 1078: {region: 0x99, script: 0x21, flags: 0x0}, - 1079: {region: 0x161, script: 0x57, flags: 0x0}, - 1080: {region: 0x165, script: 0x57, flags: 0x0}, - 1081: {region: 0x165, script: 0x57, flags: 0x0}, - 1082: {region: 0x6d, script: 0x57, flags: 0x0}, - 1083: {region: 0x161, script: 0x57, flags: 0x0}, - 1084: {region: 0x165, script: 0x57, flags: 0x0}, - 1085: {region: 0x60, script: 0x57, flags: 0x0}, - 1086: {region: 0x95, script: 0x57, flags: 0x0}, - 1087: {region: 0x165, script: 0x57, flags: 0x0}, - 1088: {region: 0x165, script: 0x57, flags: 0x0}, - 1089: {region: 0x12f, script: 0x57, flags: 0x0}, - 1090: {region: 0x165, script: 0x57, flags: 0x0}, - 1091: {region: 0x84, script: 0x57, flags: 0x0}, - 1092: {region: 0x10c, script: 0x57, flags: 0x0}, - 1093: {region: 0x12f, script: 0x57, flags: 0x0}, - 1094: {region: 0x15f, script: 0x5, flags: 0x0}, - 1095: {region: 0x4b, script: 0x57, flags: 0x0}, - 1096: {region: 0x60, script: 0x57, flags: 0x0}, - 1097: {region: 0x165, script: 0x57, flags: 0x0}, - 1098: {region: 0x99, script: 0x21, flags: 0x0}, - 1099: {region: 0x95, script: 0x57, flags: 0x0}, - 1100: {region: 0x165, script: 0x57, flags: 0x0}, - 1101: {region: 0x35, script: 0xe, flags: 0x0}, - 1102: {region: 0x9b, script: 0xcf, flags: 0x0}, - 1103: {region: 0xe9, script: 0x57, flags: 0x0}, - 1104: {region: 0x99, script: 0xd7, flags: 0x0}, - 1105: {region: 0xdb, script: 0x21, flags: 0x0}, - 1106: {region: 0x165, script: 0x57, flags: 0x0}, - 1107: {region: 0x165, script: 0x57, flags: 0x0}, - 1108: {region: 0x165, script: 0x57, flags: 0x0}, - 1109: {region: 0x165, script: 0x57, flags: 0x0}, - 1110: {region: 0x165, script: 0x57, flags: 0x0}, - 1111: {region: 0x165, script: 0x57, flags: 0x0}, - 1112: {region: 0x165, script: 0x57, flags: 0x0}, - 1113: {region: 0x165, script: 0x57, flags: 0x0}, - 1114: {region: 0xe7, script: 0x57, flags: 0x0}, - 1115: {region: 0x165, script: 0x57, flags: 0x0}, - 1116: {region: 0x165, script: 0x57, flags: 0x0}, - 1117: {region: 0x99, script: 0x4f, flags: 0x0}, - 1118: {region: 0x53, script: 0xd5, flags: 0x0}, - 1119: {region: 0xdb, script: 0x21, flags: 0x0}, - 1120: {region: 0xdb, script: 0x21, flags: 0x0}, - 1121: {region: 0x99, script: 0xda, flags: 0x0}, - 1122: {region: 0x165, script: 0x57, flags: 0x0}, - 1123: {region: 0x112, script: 0x57, flags: 0x0}, - 1124: {region: 0x131, script: 0x57, flags: 0x0}, - 1125: {region: 0x126, script: 0x57, flags: 0x0}, - 1126: {region: 0x165, script: 0x57, flags: 0x0}, - 1127: {region: 0x3c, script: 0x3, flags: 0x1}, - 1128: {region: 0x165, script: 0x57, flags: 0x0}, - 1129: {region: 0x165, script: 0x57, flags: 0x0}, - 1130: {region: 0x165, script: 0x57, flags: 0x0}, - 1131: {region: 0x123, script: 0xdf, flags: 0x0}, - 1132: {region: 0xdb, script: 0x21, flags: 0x0}, - 1133: {region: 0xdb, script: 0x21, flags: 0x0}, - 1134: {region: 0xdb, script: 0x21, flags: 0x0}, - 1135: {region: 0x6f, script: 0x29, flags: 0x0}, - 1136: {region: 0x165, script: 0x57, flags: 0x0}, - 1137: {region: 0x6d, script: 0x29, flags: 0x0}, - 1138: {region: 0x165, script: 0x57, flags: 0x0}, - 1139: {region: 0x165, script: 0x57, flags: 0x0}, - 1140: {region: 0x165, script: 0x57, flags: 0x0}, - 1141: {region: 0xd6, script: 0x57, flags: 0x0}, - 1142: {region: 0x127, script: 0x57, flags: 0x0}, - 1143: {region: 0x125, script: 0x57, flags: 0x0}, - 1144: {region: 0x32, script: 0x57, flags: 0x0}, - 1145: {region: 0xdb, script: 0x21, flags: 0x0}, - 1146: {region: 0xe7, script: 0x57, flags: 0x0}, - 1147: {region: 0x165, script: 0x57, flags: 0x0}, - 1148: {region: 0x165, script: 0x57, flags: 0x0}, - 1149: {region: 0x32, script: 0x57, flags: 0x0}, - 1150: {region: 0xd4, script: 0x57, flags: 0x0}, - 1151: {region: 0x165, script: 0x57, flags: 0x0}, - 1152: {region: 0x161, script: 0x57, flags: 0x0}, - 1153: {region: 0x165, script: 0x57, flags: 0x0}, - 1154: {region: 0x129, script: 0x57, flags: 0x0}, - 1155: {region: 0x165, script: 0x57, flags: 0x0}, - 1156: {region: 0xce, script: 0x57, flags: 0x0}, - 1157: {region: 0x165, script: 0x57, flags: 0x0}, - 1158: {region: 0xe6, script: 0x57, flags: 0x0}, - 1159: {region: 0x165, script: 0x57, flags: 0x0}, - 1160: {region: 0x165, script: 0x57, flags: 0x0}, - 1161: {region: 0x165, script: 0x57, flags: 0x0}, - 1162: {region: 0x12b, script: 0x57, flags: 0x0}, - 1163: {region: 0x12b, script: 0x57, flags: 0x0}, - 1164: {region: 0x12e, script: 0x57, flags: 0x0}, - 1165: {region: 0x165, script: 0x5, flags: 0x0}, - 1166: {region: 0x161, script: 0x57, flags: 0x0}, - 1167: {region: 0x87, script: 0x31, flags: 0x0}, - 1168: {region: 0xdb, script: 0x21, flags: 0x0}, - 1169: {region: 0xe7, script: 0x57, flags: 0x0}, - 1170: {region: 0x43, script: 0xe0, flags: 0x0}, - 1171: {region: 0x165, script: 0x57, flags: 0x0}, - 1172: {region: 0x106, script: 0x1f, flags: 0x0}, - 1173: {region: 0x165, script: 0x57, flags: 0x0}, - 1174: {region: 0x165, script: 0x57, flags: 0x0}, - 1175: {region: 0x131, script: 0x57, flags: 0x0}, - 1176: {region: 0x165, script: 0x57, flags: 0x0}, - 1177: {region: 0x123, script: 0xdf, flags: 0x0}, - 1178: {region: 0x32, script: 0x57, flags: 0x0}, - 1179: {region: 0x165, script: 0x57, flags: 0x0}, - 1180: {region: 0x165, script: 0x57, flags: 0x0}, - 1181: {region: 0xce, script: 0x57, flags: 0x0}, - 1182: {region: 0x165, script: 0x57, flags: 0x0}, - 1183: {region: 0x165, script: 0x57, flags: 0x0}, - 1184: {region: 0x12d, script: 0x57, flags: 0x0}, - 1185: {region: 0x165, script: 0x57, flags: 0x0}, - 1187: {region: 0x165, script: 0x57, flags: 0x0}, - 1188: {region: 0xd4, script: 0x57, flags: 0x0}, - 1189: {region: 0x53, script: 0xd8, flags: 0x0}, - 1190: {region: 0xe5, script: 0x57, flags: 0x0}, - 1191: {region: 0x165, script: 0x57, flags: 0x0}, - 1192: {region: 0x106, script: 0x1f, flags: 0x0}, - 1193: {region: 0xba, script: 0x57, flags: 0x0}, - 1194: {region: 0x165, script: 0x57, flags: 0x0}, - 1195: {region: 0x106, script: 0x1f, flags: 0x0}, - 1196: {region: 0x3f, script: 0x4, flags: 0x1}, - 1197: {region: 0x11c, script: 0xe2, flags: 0x0}, - 1198: {region: 0x130, script: 0x1f, flags: 0x0}, - 1199: {region: 0x75, script: 0x57, flags: 0x0}, - 1200: {region: 0x2a, script: 0x57, flags: 0x0}, - 1202: {region: 0x43, script: 0x3, flags: 0x1}, - 1203: {region: 0x99, script: 0xe, flags: 0x0}, - 1204: {region: 0xe8, script: 0x5, flags: 0x0}, - 1205: {region: 0x165, script: 0x57, flags: 0x0}, - 1206: {region: 0x165, script: 0x57, flags: 0x0}, - 1207: {region: 0x165, script: 0x57, flags: 0x0}, - 1208: {region: 0x165, script: 0x57, flags: 0x0}, - 1209: {region: 0x165, script: 0x57, flags: 0x0}, - 1210: {region: 0x165, script: 0x57, flags: 0x0}, - 1211: {region: 0x165, script: 0x57, flags: 0x0}, - 1212: {region: 0x46, script: 0x4, flags: 0x1}, - 1213: {region: 0x165, script: 0x57, flags: 0x0}, - 1214: {region: 0xb4, script: 0xe3, flags: 0x0}, - 1215: {region: 0x165, script: 0x57, flags: 0x0}, - 1216: {region: 0x161, script: 0x57, flags: 0x0}, - 1217: {region: 0x9e, script: 0x57, flags: 0x0}, - 1218: {region: 0x106, script: 0x57, flags: 0x0}, - 1219: {region: 0x13e, script: 0x57, flags: 0x0}, - 1220: {region: 0x11b, script: 0x57, flags: 0x0}, - 1221: {region: 0x165, script: 0x57, flags: 0x0}, - 1222: {region: 0x36, script: 0x57, flags: 0x0}, - 1223: {region: 0x60, script: 0x57, flags: 0x0}, - 1224: {region: 0xd1, script: 0x57, flags: 0x0}, - 1225: {region: 0x1, script: 0x57, flags: 0x0}, - 1226: {region: 0x106, script: 0x57, flags: 0x0}, - 1227: {region: 0x6a, script: 0x57, flags: 0x0}, - 1228: {region: 0x12f, script: 0x57, flags: 0x0}, - 1229: {region: 0x165, script: 0x57, flags: 0x0}, - 1230: {region: 0x36, script: 0x57, flags: 0x0}, - 1231: {region: 0x4e, script: 0x57, flags: 0x0}, - 1232: {region: 0x165, script: 0x57, flags: 0x0}, - 1233: {region: 0x6f, script: 0x29, flags: 0x0}, - 1234: {region: 0x165, script: 0x57, flags: 0x0}, - 1235: {region: 0xe7, script: 0x57, flags: 0x0}, - 1236: {region: 0x2f, script: 0x57, flags: 0x0}, - 1237: {region: 0x99, script: 0xda, flags: 0x0}, - 1238: {region: 0x99, script: 0x21, flags: 0x0}, - 1239: {region: 0x165, script: 0x57, flags: 0x0}, - 1240: {region: 0x165, script: 0x57, flags: 0x0}, - 1241: {region: 0x165, script: 0x57, flags: 0x0}, - 1242: {region: 0x165, script: 0x57, flags: 0x0}, - 1243: {region: 0x165, script: 0x57, flags: 0x0}, - 1244: {region: 0x165, script: 0x57, flags: 0x0}, - 1245: {region: 0x165, script: 0x57, flags: 0x0}, - 1246: {region: 0x165, script: 0x57, flags: 0x0}, - 1247: {region: 0x165, script: 0x57, flags: 0x0}, - 1248: {region: 0x140, script: 0x57, flags: 0x0}, - 1249: {region: 0x165, script: 0x57, flags: 0x0}, - 1250: {region: 0x165, script: 0x57, flags: 0x0}, - 1251: {region: 0xa8, script: 0x5, flags: 0x0}, - 1252: {region: 0x165, script: 0x57, flags: 0x0}, - 1253: {region: 0x114, script: 0x57, flags: 0x0}, - 1254: {region: 0x165, script: 0x57, flags: 0x0}, - 1255: {region: 0x165, script: 0x57, flags: 0x0}, - 1256: {region: 0x165, script: 0x57, flags: 0x0}, - 1257: {region: 0x165, script: 0x57, flags: 0x0}, - 1258: {region: 0x99, script: 0x21, flags: 0x0}, - 1259: {region: 0x53, script: 0x38, flags: 0x0}, - 1260: {region: 0x165, script: 0x57, flags: 0x0}, - 1261: {region: 0x165, script: 0x57, flags: 0x0}, - 1262: {region: 0x41, script: 0x57, flags: 0x0}, - 1263: {region: 0x165, script: 0x57, flags: 0x0}, - 1264: {region: 0x12b, script: 0x18, flags: 0x0}, - 1265: {region: 0x165, script: 0x57, flags: 0x0}, - 1266: {region: 0x161, script: 0x57, flags: 0x0}, - 1267: {region: 0x165, script: 0x57, flags: 0x0}, - 1268: {region: 0x12b, script: 0x5f, flags: 0x0}, - 1269: {region: 0x12b, script: 0x60, flags: 0x0}, - 1270: {region: 0x7d, script: 0x2b, flags: 0x0}, - 1271: {region: 0x53, script: 0x64, flags: 0x0}, - 1272: {region: 0x10b, script: 0x69, flags: 0x0}, - 1273: {region: 0x108, script: 0x73, flags: 0x0}, - 1274: {region: 0x99, script: 0x21, flags: 0x0}, - 1275: {region: 0x131, script: 0x57, flags: 0x0}, - 1276: {region: 0x165, script: 0x57, flags: 0x0}, - 1277: {region: 0x9c, script: 0x8a, flags: 0x0}, - 1278: {region: 0x165, script: 0x57, flags: 0x0}, - 1279: {region: 0x15e, script: 0xc2, flags: 0x0}, - 1280: {region: 0x165, script: 0x57, flags: 0x0}, - 1281: {region: 0x165, script: 0x57, flags: 0x0}, - 1282: {region: 0xdb, script: 0x21, flags: 0x0}, - 1283: {region: 0x165, script: 0x57, flags: 0x0}, - 1284: {region: 0x165, script: 0x57, flags: 0x0}, - 1285: {region: 0xd1, script: 0x57, flags: 0x0}, - 1286: {region: 0x75, script: 0x57, flags: 0x0}, - 1287: {region: 0x165, script: 0x57, flags: 0x0}, - 1288: {region: 0x165, script: 0x57, flags: 0x0}, - 1289: {region: 0x52, script: 0x57, flags: 0x0}, - 1290: {region: 0x165, script: 0x57, flags: 0x0}, - 1291: {region: 0x165, script: 0x57, flags: 0x0}, - 1292: {region: 0x165, script: 0x57, flags: 0x0}, - 1293: {region: 0x52, script: 0x57, flags: 0x0}, - 1294: {region: 0x165, script: 0x57, flags: 0x0}, - 1295: {region: 0x165, script: 0x57, flags: 0x0}, - 1296: {region: 0x165, script: 0x57, flags: 0x0}, - 1297: {region: 0x165, script: 0x57, flags: 0x0}, - 1298: {region: 0x1, script: 0x3b, flags: 0x0}, - 1299: {region: 0x165, script: 0x57, flags: 0x0}, - 1300: {region: 0x165, script: 0x57, flags: 0x0}, - 1301: {region: 0x165, script: 0x57, flags: 0x0}, - 1302: {region: 0x165, script: 0x57, flags: 0x0}, - 1303: {region: 0x165, script: 0x57, flags: 0x0}, - 1304: {region: 0xd6, script: 0x57, flags: 0x0}, - 1305: {region: 0x165, script: 0x57, flags: 0x0}, - 1306: {region: 0x165, script: 0x57, flags: 0x0}, - 1307: {region: 0x165, script: 0x57, flags: 0x0}, - 1308: {region: 0x41, script: 0x57, flags: 0x0}, - 1309: {region: 0x165, script: 0x57, flags: 0x0}, - 1310: {region: 0xcf, script: 0x57, flags: 0x0}, - 1311: {region: 0x4a, script: 0x3, flags: 0x1}, - 1312: {region: 0x165, script: 0x57, flags: 0x0}, - 1313: {region: 0x165, script: 0x57, flags: 0x0}, - 1314: {region: 0x165, script: 0x57, flags: 0x0}, - 1315: {region: 0x53, script: 0x57, flags: 0x0}, - 1316: {region: 0x10b, script: 0x57, flags: 0x0}, - 1318: {region: 0xa8, script: 0x5, flags: 0x0}, - 1319: {region: 0xd9, script: 0x57, flags: 0x0}, - 1320: {region: 0xba, script: 0xdc, flags: 0x0}, - 1321: {region: 0x4d, script: 0x14, flags: 0x1}, - 1322: {region: 0x53, script: 0x79, flags: 0x0}, - 1323: {region: 0x165, script: 0x57, flags: 0x0}, - 1324: {region: 0x122, script: 0x57, flags: 0x0}, - 1325: {region: 0xd0, script: 0x57, flags: 0x0}, - 1326: {region: 0x165, script: 0x57, flags: 0x0}, - 1327: {region: 0x161, script: 0x57, flags: 0x0}, - 1329: {region: 0x12b, script: 0x57, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 388 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9c, script: 0x7, flags: 0x0}, - 1: {region: 0xa1, script: 0x74, flags: 0x2}, - 2: {region: 0x11c, script: 0x80, flags: 0x2}, - 3: {region: 0x32, script: 0x57, flags: 0x0}, - 4: {region: 0x9b, script: 0x5, flags: 0x4}, - 5: {region: 0x9c, script: 0x5, flags: 0x4}, - 6: {region: 0x106, script: 0x1f, flags: 0x4}, - 7: {region: 0x9c, script: 0x5, flags: 0x2}, - 8: {region: 0x106, script: 0x1f, flags: 0x0}, - 9: {region: 0x38, script: 0x2c, flags: 0x2}, - 10: {region: 0x135, script: 0x57, flags: 0x0}, - 11: {region: 0x7b, script: 0xc5, flags: 0x2}, - 12: {region: 0x114, script: 0x57, flags: 0x0}, - 13: {region: 0x84, script: 0x1, flags: 0x2}, - 14: {region: 0x5d, script: 0x1e, flags: 0x0}, - 15: {region: 0x87, script: 0x5c, flags: 0x2}, - 16: {region: 0xd6, script: 0x57, flags: 0x0}, - 17: {region: 0x52, script: 0x5, flags: 0x4}, - 18: {region: 0x10b, script: 0x5, flags: 0x4}, - 19: {region: 0xae, script: 0x1f, flags: 0x0}, - 20: {region: 0x24, script: 0x5, flags: 0x4}, - 21: {region: 0x53, script: 0x5, flags: 0x4}, - 22: {region: 0x9c, script: 0x5, flags: 0x4}, - 23: {region: 0xc5, script: 0x5, flags: 0x4}, - 24: {region: 0x53, script: 0x5, flags: 0x2}, - 25: {region: 0x12b, script: 0x57, flags: 0x0}, - 26: {region: 0xb0, script: 0x5, flags: 0x4}, - 27: {region: 0x9b, script: 0x5, flags: 0x2}, - 28: {region: 0xa5, script: 0x1f, flags: 0x0}, - 29: {region: 0x53, script: 0x5, flags: 0x4}, - 30: {region: 0x12b, script: 0x57, flags: 0x4}, - 31: {region: 0x53, script: 0x5, flags: 0x2}, - 32: {region: 0x12b, script: 0x57, flags: 0x2}, - 33: {region: 0xdb, script: 0x21, flags: 0x0}, - 34: {region: 0x99, script: 0x5a, flags: 0x2}, - 35: {region: 0x83, script: 0x57, flags: 0x0}, - 36: {region: 0x84, script: 0x78, flags: 0x4}, - 37: {region: 0x84, script: 0x78, flags: 0x2}, - 38: {region: 0xc5, script: 0x1f, flags: 0x0}, - 39: {region: 0x53, script: 0x6d, flags: 0x4}, - 40: {region: 0x53, script: 0x6d, flags: 0x2}, - 41: {region: 0xd0, script: 0x57, flags: 0x0}, - 42: {region: 0x4a, script: 0x5, flags: 0x4}, - 43: {region: 0x95, script: 0x5, flags: 0x4}, - 44: {region: 0x99, script: 0x33, flags: 0x0}, - 45: {region: 0xe8, script: 0x5, flags: 0x4}, - 46: {region: 0xe8, script: 0x5, flags: 0x2}, - 47: {region: 0x9c, script: 0x84, flags: 0x0}, - 48: {region: 0x53, script: 0x85, flags: 0x2}, - 49: {region: 0xba, script: 0xdc, flags: 0x0}, - 50: {region: 0xd9, script: 0x57, flags: 0x4}, - 51: {region: 0xe8, script: 0x5, flags: 0x0}, - 52: {region: 0x99, script: 0x21, flags: 0x2}, - 53: {region: 0x99, script: 0x4c, flags: 0x2}, - 54: {region: 0x99, script: 0xc9, flags: 0x2}, - 55: {region: 0x105, script: 0x1f, flags: 0x0}, - 56: {region: 0xbd, script: 0x57, flags: 0x4}, - 57: {region: 0x104, script: 0x57, flags: 0x4}, - 58: {region: 0x106, script: 0x57, flags: 0x4}, - 59: {region: 0x12b, script: 0x57, flags: 0x4}, - 60: {region: 0x124, script: 0x1f, flags: 0x0}, - 61: {region: 0xe8, script: 0x5, flags: 0x4}, - 62: {region: 0xe8, script: 0x5, flags: 0x2}, - 63: {region: 0x53, script: 0x5, flags: 0x0}, - 64: {region: 0xae, script: 0x1f, flags: 0x4}, - 65: {region: 0xc5, script: 0x1f, flags: 0x4}, - 66: {region: 0xae, script: 0x1f, flags: 0x2}, - 67: {region: 0x99, script: 0xe, flags: 0x0}, - 68: {region: 0xdb, script: 0x21, flags: 0x4}, - 69: {region: 0xdb, script: 0x21, flags: 0x2}, - 70: {region: 0x137, script: 0x57, flags: 0x0}, - 71: {region: 0x24, script: 0x5, flags: 0x4}, - 72: {region: 0x53, script: 0x1f, flags: 0x4}, - 73: {region: 0x24, script: 0x5, flags: 0x2}, - 74: {region: 0x8d, script: 0x39, flags: 0x0}, - 75: {region: 0x53, script: 0x38, flags: 0x4}, - 76: {region: 0x53, script: 0x38, flags: 0x2}, - 77: {region: 0x53, script: 0x38, flags: 0x0}, - 78: {region: 0x2f, script: 0x39, flags: 0x4}, - 79: {region: 0x3e, script: 0x39, flags: 0x4}, - 80: {region: 0x7b, script: 0x39, flags: 0x4}, - 81: {region: 0x7e, script: 0x39, flags: 0x4}, - 82: {region: 0x8d, script: 0x39, flags: 0x4}, - 83: {region: 0x95, script: 0x39, flags: 0x4}, - 84: {region: 0xc6, script: 0x39, flags: 0x4}, - 85: {region: 0xd0, script: 0x39, flags: 0x4}, - 86: {region: 0xe2, script: 0x39, flags: 0x4}, - 87: {region: 0xe5, script: 0x39, flags: 0x4}, - 88: {region: 0xe7, script: 0x39, flags: 0x4}, - 89: {region: 0x116, script: 0x39, flags: 0x4}, - 90: {region: 0x123, script: 0x39, flags: 0x4}, - 91: {region: 0x12e, script: 0x39, flags: 0x4}, - 92: {region: 0x135, script: 0x39, flags: 0x4}, - 93: {region: 0x13e, script: 0x39, flags: 0x4}, - 94: {region: 0x12e, script: 0x11, flags: 0x2}, - 95: {region: 0x12e, script: 0x34, flags: 0x2}, - 96: {region: 0x12e, script: 0x39, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 1432 bytes, 358 elements -var likelyRegion = [358]likelyLangScript{ - 34: {lang: 0xd7, script: 0x57, flags: 0x0}, - 35: {lang: 0x3a, script: 0x5, flags: 0x0}, - 36: {lang: 0x0, script: 0x2, flags: 0x1}, - 39: {lang: 0x2, script: 0x2, flags: 0x1}, - 40: {lang: 0x4, script: 0x2, flags: 0x1}, - 42: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 43: {lang: 0x0, script: 0x57, flags: 0x0}, - 44: {lang: 0x13e, script: 0x57, flags: 0x0}, - 45: {lang: 0x41b, script: 0x57, flags: 0x0}, - 46: {lang: 0x10d, script: 0x57, flags: 0x0}, - 48: {lang: 0x367, script: 0x57, flags: 0x0}, - 49: {lang: 0x444, script: 0x57, flags: 0x0}, - 50: {lang: 0x58, script: 0x57, flags: 0x0}, - 51: {lang: 0x6, script: 0x2, flags: 0x1}, - 53: {lang: 0xa5, script: 0xe, flags: 0x0}, - 54: {lang: 0x367, script: 0x57, flags: 0x0}, - 55: {lang: 0x15e, script: 0x57, flags: 0x0}, - 56: {lang: 0x7e, script: 0x1f, flags: 0x0}, - 57: {lang: 0x3a, script: 0x5, flags: 0x0}, - 58: {lang: 0x3d9, script: 0x57, flags: 0x0}, - 59: {lang: 0x15e, script: 0x57, flags: 0x0}, - 60: {lang: 0x15e, script: 0x57, flags: 0x0}, - 62: {lang: 0x31f, script: 0x57, flags: 0x0}, - 63: {lang: 0x13e, script: 0x57, flags: 0x0}, - 64: {lang: 0x3a1, script: 0x57, flags: 0x0}, - 65: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 67: {lang: 0x8, script: 0x2, flags: 0x1}, - 69: {lang: 0x0, script: 0x57, flags: 0x0}, - 71: {lang: 0x71, script: 0x1f, flags: 0x0}, - 73: {lang: 0x512, script: 0x3b, flags: 0x2}, - 74: {lang: 0x31f, script: 0x5, flags: 0x2}, - 75: {lang: 0x445, script: 0x57, flags: 0x0}, - 76: {lang: 0x15e, script: 0x57, flags: 0x0}, - 77: {lang: 0x15e, script: 0x57, flags: 0x0}, - 78: {lang: 0x10d, script: 0x57, flags: 0x0}, - 79: {lang: 0x15e, script: 0x57, flags: 0x0}, - 81: {lang: 0x13e, script: 0x57, flags: 0x0}, - 82: {lang: 0x15e, script: 0x57, flags: 0x0}, - 83: {lang: 0xa, script: 0x4, flags: 0x1}, - 84: {lang: 0x13e, script: 0x57, flags: 0x0}, - 85: {lang: 0x0, script: 0x57, flags: 0x0}, - 86: {lang: 0x13e, script: 0x57, flags: 0x0}, - 89: {lang: 0x13e, script: 0x57, flags: 0x0}, - 90: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 91: {lang: 0x3a1, script: 0x57, flags: 0x0}, - 93: {lang: 0xe, script: 0x2, flags: 0x1}, - 94: {lang: 0xfa, script: 0x57, flags: 0x0}, - 96: {lang: 0x10d, script: 0x57, flags: 0x0}, - 98: {lang: 0x1, script: 0x57, flags: 0x0}, - 99: {lang: 0x101, script: 0x57, flags: 0x0}, - 101: {lang: 0x13e, script: 0x57, flags: 0x0}, - 103: {lang: 0x10, script: 0x2, flags: 0x1}, - 104: {lang: 0x13e, script: 0x57, flags: 0x0}, - 105: {lang: 0x13e, script: 0x57, flags: 0x0}, - 106: {lang: 0x140, script: 0x57, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, - 108: {lang: 0x3a, script: 0x5, flags: 0x0}, - 109: {lang: 0x46f, script: 0x29, flags: 0x0}, - 110: {lang: 0x13e, script: 0x57, flags: 0x0}, - 111: {lang: 0x12, script: 0x2, flags: 0x1}, - 113: {lang: 0x10d, script: 0x57, flags: 0x0}, - 114: {lang: 0x151, script: 0x57, flags: 0x0}, - 115: {lang: 0x1c0, script: 0x21, flags: 0x2}, - 118: {lang: 0x158, script: 0x57, flags: 0x0}, - 120: {lang: 0x15e, script: 0x57, flags: 0x0}, - 122: {lang: 0x15e, script: 0x57, flags: 0x0}, - 123: {lang: 0x14, script: 0x2, flags: 0x1}, - 125: {lang: 0x16, script: 0x3, flags: 0x1}, - 126: {lang: 0x15e, script: 0x57, flags: 0x0}, - 128: {lang: 0x21, script: 0x57, flags: 0x0}, - 130: {lang: 0x245, script: 0x57, flags: 0x0}, - 132: {lang: 0x15e, script: 0x57, flags: 0x0}, - 133: {lang: 0x15e, script: 0x57, flags: 0x0}, - 134: {lang: 0x13e, script: 0x57, flags: 0x0}, - 135: {lang: 0x19, script: 0x2, flags: 0x1}, - 136: {lang: 0x0, script: 0x57, flags: 0x0}, - 137: {lang: 0x13e, script: 0x57, flags: 0x0}, - 139: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 141: {lang: 0x529, script: 0x39, flags: 0x0}, - 142: {lang: 0x0, script: 0x57, flags: 0x0}, - 143: {lang: 0x13e, script: 0x57, flags: 0x0}, - 144: {lang: 0x1d1, script: 0x57, flags: 0x0}, - 145: {lang: 0x1d4, script: 0x57, flags: 0x0}, - 146: {lang: 0x1d5, script: 0x57, flags: 0x0}, - 148: {lang: 0x13e, script: 0x57, flags: 0x0}, - 149: {lang: 0x1b, script: 0x2, flags: 0x1}, - 151: {lang: 0x1bc, script: 0x3b, flags: 0x0}, - 153: {lang: 0x1d, script: 0x3, flags: 0x1}, - 155: {lang: 0x3a, script: 0x5, flags: 0x0}, - 156: {lang: 0x20, script: 0x2, flags: 0x1}, - 157: {lang: 0x1f8, script: 0x57, flags: 0x0}, - 158: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 161: {lang: 0x3a, script: 0x5, flags: 0x0}, - 162: {lang: 0x200, script: 0x46, flags: 0x0}, - 164: {lang: 0x445, script: 0x57, flags: 0x0}, - 165: {lang: 0x28a, script: 0x1f, flags: 0x0}, - 166: {lang: 0x22, script: 0x3, flags: 0x1}, - 168: {lang: 0x25, script: 0x2, flags: 0x1}, - 170: {lang: 0x254, script: 0x50, flags: 0x0}, - 171: {lang: 0x254, script: 0x50, flags: 0x0}, - 172: {lang: 0x3a, script: 0x5, flags: 0x0}, - 174: {lang: 0x3e2, script: 0x1f, flags: 0x0}, - 175: {lang: 0x27, script: 0x2, flags: 0x1}, - 176: {lang: 0x3a, script: 0x5, flags: 0x0}, - 178: {lang: 0x10d, script: 0x57, flags: 0x0}, - 179: {lang: 0x40c, script: 0xca, flags: 0x0}, - 181: {lang: 0x43b, script: 0x57, flags: 0x0}, - 182: {lang: 0x2c0, script: 0x57, flags: 0x0}, - 183: {lang: 0x15e, script: 0x57, flags: 0x0}, - 184: {lang: 0x2c7, script: 0x57, flags: 0x0}, - 185: {lang: 0x3a, script: 0x5, flags: 0x0}, - 186: {lang: 0x29, script: 0x2, flags: 0x1}, - 187: {lang: 0x15e, script: 0x57, flags: 0x0}, - 188: {lang: 0x2b, script: 0x2, flags: 0x1}, - 189: {lang: 0x432, script: 0x57, flags: 0x0}, - 190: {lang: 0x15e, script: 0x57, flags: 0x0}, - 191: {lang: 0x2f1, script: 0x57, flags: 0x0}, - 194: {lang: 0x2d, script: 0x2, flags: 0x1}, - 195: {lang: 0xa0, script: 0x57, flags: 0x0}, - 196: {lang: 0x2f, script: 0x2, flags: 0x1}, - 197: {lang: 0x31, script: 0x2, flags: 0x1}, - 198: {lang: 0x33, script: 0x2, flags: 0x1}, - 200: {lang: 0x15e, script: 0x57, flags: 0x0}, - 201: {lang: 0x35, script: 0x2, flags: 0x1}, - 203: {lang: 0x320, script: 0x57, flags: 0x0}, - 204: {lang: 0x37, script: 0x3, flags: 0x1}, - 205: {lang: 0x128, script: 0xde, flags: 0x0}, - 207: {lang: 0x13e, script: 0x57, flags: 0x0}, - 208: {lang: 0x31f, script: 0x57, flags: 0x0}, - 209: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 210: {lang: 0x16, script: 0x57, flags: 0x0}, - 211: {lang: 0x15e, script: 0x57, flags: 0x0}, - 212: {lang: 0x1b4, script: 0x57, flags: 0x0}, - 214: {lang: 0x1b4, script: 0x5, flags: 0x2}, - 216: {lang: 0x13e, script: 0x57, flags: 0x0}, - 217: {lang: 0x367, script: 0x57, flags: 0x0}, - 218: {lang: 0x347, script: 0x57, flags: 0x0}, - 219: {lang: 0x351, script: 0x21, flags: 0x0}, - 225: {lang: 0x3a, script: 0x5, flags: 0x0}, - 226: {lang: 0x13e, script: 0x57, flags: 0x0}, - 228: {lang: 0x13e, script: 0x57, flags: 0x0}, - 229: {lang: 0x15e, script: 0x57, flags: 0x0}, - 230: {lang: 0x486, script: 0x57, flags: 0x0}, - 231: {lang: 0x153, script: 0x57, flags: 0x0}, - 232: {lang: 0x3a, script: 0x3, flags: 0x1}, - 233: {lang: 0x3b3, script: 0x57, flags: 0x0}, - 234: {lang: 0x15e, script: 0x57, flags: 0x0}, - 236: {lang: 0x13e, script: 0x57, flags: 0x0}, - 237: {lang: 0x3a, script: 0x5, flags: 0x0}, - 238: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 240: {lang: 0x3a2, script: 0x57, flags: 0x0}, - 241: {lang: 0x194, script: 0x57, flags: 0x0}, - 243: {lang: 0x3a, script: 0x5, flags: 0x0}, - 258: {lang: 0x15e, script: 0x57, flags: 0x0}, - 260: {lang: 0x3d, script: 0x2, flags: 0x1}, - 261: {lang: 0x432, script: 0x1f, flags: 0x0}, - 262: {lang: 0x3f, script: 0x2, flags: 0x1}, - 263: {lang: 0x3e5, script: 0x57, flags: 0x0}, - 264: {lang: 0x3a, script: 0x5, flags: 0x0}, - 266: {lang: 0x15e, script: 0x57, flags: 0x0}, - 267: {lang: 0x3a, script: 0x5, flags: 0x0}, - 268: {lang: 0x41, script: 0x2, flags: 0x1}, - 271: {lang: 0x416, script: 0x57, flags: 0x0}, - 272: {lang: 0x347, script: 0x57, flags: 0x0}, - 273: {lang: 0x43, script: 0x2, flags: 0x1}, - 275: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 276: {lang: 0x15e, script: 0x57, flags: 0x0}, - 277: {lang: 0x429, script: 0x57, flags: 0x0}, - 278: {lang: 0x367, script: 0x57, flags: 0x0}, - 280: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 282: {lang: 0x13e, script: 0x57, flags: 0x0}, - 284: {lang: 0x45, script: 0x2, flags: 0x1}, - 288: {lang: 0x15e, script: 0x57, flags: 0x0}, - 289: {lang: 0x15e, script: 0x57, flags: 0x0}, - 290: {lang: 0x47, script: 0x2, flags: 0x1}, - 291: {lang: 0x49, script: 0x3, flags: 0x1}, - 292: {lang: 0x4c, script: 0x2, flags: 0x1}, - 293: {lang: 0x477, script: 0x57, flags: 0x0}, - 294: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 295: {lang: 0x476, script: 0x57, flags: 0x0}, - 296: {lang: 0x4e, script: 0x2, flags: 0x1}, - 297: {lang: 0x482, script: 0x57, flags: 0x0}, - 299: {lang: 0x50, script: 0x4, flags: 0x1}, - 301: {lang: 0x4a0, script: 0x57, flags: 0x0}, - 302: {lang: 0x54, script: 0x2, flags: 0x1}, - 303: {lang: 0x445, script: 0x57, flags: 0x0}, - 304: {lang: 0x56, script: 0x3, flags: 0x1}, - 305: {lang: 0x445, script: 0x57, flags: 0x0}, - 309: {lang: 0x512, script: 0x3b, flags: 0x2}, - 310: {lang: 0x13e, script: 0x57, flags: 0x0}, - 311: {lang: 0x4bc, script: 0x57, flags: 0x0}, - 312: {lang: 0x1f9, script: 0x57, flags: 0x0}, - 315: {lang: 0x13e, script: 0x57, flags: 0x0}, - 318: {lang: 0x4c3, script: 0x57, flags: 0x0}, - 319: {lang: 0x8a, script: 0x57, flags: 0x0}, - 320: {lang: 0x15e, script: 0x57, flags: 0x0}, - 322: {lang: 0x41b, script: 0x57, flags: 0x0}, - 333: {lang: 0x59, script: 0x2, flags: 0x1}, - 350: {lang: 0x3a, script: 0x5, flags: 0x0}, - 351: {lang: 0x5b, script: 0x2, flags: 0x1}, - 356: {lang: 0x423, script: 0x57, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 372 bytes, 93 elements -var likelyRegionList = [93]likelyLangScript{ - 0: {lang: 0x148, script: 0x5, flags: 0x0}, - 1: {lang: 0x476, script: 0x57, flags: 0x0}, - 2: {lang: 0x431, script: 0x57, flags: 0x0}, - 3: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 4: {lang: 0x1d7, script: 0x8, flags: 0x0}, - 5: {lang: 0x274, script: 0x57, flags: 0x0}, - 6: {lang: 0xb7, script: 0x57, flags: 0x0}, - 7: {lang: 0x432, script: 0x1f, flags: 0x0}, - 8: {lang: 0x12d, script: 0xe0, flags: 0x0}, - 9: {lang: 0x351, script: 0x21, flags: 0x0}, - 10: {lang: 0x529, script: 0x38, flags: 0x0}, - 11: {lang: 0x4ac, script: 0x5, flags: 0x0}, - 12: {lang: 0x523, script: 0x57, flags: 0x0}, - 13: {lang: 0x29a, script: 0xdf, flags: 0x0}, - 14: {lang: 0x136, script: 0x31, flags: 0x0}, - 15: {lang: 0x48a, script: 0x57, flags: 0x0}, - 16: {lang: 0x3a, script: 0x5, flags: 0x0}, - 17: {lang: 0x15e, script: 0x57, flags: 0x0}, - 18: {lang: 0x27, script: 0x29, flags: 0x0}, - 19: {lang: 0x139, script: 0x57, flags: 0x0}, - 20: {lang: 0x26a, script: 0x5, flags: 0x2}, - 21: {lang: 0x512, script: 0x3b, flags: 0x2}, - 22: {lang: 0x210, script: 0x2b, flags: 0x0}, - 23: {lang: 0x5, script: 0x1f, flags: 0x0}, - 24: {lang: 0x274, script: 0x57, flags: 0x0}, - 25: {lang: 0x136, script: 0x31, flags: 0x0}, - 26: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 27: {lang: 0x1e1, script: 0x57, flags: 0x0}, - 28: {lang: 0x31f, script: 0x5, flags: 0x0}, - 29: {lang: 0x1be, script: 0x21, flags: 0x0}, - 30: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 31: {lang: 0x236, script: 0x72, flags: 0x0}, - 32: {lang: 0x148, script: 0x5, flags: 0x0}, - 33: {lang: 0x476, script: 0x57, flags: 0x0}, - 34: {lang: 0x24a, script: 0x4b, flags: 0x0}, - 35: {lang: 0xe6, script: 0x5, flags: 0x0}, - 36: {lang: 0x226, script: 0xdf, flags: 0x0}, - 37: {lang: 0x3a, script: 0x5, flags: 0x0}, - 38: {lang: 0x15e, script: 0x57, flags: 0x0}, - 39: {lang: 0x2b8, script: 0x54, flags: 0x0}, - 40: {lang: 0x226, script: 0xdf, flags: 0x0}, - 41: {lang: 0x3a, script: 0x5, flags: 0x0}, - 42: {lang: 0x15e, script: 0x57, flags: 0x0}, - 43: {lang: 0x3dc, script: 0x57, flags: 0x0}, - 44: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 45: {lang: 0x2ff, script: 0x1f, flags: 0x0}, - 46: {lang: 0x431, script: 0x57, flags: 0x0}, - 47: {lang: 0x331, script: 0x72, flags: 0x0}, - 48: {lang: 0x213, script: 0x57, flags: 0x0}, - 49: {lang: 0x30b, script: 0x1f, flags: 0x0}, - 50: {lang: 0x242, script: 0x5, flags: 0x0}, - 51: {lang: 0x529, script: 0x39, flags: 0x0}, - 52: {lang: 0x3c0, script: 0x57, flags: 0x0}, - 53: {lang: 0x3a, script: 0x5, flags: 0x0}, - 54: {lang: 0x15e, script: 0x57, flags: 0x0}, - 55: {lang: 0x2ed, script: 0x57, flags: 0x0}, - 56: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 57: {lang: 0x88, script: 0x21, flags: 0x0}, - 58: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 59: {lang: 0x4b4, script: 0x5, flags: 0x0}, - 60: {lang: 0xbe, script: 0x21, flags: 0x0}, - 61: {lang: 0x3dc, script: 0x57, flags: 0x0}, - 62: {lang: 0x7e, script: 0x1f, flags: 0x0}, - 63: {lang: 0x3e2, script: 0x1f, flags: 0x0}, - 64: {lang: 0x267, script: 0x57, flags: 0x0}, - 65: {lang: 0x444, script: 0x57, flags: 0x0}, - 66: {lang: 0x512, script: 0x3b, flags: 0x0}, - 67: {lang: 0x412, script: 0x57, flags: 0x0}, - 68: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 69: {lang: 0x3a, script: 0x5, flags: 0x0}, - 70: {lang: 0x15e, script: 0x57, flags: 0x0}, - 71: {lang: 0x15e, script: 0x57, flags: 0x0}, - 72: {lang: 0x35, script: 0x5, flags: 0x0}, - 73: {lang: 0x46b, script: 0xdf, flags: 0x0}, - 74: {lang: 0x2ec, script: 0x5, flags: 0x0}, - 75: {lang: 0x30f, script: 0x72, flags: 0x0}, - 76: {lang: 0x467, script: 0x1f, flags: 0x0}, - 77: {lang: 0x148, script: 0x5, flags: 0x0}, - 78: {lang: 0x3a, script: 0x5, flags: 0x0}, - 79: {lang: 0x15e, script: 0x57, flags: 0x0}, - 80: {lang: 0x48a, script: 0x57, flags: 0x0}, - 81: {lang: 0x58, script: 0x5, flags: 0x0}, - 82: {lang: 0x219, script: 0x1f, flags: 0x0}, - 83: {lang: 0x81, script: 0x31, flags: 0x0}, - 84: {lang: 0x529, script: 0x39, flags: 0x0}, - 85: {lang: 0x48c, script: 0x57, flags: 0x0}, - 86: {lang: 0x4ae, script: 0x1f, flags: 0x0}, - 87: {lang: 0x512, script: 0x3b, flags: 0x0}, - 88: {lang: 0x3b3, script: 0x57, flags: 0x0}, - 89: {lang: 0x431, script: 0x57, flags: 0x0}, - 90: {lang: 0x432, script: 0x1f, flags: 0x0}, - 91: {lang: 0x15e, script: 0x57, flags: 0x0}, - 92: {lang: 0x446, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint8 -} - -// Size: 198 bytes, 33 elements -var likelyRegionGroup = [33]likelyTag{ - 1: {lang: 0x139, region: 0xd6, script: 0x57}, - 2: {lang: 0x139, region: 0x135, script: 0x57}, - 3: {lang: 0x3c0, region: 0x41, script: 0x57}, - 4: {lang: 0x139, region: 0x2f, script: 0x57}, - 5: {lang: 0x139, region: 0xd6, script: 0x57}, - 6: {lang: 0x13e, region: 0xcf, script: 0x57}, - 7: {lang: 0x445, region: 0x12f, script: 0x57}, - 8: {lang: 0x3a, region: 0x6b, script: 0x5}, - 9: {lang: 0x445, region: 0x4b, script: 0x57}, - 10: {lang: 0x139, region: 0x161, script: 0x57}, - 11: {lang: 0x139, region: 0x135, script: 0x57}, - 12: {lang: 0x139, region: 0x135, script: 0x57}, - 13: {lang: 0x13e, region: 0x59, script: 0x57}, - 14: {lang: 0x529, region: 0x53, script: 0x38}, - 15: {lang: 0x1be, region: 0x99, script: 0x21}, - 16: {lang: 0x1e1, region: 0x95, script: 0x57}, - 17: {lang: 0x1f9, region: 0x9e, script: 0x57}, - 18: {lang: 0x139, region: 0x2f, script: 0x57}, - 19: {lang: 0x139, region: 0xe6, script: 0x57}, - 20: {lang: 0x139, region: 0x8a, script: 0x57}, - 21: {lang: 0x41b, region: 0x142, script: 0x57}, - 22: {lang: 0x529, region: 0x53, script: 0x38}, - 23: {lang: 0x4bc, region: 0x137, script: 0x57}, - 24: {lang: 0x3a, region: 0x108, script: 0x5}, - 25: {lang: 0x3e2, region: 0x106, script: 0x1f}, - 26: {lang: 0x3e2, region: 0x106, script: 0x1f}, - 27: {lang: 0x139, region: 0x7b, script: 0x57}, - 28: {lang: 0x10d, region: 0x60, script: 0x57}, - 29: {lang: 0x139, region: 0xd6, script: 0x57}, - 30: {lang: 0x13e, region: 0x1f, script: 0x57}, - 31: {lang: 0x139, region: 0x9a, script: 0x57}, - 32: {lang: 0x139, region: 0x7b, script: 0x57}, -} - -// Size: 358 bytes, 358 elements -var regionToGroups = [358]uint8{ +var regionToGroups = []uint8{ // 357 elements // Entry 0 - 3F 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, @@ -3343,15 +98,14 @@ var regionToGroups = [358]uint8{ 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, -} + 0x00, 0x00, 0x00, 0x00, 0x00, +} // Size: 381 bytes -// Size: 18 bytes, 3 elements -var paradigmLocales = [3][3]uint16{ +var paradigmLocales = [][3]uint16{ // 3 elements 0: [3]uint16{0x139, 0x0, 0x7b}, 1: [3]uint16{0x13e, 0x0, 0x1f}, 2: [3]uint16{0x3c0, 0x41, 0xee}, -} +} // Size: 42 bytes type mutualIntelligibility struct { want uint16 @@ -3359,7 +113,6 @@ type mutualIntelligibility struct { distance uint8 oneway bool } - type scriptIntelligibility struct { wantLang uint16 haveLang uint16 @@ -3367,7 +120,6 @@ type scriptIntelligibility struct { haveScript uint8 distance uint8 } - type regionIntelligibility struct { lang uint16 script uint8 @@ -3378,8 +130,7 @@ type regionIntelligibility struct { // matchLang holds pairs of langIDs of base languages that are typically // mutually intelligible. Each pair is associated with a confidence and // whether the intelligibility goes one or both ways. -// Size: 678 bytes, 113 elements -var matchLang = [113]mutualIntelligibility{ +var matchLang = []mutualIntelligibility{ // 113 elements 0: {want: 0x1d1, have: 0xb7, distance: 0x4, oneway: false}, 1: {want: 0x407, have: 0xb7, distance: 0x4, oneway: false}, 2: {want: 0x407, have: 0x1d1, distance: 0x4, oneway: false}, @@ -3493,12 +244,11 @@ var matchLang = [113]mutualIntelligibility{ 110: {want: 0x512, have: 0x139, distance: 0xa, oneway: true}, 111: {want: 0x518, have: 0x139, distance: 0xa, oneway: true}, 112: {want: 0x52f, have: 0x139, distance: 0xa, oneway: true}, -} +} // Size: 702 bytes // matchScript holds pairs of scriptIDs where readers of one script // can typically also read the other. Each is associated with a confidence. -// Size: 208 bytes, 26 elements -var matchScript = [26]scriptIntelligibility{ +var matchScript = []scriptIntelligibility{ // 26 elements 0: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x57, haveScript: 0x1f, distance: 0x5}, 1: {wantLang: 0x432, haveLang: 0x432, wantScript: 0x1f, haveScript: 0x57, distance: 0x5}, 2: {wantLang: 0x58, haveLang: 0x3e2, wantScript: 0x57, haveScript: 0x1f, distance: 0xa}, @@ -3525,10 +275,9 @@ var matchScript = [26]scriptIntelligibility{ 23: {wantLang: 0x512, haveLang: 0x139, wantScript: 0x3b, haveScript: 0x57, distance: 0xa}, 24: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x38, haveScript: 0x39, distance: 0xf}, 25: {wantLang: 0x529, haveLang: 0x529, wantScript: 0x39, haveScript: 0x38, distance: 0x13}, -} +} // Size: 232 bytes -// Size: 90 bytes, 15 elements -var matchRegion = [15]regionIntelligibility{ +var matchRegion = []regionIntelligibility{ // 15 elements 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, 2: {lang: 0x139, script: 0x0, group: 0x1, distance: 0x4}, @@ -3544,143 +293,6 @@ var matchRegion = [15]regionIntelligibility{ 12: {lang: 0x13e, script: 0x0, group: 0x80, distance: 0x5}, 13: {lang: 0x3c0, script: 0x0, group: 0x80, distance: 0x5}, 14: {lang: 0x529, script: 0x39, group: 0x80, distance: 0x5}, -} - -// Size: 264 bytes, 33 elements -var regionContainment = [33]uint64{ - // Entry 0 - 1F - 0x00000001ffffffff, 0x00000000200007a2, 0x0000000000003044, 0x0000000000000008, - 0x00000000803c0010, 0x0000000000000020, 0x0000000000000040, 0x0000000000000080, - 0x0000000000000100, 0x0000000000000200, 0x0000000000000400, 0x000000004000384c, - 0x0000000000001000, 0x0000000000002000, 0x0000000000004000, 0x0000000000008000, - 0x0000000000010000, 0x0000000000020000, 0x0000000000040000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000200000, 0x0000000001c1c000, 0x0000000000800000, - 0x0000000001000000, 0x000000001e020000, 0x0000000004000000, 0x0000000008000000, - 0x0000000010000000, 0x00000000200006a0, 0x0000000040002048, 0x0000000080000000, - // Entry 20 - 3F - 0x0000000100000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 358 bytes, 358 elements -var regionInclusion = [358]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x1e, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x26, 0x26, 0x23, - 0x24, 0x26, 0x27, 0x22, 0x28, 0x29, 0x2a, 0x2b, - 0x26, 0x2c, 0x24, 0x23, 0x26, 0x25, 0x2a, 0x2d, - 0x2e, 0x24, 0x2f, 0x2d, 0x26, 0x30, 0x31, 0x28, - // Entry 40 - 7F - 0x26, 0x28, 0x26, 0x25, 0x31, 0x22, 0x32, 0x33, - 0x34, 0x30, 0x22, 0x27, 0x27, 0x27, 0x35, 0x2d, - 0x29, 0x28, 0x27, 0x36, 0x28, 0x22, 0x34, 0x23, - 0x21, 0x26, 0x2d, 0x26, 0x22, 0x37, 0x2e, 0x35, - 0x2a, 0x22, 0x2f, 0x38, 0x26, 0x26, 0x21, 0x39, - 0x39, 0x28, 0x38, 0x39, 0x39, 0x2f, 0x3a, 0x2f, - 0x20, 0x21, 0x38, 0x3b, 0x28, 0x3c, 0x2c, 0x21, - 0x2a, 0x35, 0x27, 0x38, 0x26, 0x24, 0x28, 0x2c, - // Entry 80 - BF - 0x2d, 0x23, 0x30, 0x2d, 0x2d, 0x26, 0x27, 0x3a, - 0x22, 0x34, 0x3c, 0x2d, 0x28, 0x36, 0x22, 0x34, - 0x3a, 0x26, 0x2e, 0x21, 0x39, 0x31, 0x38, 0x24, - 0x2c, 0x25, 0x22, 0x24, 0x25, 0x2c, 0x3a, 0x2c, - 0x26, 0x24, 0x36, 0x21, 0x2f, 0x3d, 0x31, 0x3c, - 0x2f, 0x26, 0x36, 0x36, 0x24, 0x26, 0x3d, 0x31, - 0x24, 0x26, 0x35, 0x25, 0x2d, 0x32, 0x38, 0x2a, - 0x38, 0x39, 0x39, 0x35, 0x33, 0x23, 0x26, 0x2f, - // Entry C0 - FF - 0x3c, 0x21, 0x23, 0x2d, 0x31, 0x36, 0x36, 0x3c, - 0x26, 0x2d, 0x26, 0x3a, 0x2f, 0x25, 0x2f, 0x34, - 0x31, 0x2f, 0x32, 0x3b, 0x2d, 0x2b, 0x2d, 0x21, - 0x34, 0x2a, 0x2c, 0x25, 0x21, 0x3c, 0x24, 0x29, - 0x2b, 0x24, 0x34, 0x21, 0x28, 0x29, 0x3b, 0x31, - 0x25, 0x2e, 0x30, 0x29, 0x26, 0x24, 0x3a, 0x21, - 0x3c, 0x28, 0x21, 0x24, 0x21, 0x21, 0x1f, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - // Entry 100 - 13F - 0x21, 0x21, 0x2f, 0x21, 0x2e, 0x23, 0x33, 0x2f, - 0x24, 0x3b, 0x2f, 0x39, 0x38, 0x31, 0x2d, 0x3a, - 0x2c, 0x2e, 0x2d, 0x23, 0x2d, 0x2f, 0x28, 0x2f, - 0x27, 0x33, 0x34, 0x26, 0x24, 0x32, 0x22, 0x26, - 0x27, 0x22, 0x2d, 0x31, 0x3d, 0x29, 0x31, 0x3d, - 0x39, 0x29, 0x31, 0x24, 0x26, 0x29, 0x36, 0x2f, - 0x33, 0x2f, 0x21, 0x22, 0x21, 0x30, 0x28, 0x3d, - 0x23, 0x26, 0x21, 0x28, 0x26, 0x26, 0x31, 0x3b, - // Entry 140 - 17F - 0x29, 0x21, 0x29, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x23, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, - 0x21, 0x21, 0x21, 0x21, 0x21, 0x24, 0x24, 0x2f, - 0x23, 0x32, 0x2f, 0x27, 0x2f, 0x21, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 584 bytes, 73 elements -var regionInclusionBits = [73]uint64{ - // Entry 0 - 1F - 0x0000000102400813, 0x00000000200007a3, 0x0000000000003844, 0x0000000040000808, - 0x00000000803c0011, 0x0000000020000022, 0x0000000040000844, 0x0000000020000082, - 0x0000000000000102, 0x0000000020000202, 0x0000000020000402, 0x000000004000384d, - 0x0000000000001804, 0x0000000040002804, 0x0000000000404000, 0x0000000000408000, - 0x0000000000410000, 0x0000000002020000, 0x0000000000040010, 0x0000000000080010, - 0x0000000000100010, 0x0000000000200010, 0x0000000001c1c001, 0x0000000000c00000, - 0x0000000001400000, 0x000000001e020001, 0x0000000006000000, 0x000000000a000000, - 0x0000000012000000, 0x00000000200006a2, 0x0000000040002848, 0x0000000080000010, - // Entry 20 - 3F - 0x0000000100000001, 0x0000000000000001, 0x0000000080000000, 0x0000000000020000, - 0x0000000001000000, 0x0000000000008000, 0x0000000000002000, 0x0000000000000200, - 0x0000000000000008, 0x0000000000200000, 0x0000000110000000, 0x0000000000040000, - 0x0000000008000000, 0x0000000000000020, 0x0000000104000000, 0x0000000000000080, - 0x0000000000001000, 0x0000000000010000, 0x0000000000000400, 0x0000000004000000, - 0x0000000000000040, 0x0000000010000000, 0x0000000000004000, 0x0000000101000000, - 0x0000000108000000, 0x0000000000000100, 0x0000000100020000, 0x0000000000080000, - 0x0000000000100000, 0x0000000000800000, 0x00000001ffffffff, 0x0000000122400fb3, - // Entry 40 - 5F - 0x00000001827c0813, 0x000000014240385f, 0x0000000103c1c813, 0x000000011e420813, - 0x0000000112000001, 0x0000000106000001, 0x0000000101400001, 0x000000010a000001, - 0x0000000102020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 73 bytes, 73 elements -var regionInclusionNext = [73]uint8{ - // Entry 0 - 3F - 0x3e, 0x3f, 0x0b, 0x0b, 0x40, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x41, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x42, 0x16, - 0x16, 0x43, 0x19, 0x19, 0x19, 0x01, 0x0b, 0x04, - 0x00, 0x00, 0x1f, 0x11, 0x18, 0x0f, 0x0d, 0x09, - 0x03, 0x15, 0x44, 0x12, 0x1b, 0x05, 0x45, 0x07, - 0x0c, 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x46, - 0x47, 0x08, 0x48, 0x13, 0x14, 0x17, 0x3e, 0x3e, - // Entry 40 - 7F - 0x3e, 0x3e, 0x3e, 0x3e, 0x43, 0x43, 0x42, 0x43, - 0x43, -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x25, 0x26, 0x2f, 0x34, 0x36, 0x3d, 0x42, 0x46, 0x48, 0x49, 0x4a, 0x50, 0x52, 0x5c, 0x5d, 0x61, 0x64, 0x6d, 0x73, 0x74, 0x75, 0x7b, 0x7c, 0x7f, 0x80, 0x81, 0x83, 0x8c, 0x8d, 0x96, 0x97, 0x98, 0x99, 0x9a, 0x9f, 0xa0, 0xa4, 0xa7, 0xa9, 0xad, 0xb1, 0xb4, 0xb5, 0xbf, 0xc6, 0xca, 0xcb, 0xcc, 0xce, 0xd0, 0xd2, 0xd5, 0xd6, 0xdd, 0xdf, 0xe0, 0xe6, 0xe7, 0xe8, 0xeb, 0xf0, 0x107, 0x109, 0x10a, 0x10b, 0x10d, 0x10e, 0x112, 0x117, 0x11b, 0x11d, 0x11f, 0x125, 0x129, 0x12c, 0x12d, 0x12f, 0x131, 0x139, 0x13c, 0x13f, 0x142, 0x161, 0x162, 0x164}}, - 1: {lang: 0x139, script: 0x0, maxScript: 0x57, toRegion: 0x1a, fromRegion: []uint16{0x2e, 0x4e, 0x60, 0x63, 0x72, 0xd9, 0x10c, 0x10f}}, - 2: {lang: 0x13e, script: 0x0, maxScript: 0x57, toRegion: 0x1f, fromRegion: []uint16{0x2c, 0x3f, 0x41, 0x48, 0x51, 0x54, 0x56, 0x59, 0x65, 0x69, 0x89, 0x8f, 0xcf, 0xd8, 0xe2, 0xe4, 0xec, 0xf1, 0x11a, 0x135, 0x136, 0x13b}}, - 3: {lang: 0x3c0, script: 0x0, maxScript: 0x57, toRegion: 0xee, fromRegion: []uint16{0x2a, 0x4e, 0x5a, 0x86, 0x8b, 0xb7, 0xc6, 0xd1, 0x118, 0x126}}, - 4: {lang: 0x529, script: 0x39, maxScript: 0x39, toRegion: 0x8d, fromRegion: []uint16{0xc6}}, -} +} // Size: 114 bytes -// Total table size 27238 bytes (26KiB); checksum: C9BBE4D5 +// Total table size 1471 bytes (1KiB); checksum: 4CB1CD46 diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go index de30155a26..42ea792666 100644 --- a/vendor/golang.org/x/text/language/tags.go +++ b/vendor/golang.org/x/text/language/tags.go @@ -4,6 +4,8 @@ package language +import "golang.org/x/text/internal/language/compact" + // TODO: Various sets of commonly use tags and regions. // MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. @@ -61,83 +63,83 @@ var ( Und Tag = Tag{} - Afrikaans Tag = Tag{lang: _af} // af - Amharic Tag = Tag{lang: _am} // am - Arabic Tag = Tag{lang: _ar} // ar - ModernStandardArabic Tag = Tag{lang: _ar, region: _001} // ar-001 - Azerbaijani Tag = Tag{lang: _az} // az - Bulgarian Tag = Tag{lang: _bg} // bg - Bengali Tag = Tag{lang: _bn} // bn - Catalan Tag = Tag{lang: _ca} // ca - Czech Tag = Tag{lang: _cs} // cs - Danish Tag = Tag{lang: _da} // da - German Tag = Tag{lang: _de} // de - Greek Tag = Tag{lang: _el} // el - English Tag = Tag{lang: _en} // en - AmericanEnglish Tag = Tag{lang: _en, region: _US} // en-US - BritishEnglish Tag = Tag{lang: _en, region: _GB} // en-GB - Spanish Tag = Tag{lang: _es} // es - EuropeanSpanish Tag = Tag{lang: _es, region: _ES} // es-ES - LatinAmericanSpanish Tag = Tag{lang: _es, region: _419} // es-419 - Estonian Tag = Tag{lang: _et} // et - Persian Tag = Tag{lang: _fa} // fa - Finnish Tag = Tag{lang: _fi} // fi - Filipino Tag = Tag{lang: _fil} // fil - French Tag = Tag{lang: _fr} // fr - CanadianFrench Tag = Tag{lang: _fr, region: _CA} // fr-CA - Gujarati Tag = Tag{lang: _gu} // gu - Hebrew Tag = Tag{lang: _he} // he - Hindi Tag = Tag{lang: _hi} // hi - Croatian Tag = Tag{lang: _hr} // hr - Hungarian Tag = Tag{lang: _hu} // hu - Armenian Tag = Tag{lang: _hy} // hy - Indonesian Tag = Tag{lang: _id} // id - Icelandic Tag = Tag{lang: _is} // is - Italian Tag = Tag{lang: _it} // it - Japanese Tag = Tag{lang: _ja} // ja - Georgian Tag = Tag{lang: _ka} // ka - Kazakh Tag = Tag{lang: _kk} // kk - Khmer Tag = Tag{lang: _km} // km - Kannada Tag = Tag{lang: _kn} // kn - Korean Tag = Tag{lang: _ko} // ko - Kirghiz Tag = Tag{lang: _ky} // ky - Lao Tag = Tag{lang: _lo} // lo - Lithuanian Tag = Tag{lang: _lt} // lt - Latvian Tag = Tag{lang: _lv} // lv - Macedonian Tag = Tag{lang: _mk} // mk - Malayalam Tag = Tag{lang: _ml} // ml - Mongolian Tag = Tag{lang: _mn} // mn - Marathi Tag = Tag{lang: _mr} // mr - Malay Tag = Tag{lang: _ms} // ms - Burmese Tag = Tag{lang: _my} // my - Nepali Tag = Tag{lang: _ne} // ne - Dutch Tag = Tag{lang: _nl} // nl - Norwegian Tag = Tag{lang: _no} // no - Punjabi Tag = Tag{lang: _pa} // pa - Polish Tag = Tag{lang: _pl} // pl - Portuguese Tag = Tag{lang: _pt} // pt - BrazilianPortuguese Tag = Tag{lang: _pt, region: _BR} // pt-BR - EuropeanPortuguese Tag = Tag{lang: _pt, region: _PT} // pt-PT - Romanian Tag = Tag{lang: _ro} // ro - Russian Tag = Tag{lang: _ru} // ru - Sinhala Tag = Tag{lang: _si} // si - Slovak Tag = Tag{lang: _sk} // sk - Slovenian Tag = Tag{lang: _sl} // sl - Albanian Tag = Tag{lang: _sq} // sq - Serbian Tag = Tag{lang: _sr} // sr - SerbianLatin Tag = Tag{lang: _sr, script: _Latn} // sr-Latn - Swedish Tag = Tag{lang: _sv} // sv - Swahili Tag = Tag{lang: _sw} // sw - Tamil Tag = Tag{lang: _ta} // ta - Telugu Tag = Tag{lang: _te} // te - Thai Tag = Tag{lang: _th} // th - Turkish Tag = Tag{lang: _tr} // tr - Ukrainian Tag = Tag{lang: _uk} // uk - Urdu Tag = Tag{lang: _ur} // ur - Uzbek Tag = Tag{lang: _uz} // uz - Vietnamese Tag = Tag{lang: _vi} // vi - Chinese Tag = Tag{lang: _zh} // zh - SimplifiedChinese Tag = Tag{lang: _zh, script: _Hans} // zh-Hans - TraditionalChinese Tag = Tag{lang: _zh, script: _Hant} // zh-Hant - Zulu Tag = Tag{lang: _zu} // zu + Afrikaans Tag = Tag(compact.Afrikaans) + Amharic Tag = Tag(compact.Amharic) + Arabic Tag = Tag(compact.Arabic) + ModernStandardArabic Tag = Tag(compact.ModernStandardArabic) + Azerbaijani Tag = Tag(compact.Azerbaijani) + Bulgarian Tag = Tag(compact.Bulgarian) + Bengali Tag = Tag(compact.Bengali) + Catalan Tag = Tag(compact.Catalan) + Czech Tag = Tag(compact.Czech) + Danish Tag = Tag(compact.Danish) + German Tag = Tag(compact.German) + Greek Tag = Tag(compact.Greek) + English Tag = Tag(compact.English) + AmericanEnglish Tag = Tag(compact.AmericanEnglish) + BritishEnglish Tag = Tag(compact.BritishEnglish) + Spanish Tag = Tag(compact.Spanish) + EuropeanSpanish Tag = Tag(compact.EuropeanSpanish) + LatinAmericanSpanish Tag = Tag(compact.LatinAmericanSpanish) + Estonian Tag = Tag(compact.Estonian) + Persian Tag = Tag(compact.Persian) + Finnish Tag = Tag(compact.Finnish) + Filipino Tag = Tag(compact.Filipino) + French Tag = Tag(compact.French) + CanadianFrench Tag = Tag(compact.CanadianFrench) + Gujarati Tag = Tag(compact.Gujarati) + Hebrew Tag = Tag(compact.Hebrew) + Hindi Tag = Tag(compact.Hindi) + Croatian Tag = Tag(compact.Croatian) + Hungarian Tag = Tag(compact.Hungarian) + Armenian Tag = Tag(compact.Armenian) + Indonesian Tag = Tag(compact.Indonesian) + Icelandic Tag = Tag(compact.Icelandic) + Italian Tag = Tag(compact.Italian) + Japanese Tag = Tag(compact.Japanese) + Georgian Tag = Tag(compact.Georgian) + Kazakh Tag = Tag(compact.Kazakh) + Khmer Tag = Tag(compact.Khmer) + Kannada Tag = Tag(compact.Kannada) + Korean Tag = Tag(compact.Korean) + Kirghiz Tag = Tag(compact.Kirghiz) + Lao Tag = Tag(compact.Lao) + Lithuanian Tag = Tag(compact.Lithuanian) + Latvian Tag = Tag(compact.Latvian) + Macedonian Tag = Tag(compact.Macedonian) + Malayalam Tag = Tag(compact.Malayalam) + Mongolian Tag = Tag(compact.Mongolian) + Marathi Tag = Tag(compact.Marathi) + Malay Tag = Tag(compact.Malay) + Burmese Tag = Tag(compact.Burmese) + Nepali Tag = Tag(compact.Nepali) + Dutch Tag = Tag(compact.Dutch) + Norwegian Tag = Tag(compact.Norwegian) + Punjabi Tag = Tag(compact.Punjabi) + Polish Tag = Tag(compact.Polish) + Portuguese Tag = Tag(compact.Portuguese) + BrazilianPortuguese Tag = Tag(compact.BrazilianPortuguese) + EuropeanPortuguese Tag = Tag(compact.EuropeanPortuguese) + Romanian Tag = Tag(compact.Romanian) + Russian Tag = Tag(compact.Russian) + Sinhala Tag = Tag(compact.Sinhala) + Slovak Tag = Tag(compact.Slovak) + Slovenian Tag = Tag(compact.Slovenian) + Albanian Tag = Tag(compact.Albanian) + Serbian Tag = Tag(compact.Serbian) + SerbianLatin Tag = Tag(compact.SerbianLatin) + Swedish Tag = Tag(compact.Swedish) + Swahili Tag = Tag(compact.Swahili) + Tamil Tag = Tag(compact.Tamil) + Telugu Tag = Tag(compact.Telugu) + Thai Tag = Tag(compact.Thai) + Turkish Tag = Tag(compact.Turkish) + Ukrainian Tag = Tag(compact.Ukrainian) + Urdu Tag = Tag(compact.Urdu) + Uzbek Tag = Tag(compact.Uzbek) + Vietnamese Tag = Tag(compact.Vietnamese) + Chinese Tag = Tag(compact.Chinese) + SimplifiedChinese Tag = Tag(compact.SimplifiedChinese) + TraditionalChinese Tag = Tag(compact.TraditionalChinese) + Zulu Tag = Tag(compact.Zulu) ) diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule.go b/vendor/golang.org/x/text/secure/bidirule/bidirule.go new file mode 100644 index 0000000000..e2b70f76c2 --- /dev/null +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule.go @@ -0,0 +1,336 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package bidirule implements the Bidi Rule defined by RFC 5893. +// +// This package is under development. The API may change without notice and +// without preserving backward compatibility. +package bidirule + +import ( + "errors" + "unicode/utf8" + + "golang.org/x/text/transform" + "golang.org/x/text/unicode/bidi" +) + +// This file contains an implementation of RFC 5893: Right-to-Left Scripts for +// Internationalized Domain Names for Applications (IDNA) +// +// A label is an individual component of a domain name. Labels are usually +// shown separated by dots; for example, the domain name "www.example.com" is +// composed of three labels: "www", "example", and "com". +// +// An RTL label is a label that contains at least one character of class R, AL, +// or AN. An LTR label is any label that is not an RTL label. +// +// A "Bidi domain name" is a domain name that contains at least one RTL label. +// +// The following guarantees can be made based on the above: +// +// o In a domain name consisting of only labels that satisfy the rule, +// the requirements of Section 3 are satisfied. Note that even LTR +// labels and pure ASCII labels have to be tested. +// +// o In a domain name consisting of only LDH labels (as defined in the +// Definitions document [RFC5890]) and labels that satisfy the rule, +// the requirements of Section 3 are satisfied as long as a label +// that starts with an ASCII digit does not come after a +// right-to-left label. +// +// No guarantee is given for other combinations. + +// ErrInvalid indicates a label is invalid according to the Bidi Rule. +var ErrInvalid = errors.New("bidirule: failed Bidi Rule") + +type ruleState uint8 + +const ( + ruleInitial ruleState = iota + ruleLTR + ruleLTRFinal + ruleRTL + ruleRTLFinal + ruleInvalid +) + +type ruleTransition struct { + next ruleState + mask uint16 +} + +var transitions = [...][2]ruleTransition{ + // [2.1] The first character must be a character with Bidi property L, R, or + // AL. If it has the R or AL property, it is an RTL label; if it has the L + // property, it is an LTR label. + ruleInitial: { + {ruleLTRFinal, 1 << bidi.L}, + {ruleRTLFinal, 1<<bidi.R | 1<<bidi.AL}, + }, + ruleRTL: { + // [2.3] In an RTL label, the end of the label must be a character with + // Bidi property R, AL, EN, or AN, followed by zero or more characters + // with Bidi property NSM. + {ruleRTLFinal, 1<<bidi.R | 1<<bidi.AL | 1<<bidi.EN | 1<<bidi.AN}, + + // [2.2] In an RTL label, only characters with the Bidi properties R, + // AL, AN, EN, ES, CS, ET, ON, BN, or NSM are allowed. + // We exclude the entries from [2.3] + {ruleRTL, 1<<bidi.ES | 1<<bidi.CS | 1<<bidi.ET | 1<<bidi.ON | 1<<bidi.BN | 1<<bidi.NSM}, + }, + ruleRTLFinal: { + // [2.3] In an RTL label, the end of the label must be a character with + // Bidi property R, AL, EN, or AN, followed by zero or more characters + // with Bidi property NSM. + {ruleRTLFinal, 1<<bidi.R | 1<<bidi.AL | 1<<bidi.EN | 1<<bidi.AN | 1<<bidi.NSM}, + + // [2.2] In an RTL label, only characters with the Bidi properties R, + // AL, AN, EN, ES, CS, ET, ON, BN, or NSM are allowed. + // We exclude the entries from [2.3] and NSM. + {ruleRTL, 1<<bidi.ES | 1<<bidi.CS | 1<<bidi.ET | 1<<bidi.ON | 1<<bidi.BN}, + }, + ruleLTR: { + // [2.6] In an LTR label, the end of the label must be a character with + // Bidi property L or EN, followed by zero or more characters with Bidi + // property NSM. + {ruleLTRFinal, 1<<bidi.L | 1<<bidi.EN}, + + // [2.5] In an LTR label, only characters with the Bidi properties L, + // EN, ES, CS, ET, ON, BN, or NSM are allowed. + // We exclude the entries from [2.6]. + {ruleLTR, 1<<bidi.ES | 1<<bidi.CS | 1<<bidi.ET | 1<<bidi.ON | 1<<bidi.BN | 1<<bidi.NSM}, + }, + ruleLTRFinal: { + // [2.6] In an LTR label, the end of the label must be a character with + // Bidi property L or EN, followed by zero or more characters with Bidi + // property NSM. + {ruleLTRFinal, 1<<bidi.L | 1<<bidi.EN | 1<<bidi.NSM}, + + // [2.5] In an LTR label, only characters with the Bidi properties L, + // EN, ES, CS, ET, ON, BN, or NSM are allowed. + // We exclude the entries from [2.6]. + {ruleLTR, 1<<bidi.ES | 1<<bidi.CS | 1<<bidi.ET | 1<<bidi.ON | 1<<bidi.BN}, + }, + ruleInvalid: { + {ruleInvalid, 0}, + {ruleInvalid, 0}, + }, +} + +// [2.4] In an RTL label, if an EN is present, no AN may be present, and +// vice versa. +const exclusiveRTL = uint16(1<<bidi.EN | 1<<bidi.AN) + +// From RFC 5893 +// An RTL label is a label that contains at least one character of type +// R, AL, or AN. +// +// An LTR label is any label that is not an RTL label. + +// Direction reports the direction of the given label as defined by RFC 5893. +// The Bidi Rule does not have to be applied to labels of the category +// LeftToRight. +func Direction(b []byte) bidi.Direction { + for i := 0; i < len(b); { + e, sz := bidi.Lookup(b[i:]) + if sz == 0 { + i++ + } + c := e.Class() + if c == bidi.R || c == bidi.AL || c == bidi.AN { + return bidi.RightToLeft + } + i += sz + } + return bidi.LeftToRight +} + +// DirectionString reports the direction of the given label as defined by RFC +// 5893. The Bidi Rule does not have to be applied to labels of the category +// LeftToRight. +func DirectionString(s string) bidi.Direction { + for i := 0; i < len(s); { + e, sz := bidi.LookupString(s[i:]) + if sz == 0 { + i++ + continue + } + c := e.Class() + if c == bidi.R || c == bidi.AL || c == bidi.AN { + return bidi.RightToLeft + } + i += sz + } + return bidi.LeftToRight +} + +// Valid reports whether b conforms to the BiDi rule. +func Valid(b []byte) bool { + var t Transformer + if n, ok := t.advance(b); !ok || n < len(b) { + return false + } + return t.isFinal() +} + +// ValidString reports whether s conforms to the BiDi rule. +func ValidString(s string) bool { + var t Transformer + if n, ok := t.advanceString(s); !ok || n < len(s) { + return false + } + return t.isFinal() +} + +// New returns a Transformer that verifies that input adheres to the Bidi Rule. +func New() *Transformer { + return &Transformer{} +} + +// Transformer implements transform.Transform. +type Transformer struct { + state ruleState + hasRTL bool + seen uint16 +} + +// A rule can only be violated for "Bidi Domain names", meaning if one of the +// following categories has been observed. +func (t *Transformer) isRTL() bool { + const isRTL = 1<<bidi.R | 1<<bidi.AL | 1<<bidi.AN + return t.seen&isRTL != 0 +} + +// Reset implements transform.Transformer. +func (t *Transformer) Reset() { *t = Transformer{} } + +// Transform implements transform.Transformer. This Transformer has state and +// needs to be reset between uses. +func (t *Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { + if len(dst) < len(src) { + src = src[:len(dst)] + atEOF = false + err = transform.ErrShortDst + } + n, err1 := t.Span(src, atEOF) + copy(dst, src[:n]) + if err == nil || err1 != nil && err1 != transform.ErrShortSrc { + err = err1 + } + return n, n, err +} + +// Span returns the first n bytes of src that conform to the Bidi rule. +func (t *Transformer) Span(src []byte, atEOF bool) (n int, err error) { + if t.state == ruleInvalid && t.isRTL() { + return 0, ErrInvalid + } + n, ok := t.advance(src) + switch { + case !ok: + err = ErrInvalid + case n < len(src): + if !atEOF { + err = transform.ErrShortSrc + break + } + err = ErrInvalid + case !t.isFinal(): + err = ErrInvalid + } + return n, err +} + +// Precomputing the ASCII values decreases running time for the ASCII fast path +// by about 30%. +var asciiTable [128]bidi.Properties + +func init() { + for i := range asciiTable { + p, _ := bidi.LookupRune(rune(i)) + asciiTable[i] = p + } +} + +func (t *Transformer) advance(s []byte) (n int, ok bool) { + var e bidi.Properties + var sz int + for n < len(s) { + if s[n] < utf8.RuneSelf { + e, sz = asciiTable[s[n]], 1 + } else { + e, sz = bidi.Lookup(s[n:]) + if sz <= 1 { + if sz == 1 { + // We always consider invalid UTF-8 to be invalid, even if + // the string has not yet been determined to be RTL. + // TODO: is this correct? + return n, false + } + return n, true // incomplete UTF-8 encoding + } + } + // TODO: using CompactClass would result in noticeable speedup. + // See unicode/bidi/prop.go:Properties.CompactClass. + c := uint16(1 << e.Class()) + t.seen |= c + if t.seen&exclusiveRTL == exclusiveRTL { + t.state = ruleInvalid + return n, false + } + switch tr := transitions[t.state]; { + case tr[0].mask&c != 0: + t.state = tr[0].next + case tr[1].mask&c != 0: + t.state = tr[1].next + default: + t.state = ruleInvalid + if t.isRTL() { + return n, false + } + } + n += sz + } + return n, true +} + +func (t *Transformer) advanceString(s string) (n int, ok bool) { + var e bidi.Properties + var sz int + for n < len(s) { + if s[n] < utf8.RuneSelf { + e, sz = asciiTable[s[n]], 1 + } else { + e, sz = bidi.LookupString(s[n:]) + if sz <= 1 { + if sz == 1 { + return n, false // invalid UTF-8 + } + return n, true // incomplete UTF-8 encoding + } + } + // TODO: using CompactClass results in noticeable speedup. + // See unicode/bidi/prop.go:Properties.CompactClass. + c := uint16(1 << e.Class()) + t.seen |= c + if t.seen&exclusiveRTL == exclusiveRTL { + t.state = ruleInvalid + return n, false + } + switch tr := transitions[t.state]; { + case tr[0].mask&c != 0: + t.state = tr[0].next + case tr[1].mask&c != 0: + t.state = tr[1].next + default: + t.state = ruleInvalid + if t.isRTL() { + return n, false + } + } + n += sz + } + return n, true +} diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go b/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go new file mode 100644 index 0000000000..e4c62289f9 --- /dev/null +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule10.0.0.go @@ -0,0 +1,11 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build go1.10 + +package bidirule + +func (t *Transformer) isFinal() bool { + return t.state == ruleLTRFinal || t.state == ruleRTLFinal || t.state == ruleInitial +} diff --git a/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go b/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go new file mode 100644 index 0000000000..02b9e1e9d4 --- /dev/null +++ b/vendor/golang.org/x/text/secure/bidirule/bidirule9.0.0.go @@ -0,0 +1,14 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build !go1.10 + +package bidirule + +func (t *Transformer) isFinal() bool { + if !t.isRTL() { + return true + } + return t.state == ruleLTRFinal || t.state == ruleRTLFinal || t.state == ruleInitial +} diff --git a/vendor/golang.org/x/text/transform/transform.go b/vendor/golang.org/x/text/transform/transform.go index fe47b9b35f..520b9ada0e 100644 --- a/vendor/golang.org/x/text/transform/transform.go +++ b/vendor/golang.org/x/text/transform/transform.go @@ -78,8 +78,8 @@ type SpanningTransformer interface { // considering the error err. // // A nil error means that all input bytes are known to be identical to the - // output produced by the Transformer. A nil error can be be returned - // regardless of whether atEOF is true. If err is nil, then then n must + // output produced by the Transformer. A nil error can be returned + // regardless of whether atEOF is true. If err is nil, then n must // equal len(src); the converse is not necessarily true. // // ErrEndOfSpan means that the Transformer output may differ from the @@ -493,7 +493,7 @@ func (c *chain) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err erro return dstL.n, srcL.p, err } -// Deprecated: use runes.Remove instead. +// Deprecated: Use runes.Remove instead. func RemoveFunc(f func(r rune) bool) Transformer { return removeF(f) } diff --git a/vendor/golang.org/x/text/unicode/bidi/bidi.go b/vendor/golang.org/x/text/unicode/bidi/bidi.go new file mode 100644 index 0000000000..e8edc54cc2 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/bidi.go @@ -0,0 +1,198 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +//go:generate go run gen.go gen_trieval.go gen_ranges.go + +// Package bidi contains functionality for bidirectional text support. +// +// See https://www.unicode.org/reports/tr9. +// +// NOTE: UNDER CONSTRUCTION. This API may change in backwards incompatible ways +// and without notice. +package bidi // import "golang.org/x/text/unicode/bidi" + +// TODO: +// The following functionality would not be hard to implement, but hinges on +// the definition of a Segmenter interface. For now this is up to the user. +// - Iterate over paragraphs +// - Segmenter to iterate over runs directly from a given text. +// Also: +// - Transformer for reordering? +// - Transformer (validator, really) for Bidi Rule. + +// This API tries to avoid dealing with embedding levels for now. Under the hood +// these will be computed, but the question is to which extent the user should +// know they exist. We should at some point allow the user to specify an +// embedding hierarchy, though. + +// A Direction indicates the overall flow of text. +type Direction int + +const ( + // LeftToRight indicates the text contains no right-to-left characters and + // that either there are some left-to-right characters or the option + // DefaultDirection(LeftToRight) was passed. + LeftToRight Direction = iota + + // RightToLeft indicates the text contains no left-to-right characters and + // that either there are some right-to-left characters or the option + // DefaultDirection(RightToLeft) was passed. + RightToLeft + + // Mixed indicates text contains both left-to-right and right-to-left + // characters. + Mixed + + // Neutral means that text contains no left-to-right and right-to-left + // characters and that no default direction has been set. + Neutral +) + +type options struct{} + +// An Option is an option for Bidi processing. +type Option func(*options) + +// ICU allows the user to define embedding levels. This may be used, for example, +// to use hierarchical structure of markup languages to define embeddings. +// The following option may be a way to expose this functionality in this API. +// // LevelFunc sets a function that associates nesting levels with the given text. +// // The levels function will be called with monotonically increasing values for p. +// func LevelFunc(levels func(p int) int) Option { +// panic("unimplemented") +// } + +// DefaultDirection sets the default direction for a Paragraph. The direction is +// overridden if the text contains directional characters. +func DefaultDirection(d Direction) Option { + panic("unimplemented") +} + +// A Paragraph holds a single Paragraph for Bidi processing. +type Paragraph struct { + // buffers +} + +// SetBytes configures p for the given paragraph text. It replaces text +// previously set by SetBytes or SetString. If b contains a paragraph separator +// it will only process the first paragraph and report the number of bytes +// consumed from b including this separator. Error may be non-nil if options are +// given. +func (p *Paragraph) SetBytes(b []byte, opts ...Option) (n int, err error) { + panic("unimplemented") +} + +// SetString configures p for the given paragraph text. It replaces text +// previously set by SetBytes or SetString. If b contains a paragraph separator +// it will only process the first paragraph and report the number of bytes +// consumed from b including this separator. Error may be non-nil if options are +// given. +func (p *Paragraph) SetString(s string, opts ...Option) (n int, err error) { + panic("unimplemented") +} + +// IsLeftToRight reports whether the principle direction of rendering for this +// paragraphs is left-to-right. If this returns false, the principle direction +// of rendering is right-to-left. +func (p *Paragraph) IsLeftToRight() bool { + panic("unimplemented") +} + +// Direction returns the direction of the text of this paragraph. +// +// The direction may be LeftToRight, RightToLeft, Mixed, or Neutral. +func (p *Paragraph) Direction() Direction { + panic("unimplemented") +} + +// RunAt reports the Run at the given position of the input text. +// +// This method can be used for computing line breaks on paragraphs. +func (p *Paragraph) RunAt(pos int) Run { + panic("unimplemented") +} + +// Order computes the visual ordering of all the runs in a Paragraph. +func (p *Paragraph) Order() (Ordering, error) { + panic("unimplemented") +} + +// Line computes the visual ordering of runs for a single line starting and +// ending at the given positions in the original text. +func (p *Paragraph) Line(start, end int) (Ordering, error) { + panic("unimplemented") +} + +// An Ordering holds the computed visual order of runs of a Paragraph. Calling +// SetBytes or SetString on the originating Paragraph invalidates an Ordering. +// The methods of an Ordering should only be called by one goroutine at a time. +type Ordering struct{} + +// Direction reports the directionality of the runs. +// +// The direction may be LeftToRight, RightToLeft, Mixed, or Neutral. +func (o *Ordering) Direction() Direction { + panic("unimplemented") +} + +// NumRuns returns the number of runs. +func (o *Ordering) NumRuns() int { + panic("unimplemented") +} + +// Run returns the ith run within the ordering. +func (o *Ordering) Run(i int) Run { + panic("unimplemented") +} + +// TODO: perhaps with options. +// // Reorder creates a reader that reads the runes in visual order per character. +// // Modifiers remain after the runes they modify. +// func (l *Runs) Reorder() io.Reader { +// panic("unimplemented") +// } + +// A Run is a continuous sequence of characters of a single direction. +type Run struct { +} + +// String returns the text of the run in its original order. +func (r *Run) String() string { + panic("unimplemented") +} + +// Bytes returns the text of the run in its original order. +func (r *Run) Bytes() []byte { + panic("unimplemented") +} + +// TODO: methods for +// - Display order +// - headers and footers +// - bracket replacement. + +// Direction reports the direction of the run. +func (r *Run) Direction() Direction { + panic("unimplemented") +} + +// Position of the Run within the text passed to SetBytes or SetString of the +// originating Paragraph value. +func (r *Run) Pos() (start, end int) { + panic("unimplemented") +} + +// AppendReverse reverses the order of characters of in, appends them to out, +// and returns the result. Modifiers will still follow the runes they modify. +// Brackets are replaced with their counterparts. +func AppendReverse(out, in []byte) []byte { + panic("unimplemented") +} + +// ReverseString reverses the order of characters in s and returns a new string. +// Modifiers will still follow the runes they modify. Brackets are replaced with +// their counterparts. +func ReverseString(s string) string { + panic("unimplemented") +} diff --git a/vendor/golang.org/x/text/unicode/bidi/bracket.go b/vendor/golang.org/x/text/unicode/bidi/bracket.go new file mode 100644 index 0000000000..1853939791 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/bracket.go @@ -0,0 +1,335 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package bidi + +import ( + "container/list" + "fmt" + "sort" +) + +// This file contains a port of the reference implementation of the +// Bidi Parentheses Algorithm: +// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/BidiPBAReference.java +// +// The implementation in this file covers definitions BD14-BD16 and rule N0 +// of UAX#9. +// +// Some preprocessing is done for each rune before data is passed to this +// algorithm: +// - opening and closing brackets are identified +// - a bracket pair type, like '(' and ')' is assigned a unique identifier that +// is identical for the opening and closing bracket. It is left to do these +// mappings. +// - The BPA algorithm requires that bracket characters that are canonical +// equivalents of each other be able to be substituted for each other. +// It is the responsibility of the caller to do this canonicalization. +// +// In implementing BD16, this implementation departs slightly from the "logical" +// algorithm defined in UAX#9. In particular, the stack referenced there +// supports operations that go beyond a "basic" stack. An equivalent +// implementation based on a linked list is used here. + +// Bidi_Paired_Bracket_Type +// BD14. An opening paired bracket is a character whose +// Bidi_Paired_Bracket_Type property value is Open. +// +// BD15. A closing paired bracket is a character whose +// Bidi_Paired_Bracket_Type property value is Close. +type bracketType byte + +const ( + bpNone bracketType = iota + bpOpen + bpClose +) + +// bracketPair holds a pair of index values for opening and closing bracket +// location of a bracket pair. +type bracketPair struct { + opener int + closer int +} + +func (b *bracketPair) String() string { + return fmt.Sprintf("(%v, %v)", b.opener, b.closer) +} + +// bracketPairs is a slice of bracketPairs with a sort.Interface implementation. +type bracketPairs []bracketPair + +func (b bracketPairs) Len() int { return len(b) } +func (b bracketPairs) Swap(i, j int) { b[i], b[j] = b[j], b[i] } +func (b bracketPairs) Less(i, j int) bool { return b[i].opener < b[j].opener } + +// resolvePairedBrackets runs the paired bracket part of the UBA algorithm. +// +// For each rune, it takes the indexes into the original string, the class the +// bracket type (in pairTypes) and the bracket identifier (pairValues). It also +// takes the direction type for the start-of-sentence and the embedding level. +// +// The identifiers for bracket types are the rune of the canonicalized opening +// bracket for brackets (open or close) or 0 for runes that are not brackets. +func resolvePairedBrackets(s *isolatingRunSequence) { + p := bracketPairer{ + sos: s.sos, + openers: list.New(), + codesIsolatedRun: s.types, + indexes: s.indexes, + } + dirEmbed := L + if s.level&1 != 0 { + dirEmbed = R + } + p.locateBrackets(s.p.pairTypes, s.p.pairValues) + p.resolveBrackets(dirEmbed, s.p.initialTypes) +} + +type bracketPairer struct { + sos Class // direction corresponding to start of sequence + + // The following is a restatement of BD 16 using non-algorithmic language. + // + // A bracket pair is a pair of characters consisting of an opening + // paired bracket and a closing paired bracket such that the + // Bidi_Paired_Bracket property value of the former equals the latter, + // subject to the following constraints. + // - both characters of a pair occur in the same isolating run sequence + // - the closing character of a pair follows the opening character + // - any bracket character can belong at most to one pair, the earliest possible one + // - any bracket character not part of a pair is treated like an ordinary character + // - pairs may nest properly, but their spans may not overlap otherwise + + // Bracket characters with canonical decompositions are supposed to be + // treated as if they had been normalized, to allow normalized and non- + // normalized text to give the same result. In this implementation that step + // is pushed out to the caller. The caller has to ensure that the pairValue + // slices contain the rune of the opening bracket after normalization for + // any opening or closing bracket. + + openers *list.List // list of positions for opening brackets + + // bracket pair positions sorted by location of opening bracket + pairPositions bracketPairs + + codesIsolatedRun []Class // directional bidi codes for an isolated run + indexes []int // array of index values into the original string + +} + +// matchOpener reports whether characters at given positions form a matching +// bracket pair. +func (p *bracketPairer) matchOpener(pairValues []rune, opener, closer int) bool { + return pairValues[p.indexes[opener]] == pairValues[p.indexes[closer]] +} + +const maxPairingDepth = 63 + +// locateBrackets locates matching bracket pairs according to BD16. +// +// This implementation uses a linked list instead of a stack, because, while +// elements are added at the front (like a push) they are not generally removed +// in atomic 'pop' operations, reducing the benefit of the stack archetype. +func (p *bracketPairer) locateBrackets(pairTypes []bracketType, pairValues []rune) { + // traverse the run + // do that explicitly (not in a for-each) so we can record position + for i, index := range p.indexes { + + // look at the bracket type for each character + if pairTypes[index] == bpNone || p.codesIsolatedRun[i] != ON { + // continue scanning + continue + } + switch pairTypes[index] { + case bpOpen: + // check if maximum pairing depth reached + if p.openers.Len() == maxPairingDepth { + p.openers.Init() + return + } + // remember opener location, most recent first + p.openers.PushFront(i) + + case bpClose: + // see if there is a match + count := 0 + for elem := p.openers.Front(); elem != nil; elem = elem.Next() { + count++ + opener := elem.Value.(int) + if p.matchOpener(pairValues, opener, i) { + // if the opener matches, add nested pair to the ordered list + p.pairPositions = append(p.pairPositions, bracketPair{opener, i}) + // remove up to and including matched opener + for ; count > 0; count-- { + p.openers.Remove(p.openers.Front()) + } + break + } + } + sort.Sort(p.pairPositions) + // if we get here, the closing bracket matched no openers + // and gets ignored + } + } +} + +// Bracket pairs within an isolating run sequence are processed as units so +// that both the opening and the closing paired bracket in a pair resolve to +// the same direction. +// +// N0. Process bracket pairs in an isolating run sequence sequentially in +// the logical order of the text positions of the opening paired brackets +// using the logic given below. Within this scope, bidirectional types EN +// and AN are treated as R. +// +// Identify the bracket pairs in the current isolating run sequence +// according to BD16. For each bracket-pair element in the list of pairs of +// text positions: +// +// a Inspect the bidirectional types of the characters enclosed within the +// bracket pair. +// +// b If any strong type (either L or R) matching the embedding direction is +// found, set the type for both brackets in the pair to match the embedding +// direction. +// +// o [ e ] o -> o e e e o +// +// o [ o e ] -> o e o e e +// +// o [ NI e ] -> o e NI e e +// +// c Otherwise, if a strong type (opposite the embedding direction) is +// found, test for adjacent strong types as follows: 1 First, check +// backwards before the opening paired bracket until the first strong type +// (L, R, or sos) is found. If that first preceding strong type is opposite +// the embedding direction, then set the type for both brackets in the pair +// to that type. 2 Otherwise, set the type for both brackets in the pair to +// the embedding direction. +// +// o [ o ] e -> o o o o e +// +// o [ o NI ] o -> o o o NI o o +// +// e [ o ] o -> e e o e o +// +// e [ o ] e -> e e o e e +// +// e ( o [ o ] NI ) e -> e e o o o o NI e e +// +// d Otherwise, do not set the type for the current bracket pair. Note that +// if the enclosed text contains no strong types the paired brackets will +// both resolve to the same level when resolved individually using rules N1 +// and N2. +// +// e ( NI ) o -> e ( NI ) o + +// getStrongTypeN0 maps character's directional code to strong type as required +// by rule N0. +// +// TODO: have separate type for "strong" directionality. +func (p *bracketPairer) getStrongTypeN0(index int) Class { + switch p.codesIsolatedRun[index] { + // in the scope of N0, number types are treated as R + case EN, AN, AL, R: + return R + case L: + return L + default: + return ON + } +} + +// classifyPairContent reports the strong types contained inside a Bracket Pair, +// assuming the given embedding direction. +// +// It returns ON if no strong type is found. If a single strong type is found, +// it returns this type. Otherwise it returns the embedding direction. +// +// TODO: use separate type for "strong" directionality. +func (p *bracketPairer) classifyPairContent(loc bracketPair, dirEmbed Class) Class { + dirOpposite := ON + for i := loc.opener + 1; i < loc.closer; i++ { + dir := p.getStrongTypeN0(i) + if dir == ON { + continue + } + if dir == dirEmbed { + return dir // type matching embedding direction found + } + dirOpposite = dir + } + // return ON if no strong type found, or class opposite to dirEmbed + return dirOpposite +} + +// classBeforePair determines which strong types are present before a Bracket +// Pair. Return R or L if strong type found, otherwise ON. +func (p *bracketPairer) classBeforePair(loc bracketPair) Class { + for i := loc.opener - 1; i >= 0; i-- { + if dir := p.getStrongTypeN0(i); dir != ON { + return dir + } + } + // no strong types found, return sos + return p.sos +} + +// assignBracketType implements rule N0 for a single bracket pair. +func (p *bracketPairer) assignBracketType(loc bracketPair, dirEmbed Class, initialTypes []Class) { + // rule "N0, a", inspect contents of pair + dirPair := p.classifyPairContent(loc, dirEmbed) + + // dirPair is now L, R, or N (no strong type found) + + // the following logical tests are performed out of order compared to + // the statement of the rules but yield the same results + if dirPair == ON { + return // case "d" - nothing to do + } + + if dirPair != dirEmbed { + // case "c": strong type found, opposite - check before (c.1) + dirPair = p.classBeforePair(loc) + if dirPair == dirEmbed || dirPair == ON { + // no strong opposite type found before - use embedding (c.2) + dirPair = dirEmbed + } + } + // else: case "b", strong type found matching embedding, + // no explicit action needed, as dirPair is already set to embedding + // direction + + // set the bracket types to the type found + p.setBracketsToType(loc, dirPair, initialTypes) +} + +func (p *bracketPairer) setBracketsToType(loc bracketPair, dirPair Class, initialTypes []Class) { + p.codesIsolatedRun[loc.opener] = dirPair + p.codesIsolatedRun[loc.closer] = dirPair + + for i := loc.opener + 1; i < loc.closer; i++ { + index := p.indexes[i] + if initialTypes[index] != NSM { + break + } + p.codesIsolatedRun[i] = dirPair + } + + for i := loc.closer + 1; i < len(p.indexes); i++ { + index := p.indexes[i] + if initialTypes[index] != NSM { + break + } + p.codesIsolatedRun[i] = dirPair + } +} + +// resolveBrackets implements rule N0 for a list of pairs. +func (p *bracketPairer) resolveBrackets(dirEmbed Class, initialTypes []Class) { + for _, loc := range p.pairPositions { + p.assignBracketType(loc, dirEmbed, initialTypes) + } +} diff --git a/vendor/golang.org/x/text/unicode/bidi/core.go b/vendor/golang.org/x/text/unicode/bidi/core.go new file mode 100644 index 0000000000..48d144008a --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/core.go @@ -0,0 +1,1058 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package bidi + +import "log" + +// This implementation is a port based on the reference implementation found at: +// https://www.unicode.org/Public/PROGRAMS/BidiReferenceJava/ +// +// described in Unicode Bidirectional Algorithm (UAX #9). +// +// Input: +// There are two levels of input to the algorithm, since clients may prefer to +// supply some information from out-of-band sources rather than relying on the +// default behavior. +// +// - Bidi class array +// - Bidi class array, with externally supplied base line direction +// +// Output: +// Output is separated into several stages: +// +// - levels array over entire paragraph +// - reordering array over entire paragraph +// - levels array over line +// - reordering array over line +// +// Note that for conformance to the Unicode Bidirectional Algorithm, +// implementations are only required to generate correct reordering and +// character directionality (odd or even levels) over a line. Generating +// identical level arrays over a line is not required. Bidi explicit format +// codes (LRE, RLE, LRO, RLO, PDF) and BN can be assigned arbitrary levels and +// positions as long as the rest of the input is properly reordered. +// +// As the algorithm is defined to operate on a single paragraph at a time, this +// implementation is written to handle single paragraphs. Thus rule P1 is +// presumed by this implementation-- the data provided to the implementation is +// assumed to be a single paragraph, and either contains no 'B' codes, or a +// single 'B' code at the end of the input. 'B' is allowed as input to +// illustrate how the algorithm assigns it a level. +// +// Also note that rules L3 and L4 depend on the rendering engine that uses the +// result of the bidi algorithm. This implementation assumes that the rendering +// engine expects combining marks in visual order (e.g. to the left of their +// base character in RTL runs) and that it adjusts the glyphs used to render +// mirrored characters that are in RTL runs so that they render appropriately. + +// level is the embedding level of a character. Even embedding levels indicate +// left-to-right order and odd levels indicate right-to-left order. The special +// level of -1 is reserved for undefined order. +type level int8 + +const implicitLevel level = -1 + +// in returns if x is equal to any of the values in set. +func (c Class) in(set ...Class) bool { + for _, s := range set { + if c == s { + return true + } + } + return false +} + +// A paragraph contains the state of a paragraph. +type paragraph struct { + initialTypes []Class + + // Arrays of properties needed for paired bracket evaluation in N0 + pairTypes []bracketType // paired Bracket types for paragraph + pairValues []rune // rune for opening bracket or pbOpen and pbClose; 0 for pbNone + + embeddingLevel level // default: = implicitLevel; + + // at the paragraph levels + resultTypes []Class + resultLevels []level + + // Index of matching PDI for isolate initiator characters. For other + // characters, the value of matchingPDI will be set to -1. For isolate + // initiators with no matching PDI, matchingPDI will be set to the length of + // the input string. + matchingPDI []int + + // Index of matching isolate initiator for PDI characters. For other + // characters, and for PDIs with no matching isolate initiator, the value of + // matchingIsolateInitiator will be set to -1. + matchingIsolateInitiator []int +} + +// newParagraph initializes a paragraph. The user needs to supply a few arrays +// corresponding to the preprocessed text input. The types correspond to the +// Unicode BiDi classes for each rune. pairTypes indicates the bracket type for +// each rune. pairValues provides a unique bracket class identifier for each +// rune (suggested is the rune of the open bracket for opening and matching +// close brackets, after normalization). The embedding levels are optional, but +// may be supplied to encode embedding levels of styled text. +// +// TODO: return an error. +func newParagraph(types []Class, pairTypes []bracketType, pairValues []rune, levels level) *paragraph { + validateTypes(types) + validatePbTypes(pairTypes) + validatePbValues(pairValues, pairTypes) + validateParagraphEmbeddingLevel(levels) + + p := ¶graph{ + initialTypes: append([]Class(nil), types...), + embeddingLevel: levels, + + pairTypes: pairTypes, + pairValues: pairValues, + + resultTypes: append([]Class(nil), types...), + } + p.run() + return p +} + +func (p *paragraph) Len() int { return len(p.initialTypes) } + +// The algorithm. Does not include line-based processing (Rules L1, L2). +// These are applied later in the line-based phase of the algorithm. +func (p *paragraph) run() { + p.determineMatchingIsolates() + + // 1) determining the paragraph level + // Rule P1 is the requirement for entering this algorithm. + // Rules P2, P3. + // If no externally supplied paragraph embedding level, use default. + if p.embeddingLevel == implicitLevel { + p.embeddingLevel = p.determineParagraphEmbeddingLevel(0, p.Len()) + } + + // Initialize result levels to paragraph embedding level. + p.resultLevels = make([]level, p.Len()) + setLevels(p.resultLevels, p.embeddingLevel) + + // 2) Explicit levels and directions + // Rules X1-X8. + p.determineExplicitEmbeddingLevels() + + // Rule X9. + // We do not remove the embeddings, the overrides, the PDFs, and the BNs + // from the string explicitly. But they are not copied into isolating run + // sequences when they are created, so they are removed for all + // practical purposes. + + // Rule X10. + // Run remainder of algorithm one isolating run sequence at a time + for _, seq := range p.determineIsolatingRunSequences() { + // 3) resolving weak types + // Rules W1-W7. + seq.resolveWeakTypes() + + // 4a) resolving paired brackets + // Rule N0 + resolvePairedBrackets(seq) + + // 4b) resolving neutral types + // Rules N1-N3. + seq.resolveNeutralTypes() + + // 5) resolving implicit embedding levels + // Rules I1, I2. + seq.resolveImplicitLevels() + + // Apply the computed levels and types + seq.applyLevelsAndTypes() + } + + // Assign appropriate levels to 'hide' LREs, RLEs, LROs, RLOs, PDFs, and + // BNs. This is for convenience, so the resulting level array will have + // a value for every character. + p.assignLevelsToCharactersRemovedByX9() +} + +// determineMatchingIsolates determines the matching PDI for each isolate +// initiator and vice versa. +// +// Definition BD9. +// +// At the end of this function: +// +// - The member variable matchingPDI is set to point to the index of the +// matching PDI character for each isolate initiator character. If there is +// no matching PDI, it is set to the length of the input text. For other +// characters, it is set to -1. +// - The member variable matchingIsolateInitiator is set to point to the +// index of the matching isolate initiator character for each PDI character. +// If there is no matching isolate initiator, or the character is not a PDI, +// it is set to -1. +func (p *paragraph) determineMatchingIsolates() { + p.matchingPDI = make([]int, p.Len()) + p.matchingIsolateInitiator = make([]int, p.Len()) + + for i := range p.matchingIsolateInitiator { + p.matchingIsolateInitiator[i] = -1 + } + + for i := range p.matchingPDI { + p.matchingPDI[i] = -1 + + if t := p.resultTypes[i]; t.in(LRI, RLI, FSI) { + depthCounter := 1 + for j := i + 1; j < p.Len(); j++ { + if u := p.resultTypes[j]; u.in(LRI, RLI, FSI) { + depthCounter++ + } else if u == PDI { + if depthCounter--; depthCounter == 0 { + p.matchingPDI[i] = j + p.matchingIsolateInitiator[j] = i + break + } + } + } + if p.matchingPDI[i] == -1 { + p.matchingPDI[i] = p.Len() + } + } + } +} + +// determineParagraphEmbeddingLevel reports the resolved paragraph direction of +// the substring limited by the given range [start, end). +// +// Determines the paragraph level based on rules P2, P3. This is also used +// in rule X5c to find if an FSI should resolve to LRI or RLI. +func (p *paragraph) determineParagraphEmbeddingLevel(start, end int) level { + var strongType Class = unknownClass + + // Rule P2. + for i := start; i < end; i++ { + if t := p.resultTypes[i]; t.in(L, AL, R) { + strongType = t + break + } else if t.in(FSI, LRI, RLI) { + i = p.matchingPDI[i] // skip over to the matching PDI + if i > end { + log.Panic("assert (i <= end)") + } + } + } + // Rule P3. + switch strongType { + case unknownClass: // none found + // default embedding level when no strong types found is 0. + return 0 + case L: + return 0 + default: // AL, R + return 1 + } +} + +const maxDepth = 125 + +// This stack will store the embedding levels and override and isolated +// statuses +type directionalStatusStack struct { + stackCounter int + embeddingLevelStack [maxDepth + 1]level + overrideStatusStack [maxDepth + 1]Class + isolateStatusStack [maxDepth + 1]bool +} + +func (s *directionalStatusStack) empty() { s.stackCounter = 0 } +func (s *directionalStatusStack) pop() { s.stackCounter-- } +func (s *directionalStatusStack) depth() int { return s.stackCounter } + +func (s *directionalStatusStack) push(level level, overrideStatus Class, isolateStatus bool) { + s.embeddingLevelStack[s.stackCounter] = level + s.overrideStatusStack[s.stackCounter] = overrideStatus + s.isolateStatusStack[s.stackCounter] = isolateStatus + s.stackCounter++ +} + +func (s *directionalStatusStack) lastEmbeddingLevel() level { + return s.embeddingLevelStack[s.stackCounter-1] +} + +func (s *directionalStatusStack) lastDirectionalOverrideStatus() Class { + return s.overrideStatusStack[s.stackCounter-1] +} + +func (s *directionalStatusStack) lastDirectionalIsolateStatus() bool { + return s.isolateStatusStack[s.stackCounter-1] +} + +// Determine explicit levels using rules X1 - X8 +func (p *paragraph) determineExplicitEmbeddingLevels() { + var stack directionalStatusStack + var overflowIsolateCount, overflowEmbeddingCount, validIsolateCount int + + // Rule X1. + stack.push(p.embeddingLevel, ON, false) + + for i, t := range p.resultTypes { + // Rules X2, X3, X4, X5, X5a, X5b, X5c + switch t { + case RLE, LRE, RLO, LRO, RLI, LRI, FSI: + isIsolate := t.in(RLI, LRI, FSI) + isRTL := t.in(RLE, RLO, RLI) + + // override if this is an FSI that resolves to RLI + if t == FSI { + isRTL = (p.determineParagraphEmbeddingLevel(i+1, p.matchingPDI[i]) == 1) + } + if isIsolate { + p.resultLevels[i] = stack.lastEmbeddingLevel() + if stack.lastDirectionalOverrideStatus() != ON { + p.resultTypes[i] = stack.lastDirectionalOverrideStatus() + } + } + + var newLevel level + if isRTL { + // least greater odd + newLevel = (stack.lastEmbeddingLevel() + 1) | 1 + } else { + // least greater even + newLevel = (stack.lastEmbeddingLevel() + 2) &^ 1 + } + + if newLevel <= maxDepth && overflowIsolateCount == 0 && overflowEmbeddingCount == 0 { + if isIsolate { + validIsolateCount++ + } + // Push new embedding level, override status, and isolated + // status. + // No check for valid stack counter, since the level check + // suffices. + switch t { + case LRO: + stack.push(newLevel, L, isIsolate) + case RLO: + stack.push(newLevel, R, isIsolate) + default: + stack.push(newLevel, ON, isIsolate) + } + // Not really part of the spec + if !isIsolate { + p.resultLevels[i] = newLevel + } + } else { + // This is an invalid explicit formatting character, + // so apply the "Otherwise" part of rules X2-X5b. + if isIsolate { + overflowIsolateCount++ + } else { // !isIsolate + if overflowIsolateCount == 0 { + overflowEmbeddingCount++ + } + } + } + + // Rule X6a + case PDI: + if overflowIsolateCount > 0 { + overflowIsolateCount-- + } else if validIsolateCount == 0 { + // do nothing + } else { + overflowEmbeddingCount = 0 + for !stack.lastDirectionalIsolateStatus() { + stack.pop() + } + stack.pop() + validIsolateCount-- + } + p.resultLevels[i] = stack.lastEmbeddingLevel() + + // Rule X7 + case PDF: + // Not really part of the spec + p.resultLevels[i] = stack.lastEmbeddingLevel() + + if overflowIsolateCount > 0 { + // do nothing + } else if overflowEmbeddingCount > 0 { + overflowEmbeddingCount-- + } else if !stack.lastDirectionalIsolateStatus() && stack.depth() >= 2 { + stack.pop() + } + + case B: // paragraph separator. + // Rule X8. + + // These values are reset for clarity, in this implementation B + // can only occur as the last code in the array. + stack.empty() + overflowIsolateCount = 0 + overflowEmbeddingCount = 0 + validIsolateCount = 0 + p.resultLevels[i] = p.embeddingLevel + + default: + p.resultLevels[i] = stack.lastEmbeddingLevel() + if stack.lastDirectionalOverrideStatus() != ON { + p.resultTypes[i] = stack.lastDirectionalOverrideStatus() + } + } + } +} + +type isolatingRunSequence struct { + p *paragraph + + indexes []int // indexes to the original string + + types []Class // type of each character using the index + resolvedLevels []level // resolved levels after application of rules + level level + sos, eos Class +} + +func (i *isolatingRunSequence) Len() int { return len(i.indexes) } + +func maxLevel(a, b level) level { + if a > b { + return a + } + return b +} + +// Rule X10, second bullet: Determine the start-of-sequence (sos) and end-of-sequence (eos) types, +// either L or R, for each isolating run sequence. +func (p *paragraph) isolatingRunSequence(indexes []int) *isolatingRunSequence { + length := len(indexes) + types := make([]Class, length) + for i, x := range indexes { + types[i] = p.resultTypes[x] + } + + // assign level, sos and eos + prevChar := indexes[0] - 1 + for prevChar >= 0 && isRemovedByX9(p.initialTypes[prevChar]) { + prevChar-- + } + prevLevel := p.embeddingLevel + if prevChar >= 0 { + prevLevel = p.resultLevels[prevChar] + } + + var succLevel level + lastType := types[length-1] + if lastType.in(LRI, RLI, FSI) { + succLevel = p.embeddingLevel + } else { + // the first character after the end of run sequence + limit := indexes[length-1] + 1 + for ; limit < p.Len() && isRemovedByX9(p.initialTypes[limit]); limit++ { + + } + succLevel = p.embeddingLevel + if limit < p.Len() { + succLevel = p.resultLevels[limit] + } + } + level := p.resultLevels[indexes[0]] + return &isolatingRunSequence{ + p: p, + indexes: indexes, + types: types, + level: level, + sos: typeForLevel(maxLevel(prevLevel, level)), + eos: typeForLevel(maxLevel(succLevel, level)), + } +} + +// Resolving weak types Rules W1-W7. +// +// Note that some weak types (EN, AN) remain after this processing is +// complete. +func (s *isolatingRunSequence) resolveWeakTypes() { + + // on entry, only these types remain + s.assertOnly(L, R, AL, EN, ES, ET, AN, CS, B, S, WS, ON, NSM, LRI, RLI, FSI, PDI) + + // Rule W1. + // Changes all NSMs. + preceedingCharacterType := s.sos + for i, t := range s.types { + if t == NSM { + s.types[i] = preceedingCharacterType + } else { + if t.in(LRI, RLI, FSI, PDI) { + preceedingCharacterType = ON + } + preceedingCharacterType = t + } + } + + // Rule W2. + // EN does not change at the start of the run, because sos != AL. + for i, t := range s.types { + if t == EN { + for j := i - 1; j >= 0; j-- { + if t := s.types[j]; t.in(L, R, AL) { + if t == AL { + s.types[i] = AN + } + break + } + } + } + } + + // Rule W3. + for i, t := range s.types { + if t == AL { + s.types[i] = R + } + } + + // Rule W4. + // Since there must be values on both sides for this rule to have an + // effect, the scan skips the first and last value. + // + // Although the scan proceeds left to right, and changes the type + // values in a way that would appear to affect the computations + // later in the scan, there is actually no problem. A change in the + // current value can only affect the value to its immediate right, + // and only affect it if it is ES or CS. But the current value can + // only change if the value to its right is not ES or CS. Thus + // either the current value will not change, or its change will have + // no effect on the remainder of the analysis. + + for i := 1; i < s.Len()-1; i++ { + t := s.types[i] + if t == ES || t == CS { + prevSepType := s.types[i-1] + succSepType := s.types[i+1] + if prevSepType == EN && succSepType == EN { + s.types[i] = EN + } else if s.types[i] == CS && prevSepType == AN && succSepType == AN { + s.types[i] = AN + } + } + } + + // Rule W5. + for i, t := range s.types { + if t == ET { + // locate end of sequence + runStart := i + runEnd := s.findRunLimit(runStart, ET) + + // check values at ends of sequence + t := s.sos + if runStart > 0 { + t = s.types[runStart-1] + } + if t != EN { + t = s.eos + if runEnd < len(s.types) { + t = s.types[runEnd] + } + } + if t == EN { + setTypes(s.types[runStart:runEnd], EN) + } + // continue at end of sequence + i = runEnd + } + } + + // Rule W6. + for i, t := range s.types { + if t.in(ES, ET, CS) { + s.types[i] = ON + } + } + + // Rule W7. + for i, t := range s.types { + if t == EN { + // set default if we reach start of run + prevStrongType := s.sos + for j := i - 1; j >= 0; j-- { + t = s.types[j] + if t == L || t == R { // AL's have been changed to R + prevStrongType = t + break + } + } + if prevStrongType == L { + s.types[i] = L + } + } + } +} + +// 6) resolving neutral types Rules N1-N2. +func (s *isolatingRunSequence) resolveNeutralTypes() { + + // on entry, only these types can be in resultTypes + s.assertOnly(L, R, EN, AN, B, S, WS, ON, RLI, LRI, FSI, PDI) + + for i, t := range s.types { + switch t { + case WS, ON, B, S, RLI, LRI, FSI, PDI: + // find bounds of run of neutrals + runStart := i + runEnd := s.findRunLimit(runStart, B, S, WS, ON, RLI, LRI, FSI, PDI) + + // determine effective types at ends of run + var leadType, trailType Class + + // Note that the character found can only be L, R, AN, or + // EN. + if runStart == 0 { + leadType = s.sos + } else { + leadType = s.types[runStart-1] + if leadType.in(AN, EN) { + leadType = R + } + } + if runEnd == len(s.types) { + trailType = s.eos + } else { + trailType = s.types[runEnd] + if trailType.in(AN, EN) { + trailType = R + } + } + + var resolvedType Class + if leadType == trailType { + // Rule N1. + resolvedType = leadType + } else { + // Rule N2. + // Notice the embedding level of the run is used, not + // the paragraph embedding level. + resolvedType = typeForLevel(s.level) + } + + setTypes(s.types[runStart:runEnd], resolvedType) + + // skip over run of (former) neutrals + i = runEnd + } + } +} + +func setLevels(levels []level, newLevel level) { + for i := range levels { + levels[i] = newLevel + } +} + +func setTypes(types []Class, newType Class) { + for i := range types { + types[i] = newType + } +} + +// 7) resolving implicit embedding levels Rules I1, I2. +func (s *isolatingRunSequence) resolveImplicitLevels() { + + // on entry, only these types can be in resultTypes + s.assertOnly(L, R, EN, AN) + + s.resolvedLevels = make([]level, len(s.types)) + setLevels(s.resolvedLevels, s.level) + + if (s.level & 1) == 0 { // even level + for i, t := range s.types { + // Rule I1. + if t == L { + // no change + } else if t == R { + s.resolvedLevels[i] += 1 + } else { // t == AN || t == EN + s.resolvedLevels[i] += 2 + } + } + } else { // odd level + for i, t := range s.types { + // Rule I2. + if t == R { + // no change + } else { // t == L || t == AN || t == EN + s.resolvedLevels[i] += 1 + } + } + } +} + +// Applies the levels and types resolved in rules W1-I2 to the +// resultLevels array. +func (s *isolatingRunSequence) applyLevelsAndTypes() { + for i, x := range s.indexes { + s.p.resultTypes[x] = s.types[i] + s.p.resultLevels[x] = s.resolvedLevels[i] + } +} + +// Return the limit of the run consisting only of the types in validSet +// starting at index. This checks the value at index, and will return +// index if that value is not in validSet. +func (s *isolatingRunSequence) findRunLimit(index int, validSet ...Class) int { +loop: + for ; index < len(s.types); index++ { + t := s.types[index] + for _, valid := range validSet { + if t == valid { + continue loop + } + } + return index // didn't find a match in validSet + } + return len(s.types) +} + +// Algorithm validation. Assert that all values in types are in the +// provided set. +func (s *isolatingRunSequence) assertOnly(codes ...Class) { +loop: + for i, t := range s.types { + for _, c := range codes { + if t == c { + continue loop + } + } + log.Panicf("invalid bidi code %v present in assertOnly at position %d", t, s.indexes[i]) + } +} + +// determineLevelRuns returns an array of level runs. Each level run is +// described as an array of indexes into the input string. +// +// Determines the level runs. Rule X9 will be applied in determining the +// runs, in the way that makes sure the characters that are supposed to be +// removed are not included in the runs. +func (p *paragraph) determineLevelRuns() [][]int { + run := []int{} + allRuns := [][]int{} + currentLevel := implicitLevel + + for i := range p.initialTypes { + if !isRemovedByX9(p.initialTypes[i]) { + if p.resultLevels[i] != currentLevel { + // we just encountered a new run; wrap up last run + if currentLevel >= 0 { // only wrap it up if there was a run + allRuns = append(allRuns, run) + run = nil + } + // Start new run + currentLevel = p.resultLevels[i] + } + run = append(run, i) + } + } + // Wrap up the final run, if any + if len(run) > 0 { + allRuns = append(allRuns, run) + } + return allRuns +} + +// Definition BD13. Determine isolating run sequences. +func (p *paragraph) determineIsolatingRunSequences() []*isolatingRunSequence { + levelRuns := p.determineLevelRuns() + + // Compute the run that each character belongs to + runForCharacter := make([]int, p.Len()) + for i, run := range levelRuns { + for _, index := range run { + runForCharacter[index] = i + } + } + + sequences := []*isolatingRunSequence{} + + var currentRunSequence []int + + for _, run := range levelRuns { + first := run[0] + if p.initialTypes[first] != PDI || p.matchingIsolateInitiator[first] == -1 { + currentRunSequence = nil + // int run = i; + for { + // Copy this level run into currentRunSequence + currentRunSequence = append(currentRunSequence, run...) + + last := currentRunSequence[len(currentRunSequence)-1] + lastT := p.initialTypes[last] + if lastT.in(LRI, RLI, FSI) && p.matchingPDI[last] != p.Len() { + run = levelRuns[runForCharacter[p.matchingPDI[last]]] + } else { + break + } + } + sequences = append(sequences, p.isolatingRunSequence(currentRunSequence)) + } + } + return sequences +} + +// Assign level information to characters removed by rule X9. This is for +// ease of relating the level information to the original input data. Note +// that the levels assigned to these codes are arbitrary, they're chosen so +// as to avoid breaking level runs. +func (p *paragraph) assignLevelsToCharactersRemovedByX9() { + for i, t := range p.initialTypes { + if t.in(LRE, RLE, LRO, RLO, PDF, BN) { + p.resultTypes[i] = t + p.resultLevels[i] = -1 + } + } + // now propagate forward the levels information (could have + // propagated backward, the main thing is not to introduce a level + // break where one doesn't already exist). + + if p.resultLevels[0] == -1 { + p.resultLevels[0] = p.embeddingLevel + } + for i := 1; i < len(p.initialTypes); i++ { + if p.resultLevels[i] == -1 { + p.resultLevels[i] = p.resultLevels[i-1] + } + } + // Embedding information is for informational purposes only so need not be + // adjusted. +} + +// +// Output +// + +// getLevels computes levels array breaking lines at offsets in linebreaks. +// Rule L1. +// +// The linebreaks array must include at least one value. The values must be +// in strictly increasing order (no duplicates) between 1 and the length of +// the text, inclusive. The last value must be the length of the text. +func (p *paragraph) getLevels(linebreaks []int) []level { + // Note that since the previous processing has removed all + // P, S, and WS values from resultTypes, the values referred to + // in these rules are the initial types, before any processing + // has been applied (including processing of overrides). + // + // This example implementation has reinserted explicit format codes + // and BN, in order that the levels array correspond to the + // initial text. Their final placement is not normative. + // These codes are treated like WS in this implementation, + // so they don't interrupt sequences of WS. + + validateLineBreaks(linebreaks, p.Len()) + + result := append([]level(nil), p.resultLevels...) + + // don't worry about linebreaks since if there is a break within + // a series of WS values preceding S, the linebreak itself + // causes the reset. + for i, t := range p.initialTypes { + if t.in(B, S) { + // Rule L1, clauses one and two. + result[i] = p.embeddingLevel + + // Rule L1, clause three. + for j := i - 1; j >= 0; j-- { + if isWhitespace(p.initialTypes[j]) { // including format codes + result[j] = p.embeddingLevel + } else { + break + } + } + } + } + + // Rule L1, clause four. + start := 0 + for _, limit := range linebreaks { + for j := limit - 1; j >= start; j-- { + if isWhitespace(p.initialTypes[j]) { // including format codes + result[j] = p.embeddingLevel + } else { + break + } + } + start = limit + } + + return result +} + +// getReordering returns the reordering of lines from a visual index to a +// logical index for line breaks at the given offsets. +// +// Lines are concatenated from left to right. So for example, the fifth +// character from the left on the third line is +// +// getReordering(linebreaks)[linebreaks[1] + 4] +// +// (linebreaks[1] is the position after the last character of the second +// line, which is also the index of the first character on the third line, +// and adding four gets the fifth character from the left). +// +// The linebreaks array must include at least one value. The values must be +// in strictly increasing order (no duplicates) between 1 and the length of +// the text, inclusive. The last value must be the length of the text. +func (p *paragraph) getReordering(linebreaks []int) []int { + validateLineBreaks(linebreaks, p.Len()) + + return computeMultilineReordering(p.getLevels(linebreaks), linebreaks) +} + +// Return multiline reordering array for a given level array. Reordering +// does not occur across a line break. +func computeMultilineReordering(levels []level, linebreaks []int) []int { + result := make([]int, len(levels)) + + start := 0 + for _, limit := range linebreaks { + tempLevels := make([]level, limit-start) + copy(tempLevels, levels[start:]) + + for j, order := range computeReordering(tempLevels) { + result[start+j] = order + start + } + start = limit + } + return result +} + +// Return reordering array for a given level array. This reorders a single +// line. The reordering is a visual to logical map. For example, the +// leftmost char is string.charAt(order[0]). Rule L2. +func computeReordering(levels []level) []int { + result := make([]int, len(levels)) + // initialize order + for i := range result { + result[i] = i + } + + // locate highest level found on line. + // Note the rules say text, but no reordering across line bounds is + // performed, so this is sufficient. + highestLevel := level(0) + lowestOddLevel := level(maxDepth + 2) + for _, level := range levels { + if level > highestLevel { + highestLevel = level + } + if level&1 != 0 && level < lowestOddLevel { + lowestOddLevel = level + } + } + + for level := highestLevel; level >= lowestOddLevel; level-- { + for i := 0; i < len(levels); i++ { + if levels[i] >= level { + // find range of text at or above this level + start := i + limit := i + 1 + for limit < len(levels) && levels[limit] >= level { + limit++ + } + + for j, k := start, limit-1; j < k; j, k = j+1, k-1 { + result[j], result[k] = result[k], result[j] + } + // skip to end of level run + i = limit + } + } + } + + return result +} + +// isWhitespace reports whether the type is considered a whitespace type for the +// line break rules. +func isWhitespace(c Class) bool { + switch c { + case LRE, RLE, LRO, RLO, PDF, LRI, RLI, FSI, PDI, BN, WS: + return true + } + return false +} + +// isRemovedByX9 reports whether the type is one of the types removed in X9. +func isRemovedByX9(c Class) bool { + switch c { + case LRE, RLE, LRO, RLO, PDF, BN: + return true + } + return false +} + +// typeForLevel reports the strong type (L or R) corresponding to the level. +func typeForLevel(level level) Class { + if (level & 0x1) == 0 { + return L + } + return R +} + +// TODO: change validation to not panic + +func validateTypes(types []Class) { + if len(types) == 0 { + log.Panic("types is null") + } + for i, t := range types[:len(types)-1] { + if t == B { + log.Panicf("B type before end of paragraph at index: %d", i) + } + } +} + +func validateParagraphEmbeddingLevel(embeddingLevel level) { + if embeddingLevel != implicitLevel && + embeddingLevel != 0 && + embeddingLevel != 1 { + log.Panicf("illegal paragraph embedding level: %d", embeddingLevel) + } +} + +func validateLineBreaks(linebreaks []int, textLength int) { + prev := 0 + for i, next := range linebreaks { + if next <= prev { + log.Panicf("bad linebreak: %d at index: %d", next, i) + } + prev = next + } + if prev != textLength { + log.Panicf("last linebreak was %d, want %d", prev, textLength) + } +} + +func validatePbTypes(pairTypes []bracketType) { + if len(pairTypes) == 0 { + log.Panic("pairTypes is null") + } + for i, pt := range pairTypes { + switch pt { + case bpNone, bpOpen, bpClose: + default: + log.Panicf("illegal pairType value at %d: %v", i, pairTypes[i]) + } + } +} + +func validatePbValues(pairValues []rune, pairTypes []bracketType) { + if pairValues == nil { + log.Panic("pairValues is null") + } + if len(pairTypes) != len(pairValues) { + log.Panic("pairTypes is different length from pairValues") + } +} diff --git a/vendor/golang.org/x/text/unicode/bidi/gen.go b/vendor/golang.org/x/text/unicode/bidi/gen.go new file mode 100644 index 0000000000..987fc169cc --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/gen.go @@ -0,0 +1,133 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "flag" + "log" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/triegen" + "golang.org/x/text/internal/ucd" +) + +var outputFile = flag.String("out", "tables.go", "output file") + +func main() { + gen.Init() + gen.Repackage("gen_trieval.go", "trieval.go", "bidi") + gen.Repackage("gen_ranges.go", "ranges_test.go", "bidi") + + genTables() +} + +// bidiClass names and codes taken from class "bc" in +// https://www.unicode.org/Public/8.0.0/ucd/PropertyValueAliases.txt +var bidiClass = map[string]Class{ + "AL": AL, // ArabicLetter + "AN": AN, // ArabicNumber + "B": B, // ParagraphSeparator + "BN": BN, // BoundaryNeutral + "CS": CS, // CommonSeparator + "EN": EN, // EuropeanNumber + "ES": ES, // EuropeanSeparator + "ET": ET, // EuropeanTerminator + "L": L, // LeftToRight + "NSM": NSM, // NonspacingMark + "ON": ON, // OtherNeutral + "R": R, // RightToLeft + "S": S, // SegmentSeparator + "WS": WS, // WhiteSpace + + "FSI": Control, + "PDF": Control, + "PDI": Control, + "LRE": Control, + "LRI": Control, + "LRO": Control, + "RLE": Control, + "RLI": Control, + "RLO": Control, +} + +func genTables() { + if numClass > 0x0F { + log.Fatalf("Too many Class constants (%#x > 0x0F).", numClass) + } + w := gen.NewCodeWriter() + defer w.WriteVersionedGoFile(*outputFile, "bidi") + + gen.WriteUnicodeVersion(w) + + t := triegen.NewTrie("bidi") + + // Build data about bracket mapping. These bits need to be or-ed with + // any other bits. + orMask := map[rune]uint64{} + + xorMap := map[rune]int{} + xorMasks := []rune{0} // First value is no-op. + + ucd.Parse(gen.OpenUCDFile("BidiBrackets.txt"), func(p *ucd.Parser) { + r1 := p.Rune(0) + r2 := p.Rune(1) + xor := r1 ^ r2 + if _, ok := xorMap[xor]; !ok { + xorMap[xor] = len(xorMasks) + xorMasks = append(xorMasks, xor) + } + entry := uint64(xorMap[xor]) << xorMaskShift + switch p.String(2) { + case "o": + entry |= openMask + case "c", "n": + default: + log.Fatalf("Unknown bracket class %q.", p.String(2)) + } + orMask[r1] = entry + }) + + w.WriteComment(` + xorMasks contains masks to be xor-ed with brackets to get the reverse + version.`) + w.WriteVar("xorMasks", xorMasks) + + done := map[rune]bool{} + + insert := func(r rune, c Class) { + if !done[r] { + t.Insert(r, orMask[r]|uint64(c)) + done[r] = true + } + } + + // Insert the derived BiDi properties. + ucd.Parse(gen.OpenUCDFile("extracted/DerivedBidiClass.txt"), func(p *ucd.Parser) { + r := p.Rune(0) + class, ok := bidiClass[p.String(1)] + if !ok { + log.Fatalf("%U: Unknown BiDi class %q", r, p.String(1)) + } + insert(r, class) + }) + visitDefaults(insert) + + // TODO: use sparse blocks. This would reduce table size considerably + // from the looks of it. + + sz, err := t.Gen(w) + if err != nil { + log.Fatal(err) + } + w.Size += sz +} + +// dummy values to make methods in gen_common compile. The real versions +// will be generated by this file to tables.go. +var ( + xorMasks []rune +) diff --git a/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go new file mode 100644 index 0000000000..02c3b505d6 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/gen_ranges.go @@ -0,0 +1,57 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +import ( + "unicode" + + "golang.org/x/text/internal/gen" + "golang.org/x/text/internal/ucd" + "golang.org/x/text/unicode/rangetable" +) + +// These tables are hand-extracted from: +// https://www.unicode.org/Public/8.0.0/ucd/extracted/DerivedBidiClass.txt +func visitDefaults(fn func(r rune, c Class)) { + // first write default values for ranges listed above. + visitRunes(fn, AL, []rune{ + 0x0600, 0x07BF, // Arabic + 0x08A0, 0x08FF, // Arabic Extended-A + 0xFB50, 0xFDCF, // Arabic Presentation Forms + 0xFDF0, 0xFDFF, + 0xFE70, 0xFEFF, + 0x0001EE00, 0x0001EEFF, // Arabic Mathematical Alpha Symbols + }) + visitRunes(fn, R, []rune{ + 0x0590, 0x05FF, // Hebrew + 0x07C0, 0x089F, // Nko et al. + 0xFB1D, 0xFB4F, + 0x00010800, 0x00010FFF, // Cypriot Syllabary et. al. + 0x0001E800, 0x0001EDFF, + 0x0001EF00, 0x0001EFFF, + }) + visitRunes(fn, ET, []rune{ // European Terminator + 0x20A0, 0x20Cf, // Currency symbols + }) + rangetable.Visit(unicode.Noncharacter_Code_Point, func(r rune) { + fn(r, BN) // Boundary Neutral + }) + ucd.Parse(gen.OpenUCDFile("DerivedCoreProperties.txt"), func(p *ucd.Parser) { + if p.String(1) == "Default_Ignorable_Code_Point" { + fn(p.Rune(0), BN) // Boundary Neutral + } + }) +} + +func visitRunes(fn func(r rune, c Class), c Class, runes []rune) { + for i := 0; i < len(runes); i += 2 { + lo, hi := runes[i], runes[i+1] + for j := lo; j <= hi; j++ { + fn(j, c) + } + } +} diff --git a/vendor/golang.org/x/text/unicode/bidi/gen_trieval.go b/vendor/golang.org/x/text/unicode/bidi/gen_trieval.go new file mode 100644 index 0000000000..9cb9942894 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/gen_trieval.go @@ -0,0 +1,64 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// +build ignore + +package main + +// Class is the Unicode BiDi class. Each rune has a single class. +type Class uint + +const ( + L Class = iota // LeftToRight + R // RightToLeft + EN // EuropeanNumber + ES // EuropeanSeparator + ET // EuropeanTerminator + AN // ArabicNumber + CS // CommonSeparator + B // ParagraphSeparator + S // SegmentSeparator + WS // WhiteSpace + ON // OtherNeutral + BN // BoundaryNeutral + NSM // NonspacingMark + AL // ArabicLetter + Control // Control LRO - PDI + + numClass + + LRO // LeftToRightOverride + RLO // RightToLeftOverride + LRE // LeftToRightEmbedding + RLE // RightToLeftEmbedding + PDF // PopDirectionalFormat + LRI // LeftToRightIsolate + RLI // RightToLeftIsolate + FSI // FirstStrongIsolate + PDI // PopDirectionalIsolate + + unknownClass = ^Class(0) +) + +var controlToClass = map[rune]Class{ + 0x202D: LRO, // LeftToRightOverride, + 0x202E: RLO, // RightToLeftOverride, + 0x202A: LRE, // LeftToRightEmbedding, + 0x202B: RLE, // RightToLeftEmbedding, + 0x202C: PDF, // PopDirectionalFormat, + 0x2066: LRI, // LeftToRightIsolate, + 0x2067: RLI, // RightToLeftIsolate, + 0x2068: FSI, // FirstStrongIsolate, + 0x2069: PDI, // PopDirectionalIsolate, +} + +// A trie entry has the following bits: +// 7..5 XOR mask for brackets +// 4 1: Bracket open, 0: Bracket close +// 3..0 Class type + +const ( + openMask = 0x10 + xorMaskShift = 5 +) diff --git a/vendor/golang.org/x/text/unicode/bidi/prop.go b/vendor/golang.org/x/text/unicode/bidi/prop.go new file mode 100644 index 0000000000..7c9484e1f5 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/prop.go @@ -0,0 +1,206 @@ +// Copyright 2016 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package bidi + +import "unicode/utf8" + +// Properties provides access to BiDi properties of runes. +type Properties struct { + entry uint8 + last uint8 +} + +var trie = newBidiTrie(0) + +// TODO: using this for bidirule reduces the running time by about 5%. Consider +// if this is worth exposing or if we can find a way to speed up the Class +// method. +// +// // CompactClass is like Class, but maps all of the BiDi control classes +// // (LRO, RLO, LRE, RLE, PDF, LRI, RLI, FSI, PDI) to the class Control. +// func (p Properties) CompactClass() Class { +// return Class(p.entry & 0x0F) +// } + +// Class returns the Bidi class for p. +func (p Properties) Class() Class { + c := Class(p.entry & 0x0F) + if c == Control { + c = controlByteToClass[p.last&0xF] + } + return c +} + +// IsBracket reports whether the rune is a bracket. +func (p Properties) IsBracket() bool { return p.entry&0xF0 != 0 } + +// IsOpeningBracket reports whether the rune is an opening bracket. +// IsBracket must return true. +func (p Properties) IsOpeningBracket() bool { return p.entry&openMask != 0 } + +// TODO: find a better API and expose. +func (p Properties) reverseBracket(r rune) rune { + return xorMasks[p.entry>>xorMaskShift] ^ r +} + +var controlByteToClass = [16]Class{ + 0xD: LRO, // U+202D LeftToRightOverride, + 0xE: RLO, // U+202E RightToLeftOverride, + 0xA: LRE, // U+202A LeftToRightEmbedding, + 0xB: RLE, // U+202B RightToLeftEmbedding, + 0xC: PDF, // U+202C PopDirectionalFormat, + 0x6: LRI, // U+2066 LeftToRightIsolate, + 0x7: RLI, // U+2067 RightToLeftIsolate, + 0x8: FSI, // U+2068 FirstStrongIsolate, + 0x9: PDI, // U+2069 PopDirectionalIsolate, +} + +// LookupRune returns properties for r. +func LookupRune(r rune) (p Properties, size int) { + var buf [4]byte + n := utf8.EncodeRune(buf[:], r) + return Lookup(buf[:n]) +} + +// TODO: these lookup methods are based on the generated trie code. The returned +// sizes have slightly different semantics from the generated code, in that it +// always returns size==1 for an illegal UTF-8 byte (instead of the length +// of the maximum invalid subsequence). Most Transformers, like unicode/norm, +// leave invalid UTF-8 untouched, in which case it has performance benefits to +// do so (without changing the semantics). Bidi requires the semantics used here +// for the bidirule implementation to be compatible with the Go semantics. +// They ultimately should perhaps be adopted by all trie implementations, for +// convenience sake. +// This unrolled code also boosts performance of the secure/bidirule package by +// about 30%. +// So, to remove this code: +// - add option to trie generator to define return type. +// - always return 1 byte size for ill-formed UTF-8 runes. + +// Lookup returns properties for the first rune in s and the width in bytes of +// its encoding. The size will be 0 if s does not hold enough bytes to complete +// the encoding. +func Lookup(s []byte) (p Properties, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return Properties{entry: bidiValues[c0]}, 1 + case c0 < 0xC2: + return Properties{}, 1 + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c1)}, 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c2), last: c2}, 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return Properties{}, 1 + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c3)}, 4 + } + // Illegal rune + return Properties{}, 1 +} + +// LookupString returns properties for the first rune in s and the width in +// bytes of its encoding. The size will be 0 if s does not hold enough bytes to +// complete the encoding. +func LookupString(s string) (p Properties, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return Properties{entry: bidiValues[c0]}, 1 + case c0 < 0xC2: + return Properties{}, 1 + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c1)}, 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c2), last: c2}, 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return Properties{}, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return Properties{}, 1 + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return Properties{}, 1 + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return Properties{}, 1 + } + return Properties{entry: trie.lookupValue(uint32(i), c3)}, 4 + } + // Illegal rune + return Properties{}, 1 +} diff --git a/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go new file mode 100644 index 0000000000..d8c94e1bd1 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables10.0.0.go @@ -0,0 +1,1815 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// +build go1.10,!go1.13 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "10.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 16128 bytes (15.75 KiB). Checksum: 8122d83e461996f. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 228 blocks, 14592 entries, 14592 bytes +// The third block is the zero block. +var bidiValues = [14592]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x0001, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d, + 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d, + 0x5ea: 0x000d, 0x5eb: 0x000d, 0x5ec: 0x000d, 0x5ed: 0x000d, 0x5ee: 0x000d, 0x5ef: 0x000d, + 0x5f0: 0x0001, 0x5f1: 0x0001, 0x5f2: 0x0001, 0x5f3: 0x0001, 0x5f4: 0x0001, 0x5f5: 0x0001, + 0x5f6: 0x0001, 0x5f7: 0x0001, 0x5f8: 0x0001, 0x5f9: 0x0001, 0x5fa: 0x0001, 0x5fb: 0x0001, + 0x5fc: 0x0001, 0x5fd: 0x0001, 0x5fe: 0x0001, 0x5ff: 0x0001, + // Block 0x18, offset 0x600 + 0x600: 0x0001, 0x601: 0x0001, 0x602: 0x0001, 0x603: 0x0001, 0x604: 0x0001, 0x605: 0x0001, + 0x606: 0x0001, 0x607: 0x0001, 0x608: 0x0001, 0x609: 0x0001, 0x60a: 0x0001, 0x60b: 0x0001, + 0x60c: 0x0001, 0x60d: 0x0001, 0x60e: 0x0001, 0x60f: 0x0001, 0x610: 0x0001, 0x611: 0x0001, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x0001, 0x619: 0x0001, 0x61a: 0x0001, 0x61b: 0x0001, 0x61c: 0x0001, 0x61d: 0x0001, + 0x61e: 0x0001, 0x61f: 0x0001, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000d, 0x64b: 0x000d, + 0x64c: 0x000d, 0x64d: 0x000d, 0x64e: 0x000d, 0x64f: 0x000d, 0x650: 0x000d, 0x651: 0x000d, + 0x652: 0x000d, 0x653: 0x000d, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + 0x83a: 0x000c, 0x83b: 0x000c, + 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, + 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa00: 0x000c, 0xa01: 0x000c, + 0xa3b: 0x000c, + 0xa3c: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa8a: 0x000c, + 0xa92: 0x000c, 0xa93: 0x000c, 0xa94: 0x000c, 0xa96: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaf1: 0x000c, 0xaf4: 0x000c, 0xaf5: 0x000c, + 0xaf6: 0x000c, 0xaf7: 0x000c, 0xaf8: 0x000c, 0xaf9: 0x000c, 0xafa: 0x000c, + 0xaff: 0x0004, + // Block 0x2c, offset 0xb00 + 0xb07: 0x000c, 0xb08: 0x000c, 0xb09: 0x000c, 0xb0a: 0x000c, 0xb0b: 0x000c, + 0xb0c: 0x000c, 0xb0d: 0x000c, 0xb0e: 0x000c, + // Block 0x2d, offset 0xb40 + 0xb71: 0x000c, 0xb74: 0x000c, 0xb75: 0x000c, + 0xb76: 0x000c, 0xb77: 0x000c, 0xb78: 0x000c, 0xb79: 0x000c, 0xb7b: 0x000c, + 0xb7c: 0x000c, + // Block 0x2e, offset 0xb80 + 0xb88: 0x000c, 0xb89: 0x000c, 0xb8a: 0x000c, 0xb8b: 0x000c, + 0xb8c: 0x000c, 0xb8d: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbd8: 0x000c, 0xbd9: 0x000c, + 0xbf5: 0x000c, + 0xbf7: 0x000c, 0xbf9: 0x000c, 0xbfa: 0x003a, 0xbfb: 0x002a, + 0xbfc: 0x003a, 0xbfd: 0x002a, + // Block 0x30, offset 0xc00 + 0xc31: 0x000c, 0xc32: 0x000c, 0xc33: 0x000c, 0xc34: 0x000c, 0xc35: 0x000c, + 0xc36: 0x000c, 0xc37: 0x000c, 0xc38: 0x000c, 0xc39: 0x000c, 0xc3a: 0x000c, 0xc3b: 0x000c, + 0xc3c: 0x000c, 0xc3d: 0x000c, 0xc3e: 0x000c, + // Block 0x31, offset 0xc40 + 0xc40: 0x000c, 0xc41: 0x000c, 0xc42: 0x000c, 0xc43: 0x000c, 0xc44: 0x000c, + 0xc46: 0x000c, 0xc47: 0x000c, + 0xc4d: 0x000c, 0xc4e: 0x000c, 0xc4f: 0x000c, 0xc50: 0x000c, 0xc51: 0x000c, + 0xc52: 0x000c, 0xc53: 0x000c, 0xc54: 0x000c, 0xc55: 0x000c, 0xc56: 0x000c, 0xc57: 0x000c, + 0xc59: 0x000c, 0xc5a: 0x000c, 0xc5b: 0x000c, 0xc5c: 0x000c, 0xc5d: 0x000c, + 0xc5e: 0x000c, 0xc5f: 0x000c, 0xc60: 0x000c, 0xc61: 0x000c, 0xc62: 0x000c, 0xc63: 0x000c, + 0xc64: 0x000c, 0xc65: 0x000c, 0xc66: 0x000c, 0xc67: 0x000c, 0xc68: 0x000c, 0xc69: 0x000c, + 0xc6a: 0x000c, 0xc6b: 0x000c, 0xc6c: 0x000c, 0xc6d: 0x000c, 0xc6e: 0x000c, 0xc6f: 0x000c, + 0xc70: 0x000c, 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, + // Block 0x32, offset 0xc80 + 0xc86: 0x000c, + // Block 0x33, offset 0xcc0 + 0xced: 0x000c, 0xcee: 0x000c, 0xcef: 0x000c, + 0xcf0: 0x000c, 0xcf2: 0x000c, 0xcf3: 0x000c, 0xcf4: 0x000c, 0xcf5: 0x000c, + 0xcf6: 0x000c, 0xcf7: 0x000c, 0xcf9: 0x000c, 0xcfa: 0x000c, + 0xcfd: 0x000c, 0xcfe: 0x000c, + // Block 0x34, offset 0xd00 + 0xd18: 0x000c, 0xd19: 0x000c, + 0xd1e: 0x000c, 0xd1f: 0x000c, 0xd20: 0x000c, + 0xd31: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, + // Block 0x35, offset 0xd40 + 0xd42: 0x000c, 0xd45: 0x000c, + 0xd46: 0x000c, + 0xd4d: 0x000c, + 0xd5d: 0x000c, + // Block 0x36, offset 0xd80 + 0xd9d: 0x000c, + 0xd9e: 0x000c, 0xd9f: 0x000c, + // Block 0x37, offset 0xdc0 + 0xdd0: 0x000a, 0xdd1: 0x000a, + 0xdd2: 0x000a, 0xdd3: 0x000a, 0xdd4: 0x000a, 0xdd5: 0x000a, 0xdd6: 0x000a, 0xdd7: 0x000a, + 0xdd8: 0x000a, 0xdd9: 0x000a, + // Block 0x38, offset 0xe00 + 0xe00: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0009, + 0xe5b: 0x007a, 0xe5c: 0x006a, + // Block 0x3a, offset 0xe80 + 0xe92: 0x000c, 0xe93: 0x000c, 0xe94: 0x000c, + 0xeb2: 0x000c, 0xeb3: 0x000c, 0xeb4: 0x000c, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf34: 0x000c, 0xf35: 0x000c, + 0xf37: 0x000c, 0xf38: 0x000c, 0xf39: 0x000c, 0xf3a: 0x000c, 0xf3b: 0x000c, + 0xf3c: 0x000c, 0xf3d: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf46: 0x000c, 0xf49: 0x000c, 0xf4a: 0x000c, 0xf4b: 0x000c, + 0xf4c: 0x000c, 0xf4d: 0x000c, 0xf4e: 0x000c, 0xf4f: 0x000c, 0xf50: 0x000c, 0xf51: 0x000c, + 0xf52: 0x000c, 0xf53: 0x000c, + 0xf5b: 0x0004, 0xf5d: 0x000c, + 0xf70: 0x000a, 0xf71: 0x000a, 0xf72: 0x000a, 0xf73: 0x000a, 0xf74: 0x000a, 0xf75: 0x000a, + 0xf76: 0x000a, 0xf77: 0x000a, 0xf78: 0x000a, 0xf79: 0x000a, + // Block 0x3e, offset 0xf80 + 0xf80: 0x000a, 0xf81: 0x000a, 0xf82: 0x000a, 0xf83: 0x000a, 0xf84: 0x000a, 0xf85: 0x000a, + 0xf86: 0x000a, 0xf87: 0x000a, 0xf88: 0x000a, 0xf89: 0x000a, 0xf8a: 0x000a, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000b, + // Block 0x3f, offset 0xfc0 + 0xfc5: 0x000c, + 0xfc6: 0x000c, + 0xfe9: 0x000c, + // Block 0x40, offset 0x1000 + 0x1020: 0x000c, 0x1021: 0x000c, 0x1022: 0x000c, + 0x1027: 0x000c, 0x1028: 0x000c, + 0x1032: 0x000c, + 0x1039: 0x000c, 0x103a: 0x000c, 0x103b: 0x000c, + // Block 0x41, offset 0x1040 + 0x1040: 0x000a, 0x1044: 0x000a, 0x1045: 0x000a, + // Block 0x42, offset 0x1080 + 0x109e: 0x000a, 0x109f: 0x000a, 0x10a0: 0x000a, 0x10a1: 0x000a, 0x10a2: 0x000a, 0x10a3: 0x000a, + 0x10a4: 0x000a, 0x10a5: 0x000a, 0x10a6: 0x000a, 0x10a7: 0x000a, 0x10a8: 0x000a, 0x10a9: 0x000a, + 0x10aa: 0x000a, 0x10ab: 0x000a, 0x10ac: 0x000a, 0x10ad: 0x000a, 0x10ae: 0x000a, 0x10af: 0x000a, + 0x10b0: 0x000a, 0x10b1: 0x000a, 0x10b2: 0x000a, 0x10b3: 0x000a, 0x10b4: 0x000a, 0x10b5: 0x000a, + 0x10b6: 0x000a, 0x10b7: 0x000a, 0x10b8: 0x000a, 0x10b9: 0x000a, 0x10ba: 0x000a, 0x10bb: 0x000a, + 0x10bc: 0x000a, 0x10bd: 0x000a, 0x10be: 0x000a, 0x10bf: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10d7: 0x000c, + 0x10d8: 0x000c, 0x10db: 0x000c, + // Block 0x44, offset 0x1100 + 0x1116: 0x000c, + 0x1118: 0x000c, 0x1119: 0x000c, 0x111a: 0x000c, 0x111b: 0x000c, 0x111c: 0x000c, 0x111d: 0x000c, + 0x111e: 0x000c, 0x1120: 0x000c, 0x1122: 0x000c, + 0x1125: 0x000c, 0x1126: 0x000c, 0x1127: 0x000c, 0x1128: 0x000c, 0x1129: 0x000c, + 0x112a: 0x000c, 0x112b: 0x000c, 0x112c: 0x000c, + 0x1133: 0x000c, 0x1134: 0x000c, 0x1135: 0x000c, + 0x1136: 0x000c, 0x1137: 0x000c, 0x1138: 0x000c, 0x1139: 0x000c, 0x113a: 0x000c, 0x113b: 0x000c, + 0x113c: 0x000c, 0x113f: 0x000c, + // Block 0x45, offset 0x1140 + 0x1170: 0x000c, 0x1171: 0x000c, 0x1172: 0x000c, 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117d: 0x000c, 0x117e: 0x000c, + // Block 0x46, offset 0x1180 + 0x1180: 0x000c, 0x1181: 0x000c, 0x1182: 0x000c, 0x1183: 0x000c, + 0x11b4: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, + 0x11bc: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c2: 0x000c, + 0x11eb: 0x000c, 0x11ec: 0x000c, 0x11ed: 0x000c, 0x11ee: 0x000c, 0x11ef: 0x000c, + 0x11f0: 0x000c, 0x11f1: 0x000c, 0x11f2: 0x000c, 0x11f3: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, + 0x1222: 0x000c, 0x1223: 0x000c, + 0x1224: 0x000c, 0x1225: 0x000c, 0x1228: 0x000c, 0x1229: 0x000c, + 0x122b: 0x000c, 0x122c: 0x000c, 0x122d: 0x000c, + // Block 0x49, offset 0x1240 + 0x1266: 0x000c, 0x1268: 0x000c, 0x1269: 0x000c, + 0x126d: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, + // Block 0x4a, offset 0x1280 + 0x12ac: 0x000c, 0x12ad: 0x000c, 0x12ae: 0x000c, 0x12af: 0x000c, + 0x12b0: 0x000c, 0x12b1: 0x000c, 0x12b2: 0x000c, 0x12b3: 0x000c, + 0x12b6: 0x000c, 0x12b7: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12d0: 0x000c, 0x12d1: 0x000c, + 0x12d2: 0x000c, 0x12d4: 0x000c, 0x12d5: 0x000c, 0x12d6: 0x000c, 0x12d7: 0x000c, + 0x12d8: 0x000c, 0x12d9: 0x000c, 0x12da: 0x000c, 0x12db: 0x000c, 0x12dc: 0x000c, 0x12dd: 0x000c, + 0x12de: 0x000c, 0x12df: 0x000c, 0x12e0: 0x000c, 0x12e2: 0x000c, 0x12e3: 0x000c, + 0x12e4: 0x000c, 0x12e5: 0x000c, 0x12e6: 0x000c, 0x12e7: 0x000c, 0x12e8: 0x000c, + 0x12ed: 0x000c, + 0x12f4: 0x000c, + 0x12f8: 0x000c, 0x12f9: 0x000c, + // Block 0x4c, offset 0x1300 + 0x1300: 0x000c, 0x1301: 0x000c, 0x1302: 0x000c, 0x1303: 0x000c, 0x1304: 0x000c, 0x1305: 0x000c, + 0x1306: 0x000c, 0x1307: 0x000c, 0x1308: 0x000c, 0x1309: 0x000c, 0x130a: 0x000c, 0x130b: 0x000c, + 0x130c: 0x000c, 0x130d: 0x000c, 0x130e: 0x000c, 0x130f: 0x000c, 0x1310: 0x000c, 0x1311: 0x000c, + 0x1312: 0x000c, 0x1313: 0x000c, 0x1314: 0x000c, 0x1315: 0x000c, 0x1316: 0x000c, 0x1317: 0x000c, + 0x1318: 0x000c, 0x1319: 0x000c, 0x131a: 0x000c, 0x131b: 0x000c, 0x131c: 0x000c, 0x131d: 0x000c, + 0x131e: 0x000c, 0x131f: 0x000c, 0x1320: 0x000c, 0x1321: 0x000c, 0x1322: 0x000c, 0x1323: 0x000c, + 0x1324: 0x000c, 0x1325: 0x000c, 0x1326: 0x000c, 0x1327: 0x000c, 0x1328: 0x000c, 0x1329: 0x000c, + 0x132a: 0x000c, 0x132b: 0x000c, 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, 0x1334: 0x000c, 0x1335: 0x000c, + 0x1336: 0x000c, 0x1337: 0x000c, 0x1338: 0x000c, 0x1339: 0x000c, 0x133b: 0x000c, + 0x133c: 0x000c, 0x133d: 0x000c, 0x133e: 0x000c, 0x133f: 0x000c, + // Block 0x4d, offset 0x1340 + 0x137d: 0x000a, 0x137f: 0x000a, + // Block 0x4e, offset 0x1380 + 0x1380: 0x000a, 0x1381: 0x000a, + 0x138d: 0x000a, 0x138e: 0x000a, 0x138f: 0x000a, + 0x139d: 0x000a, + 0x139e: 0x000a, 0x139f: 0x000a, + 0x13ad: 0x000a, 0x13ae: 0x000a, 0x13af: 0x000a, + 0x13bd: 0x000a, 0x13be: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0009, 0x13c1: 0x0009, 0x13c2: 0x0009, 0x13c3: 0x0009, 0x13c4: 0x0009, 0x13c5: 0x0009, + 0x13c6: 0x0009, 0x13c7: 0x0009, 0x13c8: 0x0009, 0x13c9: 0x0009, 0x13ca: 0x0009, 0x13cb: 0x000b, + 0x13cc: 0x000b, 0x13cd: 0x000b, 0x13cf: 0x0001, 0x13d0: 0x000a, 0x13d1: 0x000a, + 0x13d2: 0x000a, 0x13d3: 0x000a, 0x13d4: 0x000a, 0x13d5: 0x000a, 0x13d6: 0x000a, 0x13d7: 0x000a, + 0x13d8: 0x000a, 0x13d9: 0x000a, 0x13da: 0x000a, 0x13db: 0x000a, 0x13dc: 0x000a, 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, 0x13e0: 0x000a, 0x13e1: 0x000a, 0x13e2: 0x000a, 0x13e3: 0x000a, + 0x13e4: 0x000a, 0x13e5: 0x000a, 0x13e6: 0x000a, 0x13e7: 0x000a, 0x13e8: 0x0009, 0x13e9: 0x0007, + 0x13ea: 0x000e, 0x13eb: 0x000e, 0x13ec: 0x000e, 0x13ed: 0x000e, 0x13ee: 0x000e, 0x13ef: 0x0006, + 0x13f0: 0x0004, 0x13f1: 0x0004, 0x13f2: 0x0004, 0x13f3: 0x0004, 0x13f4: 0x0004, 0x13f5: 0x000a, + 0x13f6: 0x000a, 0x13f7: 0x000a, 0x13f8: 0x000a, 0x13f9: 0x000a, 0x13fa: 0x000a, 0x13fb: 0x000a, + 0x13fc: 0x000a, 0x13fd: 0x000a, 0x13fe: 0x000a, 0x13ff: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x000a, 0x1401: 0x000a, 0x1402: 0x000a, 0x1403: 0x000a, 0x1404: 0x0006, 0x1405: 0x009a, + 0x1406: 0x008a, 0x1407: 0x000a, 0x1408: 0x000a, 0x1409: 0x000a, 0x140a: 0x000a, 0x140b: 0x000a, + 0x140c: 0x000a, 0x140d: 0x000a, 0x140e: 0x000a, 0x140f: 0x000a, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x0009, 0x1420: 0x000b, 0x1421: 0x000b, 0x1422: 0x000b, 0x1423: 0x000b, + 0x1424: 0x000b, 0x1425: 0x000b, 0x1426: 0x000e, 0x1427: 0x000e, 0x1428: 0x000e, 0x1429: 0x000e, + 0x142a: 0x000b, 0x142b: 0x000b, 0x142c: 0x000b, 0x142d: 0x000b, 0x142e: 0x000b, 0x142f: 0x000b, + 0x1430: 0x0002, 0x1434: 0x0002, 0x1435: 0x0002, + 0x1436: 0x0002, 0x1437: 0x0002, 0x1438: 0x0002, 0x1439: 0x0002, 0x143a: 0x0003, 0x143b: 0x0003, + 0x143c: 0x000a, 0x143d: 0x009a, 0x143e: 0x008a, + // Block 0x51, offset 0x1440 + 0x1440: 0x0002, 0x1441: 0x0002, 0x1442: 0x0002, 0x1443: 0x0002, 0x1444: 0x0002, 0x1445: 0x0002, + 0x1446: 0x0002, 0x1447: 0x0002, 0x1448: 0x0002, 0x1449: 0x0002, 0x144a: 0x0003, 0x144b: 0x0003, + 0x144c: 0x000a, 0x144d: 0x009a, 0x144e: 0x008a, + 0x1460: 0x0004, 0x1461: 0x0004, 0x1462: 0x0004, 0x1463: 0x0004, + 0x1464: 0x0004, 0x1465: 0x0004, 0x1466: 0x0004, 0x1467: 0x0004, 0x1468: 0x0004, 0x1469: 0x0004, + 0x146a: 0x0004, 0x146b: 0x0004, 0x146c: 0x0004, 0x146d: 0x0004, 0x146e: 0x0004, 0x146f: 0x0004, + 0x1470: 0x0004, 0x1471: 0x0004, 0x1472: 0x0004, 0x1473: 0x0004, 0x1474: 0x0004, 0x1475: 0x0004, + 0x1476: 0x0004, 0x1477: 0x0004, 0x1478: 0x0004, 0x1479: 0x0004, 0x147a: 0x0004, 0x147b: 0x0004, + 0x147c: 0x0004, 0x147d: 0x0004, 0x147e: 0x0004, 0x147f: 0x0004, + // Block 0x52, offset 0x1480 + 0x1480: 0x0004, 0x1481: 0x0004, 0x1482: 0x0004, 0x1483: 0x0004, 0x1484: 0x0004, 0x1485: 0x0004, + 0x1486: 0x0004, 0x1487: 0x0004, 0x1488: 0x0004, 0x1489: 0x0004, 0x148a: 0x0004, 0x148b: 0x0004, + 0x148c: 0x0004, 0x148d: 0x0004, 0x148e: 0x0004, 0x148f: 0x0004, 0x1490: 0x000c, 0x1491: 0x000c, + 0x1492: 0x000c, 0x1493: 0x000c, 0x1494: 0x000c, 0x1495: 0x000c, 0x1496: 0x000c, 0x1497: 0x000c, + 0x1498: 0x000c, 0x1499: 0x000c, 0x149a: 0x000c, 0x149b: 0x000c, 0x149c: 0x000c, 0x149d: 0x000c, + 0x149e: 0x000c, 0x149f: 0x000c, 0x14a0: 0x000c, 0x14a1: 0x000c, 0x14a2: 0x000c, 0x14a3: 0x000c, + 0x14a4: 0x000c, 0x14a5: 0x000c, 0x14a6: 0x000c, 0x14a7: 0x000c, 0x14a8: 0x000c, 0x14a9: 0x000c, + 0x14aa: 0x000c, 0x14ab: 0x000c, 0x14ac: 0x000c, 0x14ad: 0x000c, 0x14ae: 0x000c, 0x14af: 0x000c, + 0x14b0: 0x000c, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x000a, 0x14c1: 0x000a, 0x14c3: 0x000a, 0x14c4: 0x000a, 0x14c5: 0x000a, + 0x14c6: 0x000a, 0x14c8: 0x000a, 0x14c9: 0x000a, + 0x14d4: 0x000a, 0x14d6: 0x000a, 0x14d7: 0x000a, + 0x14d8: 0x000a, + 0x14de: 0x000a, 0x14df: 0x000a, 0x14e0: 0x000a, 0x14e1: 0x000a, 0x14e2: 0x000a, 0x14e3: 0x000a, + 0x14e5: 0x000a, 0x14e7: 0x000a, 0x14e9: 0x000a, + 0x14ee: 0x0004, + 0x14fa: 0x000a, 0x14fb: 0x000a, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1502: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, + 0x150a: 0x000a, 0x150b: 0x000a, + 0x150c: 0x000a, 0x150d: 0x000a, 0x1510: 0x000a, 0x1511: 0x000a, + 0x1512: 0x000a, 0x1513: 0x000a, 0x1514: 0x000a, 0x1515: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, 0x1519: 0x000a, 0x151a: 0x000a, 0x151b: 0x000a, 0x151c: 0x000a, 0x151d: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, + // Block 0x55, offset 0x1540 + 0x1549: 0x000a, 0x154a: 0x000a, 0x154b: 0x000a, + 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, 0x1560: 0x000a, 0x1561: 0x000a, 0x1562: 0x000a, 0x1563: 0x000a, + 0x1564: 0x000a, 0x1565: 0x000a, 0x1566: 0x000a, 0x1567: 0x000a, 0x1568: 0x000a, 0x1569: 0x000a, + 0x156a: 0x000a, 0x156b: 0x000a, 0x156c: 0x000a, 0x156d: 0x000a, 0x156e: 0x000a, 0x156f: 0x000a, + 0x1570: 0x000a, 0x1571: 0x000a, 0x1572: 0x000a, 0x1573: 0x000a, 0x1574: 0x000a, 0x1575: 0x000a, + 0x1576: 0x000a, 0x1577: 0x000a, 0x1578: 0x000a, 0x1579: 0x000a, 0x157a: 0x000a, 0x157b: 0x000a, + 0x157c: 0x000a, 0x157d: 0x000a, 0x157e: 0x000a, 0x157f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1580: 0x000a, 0x1581: 0x000a, 0x1582: 0x000a, 0x1583: 0x000a, 0x1584: 0x000a, 0x1585: 0x000a, + 0x1586: 0x000a, 0x1587: 0x000a, 0x1588: 0x000a, 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x158c: 0x000a, 0x158d: 0x000a, 0x158e: 0x000a, 0x158f: 0x000a, 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x0003, 0x15d3: 0x0004, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x003a, 0x1609: 0x002a, 0x160a: 0x003a, 0x160b: 0x002a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x000a, 0x1613: 0x000a, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x009a, + 0x162a: 0x008a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + // Block 0x59, offset 0x1640 + 0x167b: 0x000a, + 0x167c: 0x000a, 0x167d: 0x000a, 0x167e: 0x000a, 0x167f: 0x000a, + // Block 0x5a, offset 0x1680 + 0x1680: 0x000a, 0x1681: 0x000a, 0x1682: 0x000a, 0x1683: 0x000a, 0x1684: 0x000a, 0x1685: 0x000a, + 0x1686: 0x000a, 0x1687: 0x000a, 0x1688: 0x000a, 0x1689: 0x000a, 0x168a: 0x000a, 0x168b: 0x000a, + 0x168c: 0x000a, 0x168d: 0x000a, 0x168e: 0x000a, 0x168f: 0x000a, 0x1690: 0x000a, 0x1691: 0x000a, + 0x1692: 0x000a, 0x1693: 0x000a, 0x1694: 0x000a, 0x1696: 0x000a, 0x1697: 0x000a, + 0x1698: 0x000a, 0x1699: 0x000a, 0x169a: 0x000a, 0x169b: 0x000a, 0x169c: 0x000a, 0x169d: 0x000a, + 0x169e: 0x000a, 0x169f: 0x000a, 0x16a0: 0x000a, 0x16a1: 0x000a, 0x16a2: 0x000a, 0x16a3: 0x000a, + 0x16a4: 0x000a, 0x16a5: 0x000a, 0x16a6: 0x000a, 0x16a7: 0x000a, 0x16a8: 0x000a, 0x16a9: 0x000a, + 0x16aa: 0x000a, 0x16ab: 0x000a, 0x16ac: 0x000a, 0x16ad: 0x000a, 0x16ae: 0x000a, 0x16af: 0x000a, + 0x16b0: 0x000a, 0x16b1: 0x000a, 0x16b2: 0x000a, 0x16b3: 0x000a, 0x16b4: 0x000a, 0x16b5: 0x000a, + 0x16b6: 0x000a, 0x16b7: 0x000a, 0x16b8: 0x000a, 0x16b9: 0x000a, 0x16ba: 0x000a, 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d5: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, + 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, 0x1727: 0x000a, 0x1728: 0x000a, 0x1729: 0x000a, + 0x172a: 0x000a, 0x172b: 0x000a, 0x172c: 0x000a, 0x172d: 0x000a, 0x172e: 0x000a, 0x172f: 0x000a, + 0x1730: 0x000a, 0x1731: 0x000a, 0x1732: 0x000a, 0x1733: 0x000a, 0x1734: 0x000a, 0x1735: 0x000a, + 0x1736: 0x000a, 0x1737: 0x000a, 0x1738: 0x000a, 0x1739: 0x000a, 0x173a: 0x000a, 0x173b: 0x000a, + 0x173c: 0x000a, 0x173d: 0x000a, 0x173e: 0x000a, 0x173f: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x0002, 0x1749: 0x0002, 0x174a: 0x0002, 0x174b: 0x0002, + 0x174c: 0x0002, 0x174d: 0x0002, 0x174e: 0x0002, 0x174f: 0x0002, 0x1750: 0x0002, 0x1751: 0x0002, + 0x1752: 0x0002, 0x1753: 0x0002, 0x1754: 0x0002, 0x1755: 0x0002, 0x1756: 0x0002, 0x1757: 0x0002, + 0x1758: 0x0002, 0x1759: 0x0002, 0x175a: 0x0002, 0x175b: 0x0002, + // Block 0x5e, offset 0x1780 + 0x17aa: 0x000a, 0x17ab: 0x000a, 0x17ac: 0x000a, 0x17ad: 0x000a, 0x17ae: 0x000a, 0x17af: 0x000a, + 0x17b0: 0x000a, 0x17b1: 0x000a, 0x17b2: 0x000a, 0x17b3: 0x000a, 0x17b4: 0x000a, 0x17b5: 0x000a, + 0x17b6: 0x000a, 0x17b7: 0x000a, 0x17b8: 0x000a, 0x17b9: 0x000a, 0x17ba: 0x000a, 0x17bb: 0x000a, + 0x17bc: 0x000a, 0x17bd: 0x000a, 0x17be: 0x000a, 0x17bf: 0x000a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x000a, 0x17c1: 0x000a, 0x17c2: 0x000a, 0x17c3: 0x000a, 0x17c4: 0x000a, 0x17c5: 0x000a, + 0x17c6: 0x000a, 0x17c7: 0x000a, 0x17c8: 0x000a, 0x17c9: 0x000a, 0x17ca: 0x000a, 0x17cb: 0x000a, + 0x17cc: 0x000a, 0x17cd: 0x000a, 0x17ce: 0x000a, 0x17cf: 0x000a, 0x17d0: 0x000a, 0x17d1: 0x000a, + 0x17d2: 0x000a, 0x17d3: 0x000a, 0x17d4: 0x000a, 0x17d5: 0x000a, 0x17d6: 0x000a, 0x17d7: 0x000a, + 0x17d8: 0x000a, 0x17d9: 0x000a, 0x17da: 0x000a, 0x17db: 0x000a, 0x17dc: 0x000a, 0x17dd: 0x000a, + 0x17de: 0x000a, 0x17df: 0x000a, 0x17e0: 0x000a, 0x17e1: 0x000a, 0x17e2: 0x000a, 0x17e3: 0x000a, + 0x17e4: 0x000a, 0x17e5: 0x000a, 0x17e6: 0x000a, 0x17e7: 0x000a, 0x17e8: 0x000a, 0x17e9: 0x000a, + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x003a, 0x1829: 0x002a, + 0x182a: 0x003a, 0x182b: 0x002a, 0x182c: 0x003a, 0x182d: 0x002a, 0x182e: 0x003a, 0x182f: 0x002a, + 0x1830: 0x003a, 0x1831: 0x002a, 0x1832: 0x003a, 0x1833: 0x002a, 0x1834: 0x003a, 0x1835: 0x002a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x009a, + 0x1846: 0x008a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x003a, 0x1867: 0x002a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x000a, 0x1871: 0x000a, 0x1872: 0x000a, 0x1873: 0x000a, 0x1874: 0x000a, 0x1875: 0x000a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x007a, 0x1884: 0x006a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x00ba, 0x1888: 0x00aa, 0x1889: 0x009a, 0x188a: 0x008a, 0x188b: 0x007a, + 0x188c: 0x006a, 0x188d: 0x00da, 0x188e: 0x002a, 0x188f: 0x003a, 0x1890: 0x00ca, 0x1891: 0x009a, + 0x1892: 0x008a, 0x1893: 0x007a, 0x1894: 0x006a, 0x1895: 0x009a, 0x1896: 0x008a, 0x1897: 0x00ba, + 0x1898: 0x00aa, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x000a, 0x18a7: 0x000a, 0x18a8: 0x000a, 0x18a9: 0x000a, + 0x18aa: 0x000a, 0x18ab: 0x000a, 0x18ac: 0x000a, 0x18ad: 0x000a, 0x18ae: 0x000a, 0x18af: 0x000a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x000a, 0x18c4: 0x000a, 0x18c5: 0x000a, + 0x18c6: 0x000a, 0x18c7: 0x000a, 0x18c8: 0x000a, 0x18c9: 0x000a, 0x18ca: 0x000a, 0x18cb: 0x000a, + 0x18cc: 0x000a, 0x18cd: 0x000a, 0x18ce: 0x000a, 0x18cf: 0x000a, 0x18d0: 0x000a, 0x18d1: 0x000a, + 0x18d2: 0x000a, 0x18d3: 0x000a, 0x18d4: 0x000a, 0x18d5: 0x000a, 0x18d6: 0x000a, 0x18d7: 0x000a, + 0x18d8: 0x003a, 0x18d9: 0x002a, 0x18da: 0x003a, 0x18db: 0x002a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x003a, 0x18fd: 0x002a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x000a, 0x1919: 0x000a, 0x191a: 0x000a, 0x191b: 0x000a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x000a, 0x193d: 0x000a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, 0x1974: 0x000a, 0x1975: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, + 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, + 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a, + 0x19ea: 0x000a, 0x19ef: 0x000c, + 0x19f0: 0x000c, 0x19f1: 0x000c, + 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a, + 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a3f: 0x000c, + // Block 0x69, offset 0x1a40 + 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c, + 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c, + 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c, + 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c, + 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c, + 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a, + 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a, + 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a, + 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a, + 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a, + 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a, + 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a, + 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a, + 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a, + 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a, + 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a, + 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a, + 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a, + 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a, + 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a, + 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a, + 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a, + 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a, + 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a, + 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a, + 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a, + 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, + 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a, + 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a, + 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a, + 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a, + 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c, + 0x1bf0: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, + 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a, + 0x1c20: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c7b: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a, + 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a, + 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a, + 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a, + 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a, + 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cdd: 0x000a, + 0x1cde: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d10: 0x000a, 0x1d11: 0x000a, + 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a, + 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a, + 0x1d1e: 0x000a, 0x1d1f: 0x000a, + 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a, + 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e1e: 0x000a, 0x1e1f: 0x000a, + 0x1e3f: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e50: 0x000a, 0x1e51: 0x000a, + 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a, + 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a, + 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a, + 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a, + 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a, + 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a, + 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a, + 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a, + 0x1e86: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f2f: 0x000c, + 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c, + 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c, + 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f5e: 0x000c, 0x1f5f: 0x000c, + // Block 0x7e, offset 0x1f80 + 0x1fb0: 0x000c, 0x1fb1: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a, + 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a, + 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a, + 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a, + 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a, + 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a, + // Block 0x80, offset 0x2000 + 0x2008: 0x000a, + // Block 0x81, offset 0x2040 + 0x2042: 0x000c, + 0x2046: 0x000c, 0x204b: 0x000c, + 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a, + 0x206a: 0x000a, 0x206b: 0x000a, + 0x2078: 0x0004, 0x2079: 0x0004, + // Block 0x82, offset 0x2080 + 0x20b4: 0x000a, 0x20b5: 0x000a, + 0x20b6: 0x000a, 0x20b7: 0x000a, + // Block 0x83, offset 0x20c0 + 0x20c4: 0x000c, 0x20c5: 0x000c, + 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c, + 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c, + 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c, + 0x20f0: 0x000c, 0x20f1: 0x000c, + // Block 0x84, offset 0x2100 + 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, + // Block 0x85, offset 0x2140 + 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c, + 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c, + // Block 0x86, offset 0x2180 + 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c, + 0x21b3: 0x000c, + 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c, + 0x21bc: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21e5: 0x000c, + // Block 0x88, offset 0x2200 + 0x2229: 0x000c, + 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c, + 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c, + 0x2236: 0x000c, + // Block 0x89, offset 0x2240 + 0x2243: 0x000c, + 0x224c: 0x000c, + 0x227c: 0x000c, + // Block 0x8a, offset 0x2280 + 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c, + 0x22b7: 0x000c, 0x22b8: 0x000c, + 0x22be: 0x000c, 0x22bf: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22c1: 0x000c, + 0x22ec: 0x000c, 0x22ed: 0x000c, + 0x22f6: 0x000c, + // Block 0x8c, offset 0x2300 + 0x2325: 0x000c, 0x2328: 0x000c, + 0x232d: 0x000c, + // Block 0x8d, offset 0x2340 + 0x235d: 0x0001, + 0x235e: 0x000c, 0x235f: 0x0001, 0x2360: 0x0001, 0x2361: 0x0001, 0x2362: 0x0001, 0x2363: 0x0001, + 0x2364: 0x0001, 0x2365: 0x0001, 0x2366: 0x0001, 0x2367: 0x0001, 0x2368: 0x0001, 0x2369: 0x0003, + 0x236a: 0x0001, 0x236b: 0x0001, 0x236c: 0x0001, 0x236d: 0x0001, 0x236e: 0x0001, 0x236f: 0x0001, + 0x2370: 0x0001, 0x2371: 0x0001, 0x2372: 0x0001, 0x2373: 0x0001, 0x2374: 0x0001, 0x2375: 0x0001, + 0x2376: 0x0001, 0x2377: 0x0001, 0x2378: 0x0001, 0x2379: 0x0001, 0x237a: 0x0001, 0x237b: 0x0001, + 0x237c: 0x0001, 0x237d: 0x0001, 0x237e: 0x0001, 0x237f: 0x0001, + // Block 0x8e, offset 0x2380 + 0x2380: 0x0001, 0x2381: 0x0001, 0x2382: 0x0001, 0x2383: 0x0001, 0x2384: 0x0001, 0x2385: 0x0001, + 0x2386: 0x0001, 0x2387: 0x0001, 0x2388: 0x0001, 0x2389: 0x0001, 0x238a: 0x0001, 0x238b: 0x0001, + 0x238c: 0x0001, 0x238d: 0x0001, 0x238e: 0x0001, 0x238f: 0x0001, 0x2390: 0x000d, 0x2391: 0x000d, + 0x2392: 0x000d, 0x2393: 0x000d, 0x2394: 0x000d, 0x2395: 0x000d, 0x2396: 0x000d, 0x2397: 0x000d, + 0x2398: 0x000d, 0x2399: 0x000d, 0x239a: 0x000d, 0x239b: 0x000d, 0x239c: 0x000d, 0x239d: 0x000d, + 0x239e: 0x000d, 0x239f: 0x000d, 0x23a0: 0x000d, 0x23a1: 0x000d, 0x23a2: 0x000d, 0x23a3: 0x000d, + 0x23a4: 0x000d, 0x23a5: 0x000d, 0x23a6: 0x000d, 0x23a7: 0x000d, 0x23a8: 0x000d, 0x23a9: 0x000d, + 0x23aa: 0x000d, 0x23ab: 0x000d, 0x23ac: 0x000d, 0x23ad: 0x000d, 0x23ae: 0x000d, 0x23af: 0x000d, + 0x23b0: 0x000d, 0x23b1: 0x000d, 0x23b2: 0x000d, 0x23b3: 0x000d, 0x23b4: 0x000d, 0x23b5: 0x000d, + 0x23b6: 0x000d, 0x23b7: 0x000d, 0x23b8: 0x000d, 0x23b9: 0x000d, 0x23ba: 0x000d, 0x23bb: 0x000d, + 0x23bc: 0x000d, 0x23bd: 0x000d, 0x23be: 0x000d, 0x23bf: 0x000d, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x000d, 0x23c1: 0x000d, 0x23c2: 0x000d, 0x23c3: 0x000d, 0x23c4: 0x000d, 0x23c5: 0x000d, + 0x23c6: 0x000d, 0x23c7: 0x000d, 0x23c8: 0x000d, 0x23c9: 0x000d, 0x23ca: 0x000d, 0x23cb: 0x000d, + 0x23cc: 0x000d, 0x23cd: 0x000d, 0x23ce: 0x000d, 0x23cf: 0x000d, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000a, 0x23ff: 0x000a, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000b, 0x2411: 0x000b, + 0x2412: 0x000b, 0x2413: 0x000b, 0x2414: 0x000b, 0x2415: 0x000b, 0x2416: 0x000b, 0x2417: 0x000b, + 0x2418: 0x000b, 0x2419: 0x000b, 0x241a: 0x000b, 0x241b: 0x000b, 0x241c: 0x000b, 0x241d: 0x000b, + 0x241e: 0x000b, 0x241f: 0x000b, 0x2420: 0x000b, 0x2421: 0x000b, 0x2422: 0x000b, 0x2423: 0x000b, + 0x2424: 0x000b, 0x2425: 0x000b, 0x2426: 0x000b, 0x2427: 0x000b, 0x2428: 0x000b, 0x2429: 0x000b, + 0x242a: 0x000b, 0x242b: 0x000b, 0x242c: 0x000b, 0x242d: 0x000b, 0x242e: 0x000b, 0x242f: 0x000b, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000a, 0x243e: 0x000d, 0x243f: 0x000d, + // Block 0x91, offset 0x2440 + 0x2440: 0x000c, 0x2441: 0x000c, 0x2442: 0x000c, 0x2443: 0x000c, 0x2444: 0x000c, 0x2445: 0x000c, + 0x2446: 0x000c, 0x2447: 0x000c, 0x2448: 0x000c, 0x2449: 0x000c, 0x244a: 0x000c, 0x244b: 0x000c, + 0x244c: 0x000c, 0x244d: 0x000c, 0x244e: 0x000c, 0x244f: 0x000c, 0x2450: 0x000a, 0x2451: 0x000a, + 0x2452: 0x000a, 0x2453: 0x000a, 0x2454: 0x000a, 0x2455: 0x000a, 0x2456: 0x000a, 0x2457: 0x000a, + 0x2458: 0x000a, 0x2459: 0x000a, + 0x2460: 0x000c, 0x2461: 0x000c, 0x2462: 0x000c, 0x2463: 0x000c, + 0x2464: 0x000c, 0x2465: 0x000c, 0x2466: 0x000c, 0x2467: 0x000c, 0x2468: 0x000c, 0x2469: 0x000c, + 0x246a: 0x000c, 0x246b: 0x000c, 0x246c: 0x000c, 0x246d: 0x000c, 0x246e: 0x000c, 0x246f: 0x000c, + 0x2470: 0x000a, 0x2471: 0x000a, 0x2472: 0x000a, 0x2473: 0x000a, 0x2474: 0x000a, 0x2475: 0x000a, + 0x2476: 0x000a, 0x2477: 0x000a, 0x2478: 0x000a, 0x2479: 0x000a, 0x247a: 0x000a, 0x247b: 0x000a, + 0x247c: 0x000a, 0x247d: 0x000a, 0x247e: 0x000a, 0x247f: 0x000a, + // Block 0x92, offset 0x2480 + 0x2480: 0x000a, 0x2481: 0x000a, 0x2482: 0x000a, 0x2483: 0x000a, 0x2484: 0x000a, 0x2485: 0x000a, + 0x2486: 0x000a, 0x2487: 0x000a, 0x2488: 0x000a, 0x2489: 0x000a, 0x248a: 0x000a, 0x248b: 0x000a, + 0x248c: 0x000a, 0x248d: 0x000a, 0x248e: 0x000a, 0x248f: 0x000a, 0x2490: 0x0006, 0x2491: 0x000a, + 0x2492: 0x0006, 0x2494: 0x000a, 0x2495: 0x0006, 0x2496: 0x000a, 0x2497: 0x000a, + 0x2498: 0x000a, 0x2499: 0x009a, 0x249a: 0x008a, 0x249b: 0x007a, 0x249c: 0x006a, 0x249d: 0x009a, + 0x249e: 0x008a, 0x249f: 0x0004, 0x24a0: 0x000a, 0x24a1: 0x000a, 0x24a2: 0x0003, 0x24a3: 0x0003, + 0x24a4: 0x000a, 0x24a5: 0x000a, 0x24a6: 0x000a, 0x24a8: 0x000a, 0x24a9: 0x0004, + 0x24aa: 0x0004, 0x24ab: 0x000a, + 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d, + 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d, + 0x24bc: 0x000d, 0x24bd: 0x000d, 0x24be: 0x000d, 0x24bf: 0x000d, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000d, 0x24c1: 0x000d, 0x24c2: 0x000d, 0x24c3: 0x000d, 0x24c4: 0x000d, 0x24c5: 0x000d, + 0x24c6: 0x000d, 0x24c7: 0x000d, 0x24c8: 0x000d, 0x24c9: 0x000d, 0x24ca: 0x000d, 0x24cb: 0x000d, + 0x24cc: 0x000d, 0x24cd: 0x000d, 0x24ce: 0x000d, 0x24cf: 0x000d, 0x24d0: 0x000d, 0x24d1: 0x000d, + 0x24d2: 0x000d, 0x24d3: 0x000d, 0x24d4: 0x000d, 0x24d5: 0x000d, 0x24d6: 0x000d, 0x24d7: 0x000d, + 0x24d8: 0x000d, 0x24d9: 0x000d, 0x24da: 0x000d, 0x24db: 0x000d, 0x24dc: 0x000d, 0x24dd: 0x000d, + 0x24de: 0x000d, 0x24df: 0x000d, 0x24e0: 0x000d, 0x24e1: 0x000d, 0x24e2: 0x000d, 0x24e3: 0x000d, + 0x24e4: 0x000d, 0x24e5: 0x000d, 0x24e6: 0x000d, 0x24e7: 0x000d, 0x24e8: 0x000d, 0x24e9: 0x000d, + 0x24ea: 0x000d, 0x24eb: 0x000d, 0x24ec: 0x000d, 0x24ed: 0x000d, 0x24ee: 0x000d, 0x24ef: 0x000d, + 0x24f0: 0x000d, 0x24f1: 0x000d, 0x24f2: 0x000d, 0x24f3: 0x000d, 0x24f4: 0x000d, 0x24f5: 0x000d, + 0x24f6: 0x000d, 0x24f7: 0x000d, 0x24f8: 0x000d, 0x24f9: 0x000d, 0x24fa: 0x000d, 0x24fb: 0x000d, + 0x24fc: 0x000d, 0x24fd: 0x000d, 0x24fe: 0x000d, 0x24ff: 0x000b, + // Block 0x94, offset 0x2500 + 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x0004, 0x2504: 0x0004, 0x2505: 0x0004, + 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x003a, 0x2509: 0x002a, 0x250a: 0x000a, 0x250b: 0x0003, + 0x250c: 0x0006, 0x250d: 0x0003, 0x250e: 0x0006, 0x250f: 0x0006, 0x2510: 0x0002, 0x2511: 0x0002, + 0x2512: 0x0002, 0x2513: 0x0002, 0x2514: 0x0002, 0x2515: 0x0002, 0x2516: 0x0002, 0x2517: 0x0002, + 0x2518: 0x0002, 0x2519: 0x0002, 0x251a: 0x0006, 0x251b: 0x000a, 0x251c: 0x000a, 0x251d: 0x000a, + 0x251e: 0x000a, 0x251f: 0x000a, 0x2520: 0x000a, + 0x253b: 0x005a, + 0x253c: 0x000a, 0x253d: 0x004a, 0x253e: 0x000a, 0x253f: 0x000a, + // Block 0x95, offset 0x2540 + 0x2540: 0x000a, + 0x255b: 0x005a, 0x255c: 0x000a, 0x255d: 0x004a, + 0x255e: 0x000a, 0x255f: 0x00fa, 0x2560: 0x00ea, 0x2561: 0x000a, 0x2562: 0x003a, 0x2563: 0x002a, + 0x2564: 0x000a, 0x2565: 0x000a, + // Block 0x96, offset 0x2580 + 0x25a0: 0x0004, 0x25a1: 0x0004, 0x25a2: 0x000a, 0x25a3: 0x000a, + 0x25a4: 0x000a, 0x25a5: 0x0004, 0x25a6: 0x0004, 0x25a8: 0x000a, 0x25a9: 0x000a, + 0x25aa: 0x000a, 0x25ab: 0x000a, 0x25ac: 0x000a, 0x25ad: 0x000a, 0x25ae: 0x000a, + 0x25b0: 0x000b, 0x25b1: 0x000b, 0x25b2: 0x000b, 0x25b3: 0x000b, 0x25b4: 0x000b, 0x25b5: 0x000b, + 0x25b6: 0x000b, 0x25b7: 0x000b, 0x25b8: 0x000b, 0x25b9: 0x000a, 0x25ba: 0x000a, 0x25bb: 0x000a, + 0x25bc: 0x000a, 0x25bd: 0x000a, 0x25be: 0x000b, 0x25bf: 0x000b, + // Block 0x97, offset 0x25c0 + 0x25c1: 0x000a, + // Block 0x98, offset 0x2600 + 0x2600: 0x000a, 0x2601: 0x000a, 0x2602: 0x000a, 0x2603: 0x000a, 0x2604: 0x000a, 0x2605: 0x000a, + 0x2606: 0x000a, 0x2607: 0x000a, 0x2608: 0x000a, 0x2609: 0x000a, 0x260a: 0x000a, 0x260b: 0x000a, + 0x260c: 0x000a, 0x2610: 0x000a, 0x2611: 0x000a, + 0x2612: 0x000a, 0x2613: 0x000a, 0x2614: 0x000a, 0x2615: 0x000a, 0x2616: 0x000a, 0x2617: 0x000a, + 0x2618: 0x000a, 0x2619: 0x000a, 0x261a: 0x000a, 0x261b: 0x000a, + 0x2620: 0x000a, + // Block 0x99, offset 0x2640 + 0x267d: 0x000c, + // Block 0x9a, offset 0x2680 + 0x26a0: 0x000c, 0x26a1: 0x0002, 0x26a2: 0x0002, 0x26a3: 0x0002, + 0x26a4: 0x0002, 0x26a5: 0x0002, 0x26a6: 0x0002, 0x26a7: 0x0002, 0x26a8: 0x0002, 0x26a9: 0x0002, + 0x26aa: 0x0002, 0x26ab: 0x0002, 0x26ac: 0x0002, 0x26ad: 0x0002, 0x26ae: 0x0002, 0x26af: 0x0002, + 0x26b0: 0x0002, 0x26b1: 0x0002, 0x26b2: 0x0002, 0x26b3: 0x0002, 0x26b4: 0x0002, 0x26b5: 0x0002, + 0x26b6: 0x0002, 0x26b7: 0x0002, 0x26b8: 0x0002, 0x26b9: 0x0002, 0x26ba: 0x0002, 0x26bb: 0x0002, + // Block 0x9b, offset 0x26c0 + 0x26f6: 0x000c, 0x26f7: 0x000c, 0x26f8: 0x000c, 0x26f9: 0x000c, 0x26fa: 0x000c, + // Block 0x9c, offset 0x2700 + 0x2700: 0x0001, 0x2701: 0x0001, 0x2702: 0x0001, 0x2703: 0x0001, 0x2704: 0x0001, 0x2705: 0x0001, + 0x2706: 0x0001, 0x2707: 0x0001, 0x2708: 0x0001, 0x2709: 0x0001, 0x270a: 0x0001, 0x270b: 0x0001, + 0x270c: 0x0001, 0x270d: 0x0001, 0x270e: 0x0001, 0x270f: 0x0001, 0x2710: 0x0001, 0x2711: 0x0001, + 0x2712: 0x0001, 0x2713: 0x0001, 0x2714: 0x0001, 0x2715: 0x0001, 0x2716: 0x0001, 0x2717: 0x0001, + 0x2718: 0x0001, 0x2719: 0x0001, 0x271a: 0x0001, 0x271b: 0x0001, 0x271c: 0x0001, 0x271d: 0x0001, + 0x271e: 0x0001, 0x271f: 0x0001, 0x2720: 0x0001, 0x2721: 0x0001, 0x2722: 0x0001, 0x2723: 0x0001, + 0x2724: 0x0001, 0x2725: 0x0001, 0x2726: 0x0001, 0x2727: 0x0001, 0x2728: 0x0001, 0x2729: 0x0001, + 0x272a: 0x0001, 0x272b: 0x0001, 0x272c: 0x0001, 0x272d: 0x0001, 0x272e: 0x0001, 0x272f: 0x0001, + 0x2730: 0x0001, 0x2731: 0x0001, 0x2732: 0x0001, 0x2733: 0x0001, 0x2734: 0x0001, 0x2735: 0x0001, + 0x2736: 0x0001, 0x2737: 0x0001, 0x2738: 0x0001, 0x2739: 0x0001, 0x273a: 0x0001, 0x273b: 0x0001, + 0x273c: 0x0001, 0x273d: 0x0001, 0x273e: 0x0001, 0x273f: 0x0001, + // Block 0x9d, offset 0x2740 + 0x2740: 0x0001, 0x2741: 0x0001, 0x2742: 0x0001, 0x2743: 0x0001, 0x2744: 0x0001, 0x2745: 0x0001, + 0x2746: 0x0001, 0x2747: 0x0001, 0x2748: 0x0001, 0x2749: 0x0001, 0x274a: 0x0001, 0x274b: 0x0001, + 0x274c: 0x0001, 0x274d: 0x0001, 0x274e: 0x0001, 0x274f: 0x0001, 0x2750: 0x0001, 0x2751: 0x0001, + 0x2752: 0x0001, 0x2753: 0x0001, 0x2754: 0x0001, 0x2755: 0x0001, 0x2756: 0x0001, 0x2757: 0x0001, + 0x2758: 0x0001, 0x2759: 0x0001, 0x275a: 0x0001, 0x275b: 0x0001, 0x275c: 0x0001, 0x275d: 0x0001, + 0x275e: 0x0001, 0x275f: 0x000a, 0x2760: 0x0001, 0x2761: 0x0001, 0x2762: 0x0001, 0x2763: 0x0001, + 0x2764: 0x0001, 0x2765: 0x0001, 0x2766: 0x0001, 0x2767: 0x0001, 0x2768: 0x0001, 0x2769: 0x0001, + 0x276a: 0x0001, 0x276b: 0x0001, 0x276c: 0x0001, 0x276d: 0x0001, 0x276e: 0x0001, 0x276f: 0x0001, + 0x2770: 0x0001, 0x2771: 0x0001, 0x2772: 0x0001, 0x2773: 0x0001, 0x2774: 0x0001, 0x2775: 0x0001, + 0x2776: 0x0001, 0x2777: 0x0001, 0x2778: 0x0001, 0x2779: 0x0001, 0x277a: 0x0001, 0x277b: 0x0001, + 0x277c: 0x0001, 0x277d: 0x0001, 0x277e: 0x0001, 0x277f: 0x0001, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x000c, 0x2782: 0x000c, 0x2783: 0x000c, 0x2784: 0x0001, 0x2785: 0x000c, + 0x2786: 0x000c, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x000c, 0x278d: 0x000c, 0x278e: 0x000c, 0x278f: 0x000c, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x000c, 0x27b9: 0x000c, 0x27ba: 0x000c, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x000c, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001, + 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x0001, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x000c, 0x27e6: 0x000c, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x0001, 0x2802: 0x0001, 0x2803: 0x0001, 0x2804: 0x0001, 0x2805: 0x0001, + 0x2806: 0x0001, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x0001, 0x280d: 0x0001, 0x280e: 0x0001, 0x280f: 0x0001, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x0001, 0x2839: 0x000a, 0x283a: 0x000a, 0x283b: 0x000a, + 0x283c: 0x000a, 0x283d: 0x000a, 0x283e: 0x000a, 0x283f: 0x000a, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0005, 0x2861: 0x0005, 0x2862: 0x0005, 0x2863: 0x0005, + 0x2864: 0x0005, 0x2865: 0x0005, 0x2866: 0x0005, 0x2867: 0x0005, 0x2868: 0x0005, 0x2869: 0x0005, + 0x286a: 0x0005, 0x286b: 0x0005, 0x286c: 0x0005, 0x286d: 0x0005, 0x286e: 0x0005, 0x286f: 0x0005, + 0x2870: 0x0005, 0x2871: 0x0005, 0x2872: 0x0005, 0x2873: 0x0005, 0x2874: 0x0005, 0x2875: 0x0005, + 0x2876: 0x0005, 0x2877: 0x0005, 0x2878: 0x0005, 0x2879: 0x0005, 0x287a: 0x0005, 0x287b: 0x0005, + 0x287c: 0x0005, 0x287d: 0x0005, 0x287e: 0x0005, 0x287f: 0x0001, + // Block 0xa2, offset 0x2880 + 0x2881: 0x000c, + 0x28b8: 0x000c, 0x28b9: 0x000c, 0x28ba: 0x000c, 0x28bb: 0x000c, + 0x28bc: 0x000c, 0x28bd: 0x000c, 0x28be: 0x000c, 0x28bf: 0x000c, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x000c, 0x28c1: 0x000c, 0x28c2: 0x000c, 0x28c3: 0x000c, 0x28c4: 0x000c, 0x28c5: 0x000c, + 0x28c6: 0x000c, + 0x28d2: 0x000a, 0x28d3: 0x000a, 0x28d4: 0x000a, 0x28d5: 0x000a, 0x28d6: 0x000a, 0x28d7: 0x000a, + 0x28d8: 0x000a, 0x28d9: 0x000a, 0x28da: 0x000a, 0x28db: 0x000a, 0x28dc: 0x000a, 0x28dd: 0x000a, + 0x28de: 0x000a, 0x28df: 0x000a, 0x28e0: 0x000a, 0x28e1: 0x000a, 0x28e2: 0x000a, 0x28e3: 0x000a, + 0x28e4: 0x000a, 0x28e5: 0x000a, + 0x28ff: 0x000c, + // Block 0xa4, offset 0x2900 + 0x2900: 0x000c, 0x2901: 0x000c, + 0x2933: 0x000c, 0x2934: 0x000c, 0x2935: 0x000c, + 0x2936: 0x000c, 0x2939: 0x000c, 0x293a: 0x000c, + // Block 0xa5, offset 0x2940 + 0x2940: 0x000c, 0x2941: 0x000c, 0x2942: 0x000c, + 0x2967: 0x000c, 0x2968: 0x000c, 0x2969: 0x000c, + 0x296a: 0x000c, 0x296b: 0x000c, 0x296d: 0x000c, 0x296e: 0x000c, 0x296f: 0x000c, + 0x2970: 0x000c, 0x2971: 0x000c, 0x2972: 0x000c, 0x2973: 0x000c, 0x2974: 0x000c, + // Block 0xa6, offset 0x2980 + 0x29b3: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x000c, 0x29c1: 0x000c, + 0x29f6: 0x000c, 0x29f7: 0x000c, 0x29f8: 0x000c, 0x29f9: 0x000c, 0x29fa: 0x000c, 0x29fb: 0x000c, + 0x29fc: 0x000c, 0x29fd: 0x000c, 0x29fe: 0x000c, + // Block 0xa8, offset 0x2a00 + 0x2a0a: 0x000c, 0x2a0b: 0x000c, + 0x2a0c: 0x000c, + // Block 0xa9, offset 0x2a40 + 0x2a6f: 0x000c, + 0x2a70: 0x000c, 0x2a71: 0x000c, 0x2a74: 0x000c, + 0x2a76: 0x000c, 0x2a77: 0x000c, + 0x2a7e: 0x000c, + // Block 0xaa, offset 0x2a80 + 0x2a9f: 0x000c, 0x2aa3: 0x000c, + 0x2aa4: 0x000c, 0x2aa5: 0x000c, 0x2aa6: 0x000c, 0x2aa7: 0x000c, 0x2aa8: 0x000c, 0x2aa9: 0x000c, + 0x2aaa: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2ac0: 0x000c, 0x2ac1: 0x000c, + 0x2afc: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, + 0x2b26: 0x000c, 0x2b27: 0x000c, 0x2b28: 0x000c, 0x2b29: 0x000c, + 0x2b2a: 0x000c, 0x2b2b: 0x000c, 0x2b2c: 0x000c, + 0x2b30: 0x000c, 0x2b31: 0x000c, 0x2b32: 0x000c, 0x2b33: 0x000c, 0x2b34: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b78: 0x000c, 0x2b79: 0x000c, 0x2b7a: 0x000c, 0x2b7b: 0x000c, + 0x2b7c: 0x000c, 0x2b7d: 0x000c, 0x2b7e: 0x000c, 0x2b7f: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2b82: 0x000c, 0x2b83: 0x000c, 0x2b84: 0x000c, + 0x2b86: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bf3: 0x000c, 0x2bf4: 0x000c, 0x2bf5: 0x000c, + 0x2bf6: 0x000c, 0x2bf7: 0x000c, 0x2bf8: 0x000c, 0x2bfa: 0x000c, + 0x2bff: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c00: 0x000c, 0x2c02: 0x000c, 0x2c03: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c72: 0x000c, 0x2c73: 0x000c, 0x2c74: 0x000c, 0x2c75: 0x000c, + 0x2c7c: 0x000c, 0x2c7d: 0x000c, 0x2c7f: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2c80: 0x000c, + 0x2c9c: 0x000c, 0x2c9d: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cf3: 0x000c, 0x2cf4: 0x000c, 0x2cf5: 0x000c, + 0x2cf6: 0x000c, 0x2cf7: 0x000c, 0x2cf8: 0x000c, 0x2cf9: 0x000c, 0x2cfa: 0x000c, + 0x2cfd: 0x000c, 0x2cff: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d00: 0x000c, + 0x2d20: 0x000a, 0x2d21: 0x000a, 0x2d22: 0x000a, 0x2d23: 0x000a, + 0x2d24: 0x000a, 0x2d25: 0x000a, 0x2d26: 0x000a, 0x2d27: 0x000a, 0x2d28: 0x000a, 0x2d29: 0x000a, + 0x2d2a: 0x000a, 0x2d2b: 0x000a, 0x2d2c: 0x000a, + // Block 0xb5, offset 0x2d40 + 0x2d6b: 0x000c, 0x2d6d: 0x000c, + 0x2d70: 0x000c, 0x2d71: 0x000c, 0x2d72: 0x000c, 0x2d73: 0x000c, 0x2d74: 0x000c, 0x2d75: 0x000c, + 0x2d77: 0x000c, + // Block 0xb6, offset 0x2d80 + 0x2d9d: 0x000c, + 0x2d9e: 0x000c, 0x2d9f: 0x000c, 0x2da2: 0x000c, 0x2da3: 0x000c, + 0x2da4: 0x000c, 0x2da5: 0x000c, 0x2da7: 0x000c, 0x2da8: 0x000c, 0x2da9: 0x000c, + 0x2daa: 0x000c, 0x2dab: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2dc1: 0x000c, 0x2dc2: 0x000c, 0x2dc3: 0x000c, 0x2dc4: 0x000c, 0x2dc5: 0x000c, + 0x2dc6: 0x000c, 0x2dc9: 0x000c, 0x2dca: 0x000c, + 0x2df3: 0x000c, 0x2df4: 0x000c, 0x2df5: 0x000c, + 0x2df6: 0x000c, 0x2df7: 0x000c, 0x2df8: 0x000c, 0x2dfb: 0x000c, + 0x2dfc: 0x000c, 0x2dfd: 0x000c, 0x2dfe: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e07: 0x000c, + 0x2e11: 0x000c, + 0x2e12: 0x000c, 0x2e13: 0x000c, 0x2e14: 0x000c, 0x2e15: 0x000c, 0x2e16: 0x000c, + 0x2e19: 0x000c, 0x2e1a: 0x000c, 0x2e1b: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e4a: 0x000c, 0x2e4b: 0x000c, + 0x2e4c: 0x000c, 0x2e4d: 0x000c, 0x2e4e: 0x000c, 0x2e4f: 0x000c, 0x2e50: 0x000c, 0x2e51: 0x000c, + 0x2e52: 0x000c, 0x2e53: 0x000c, 0x2e54: 0x000c, 0x2e55: 0x000c, 0x2e56: 0x000c, + 0x2e58: 0x000c, 0x2e59: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb0: 0x000c, 0x2eb1: 0x000c, 0x2eb2: 0x000c, 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c, + 0x2eb6: 0x000c, 0x2eb8: 0x000c, 0x2eb9: 0x000c, 0x2eba: 0x000c, 0x2ebb: 0x000c, + 0x2ebc: 0x000c, 0x2ebd: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ed2: 0x000c, 0x2ed3: 0x000c, 0x2ed4: 0x000c, 0x2ed5: 0x000c, 0x2ed6: 0x000c, 0x2ed7: 0x000c, + 0x2ed8: 0x000c, 0x2ed9: 0x000c, 0x2eda: 0x000c, 0x2edb: 0x000c, 0x2edc: 0x000c, 0x2edd: 0x000c, + 0x2ede: 0x000c, 0x2edf: 0x000c, 0x2ee0: 0x000c, 0x2ee1: 0x000c, 0x2ee2: 0x000c, 0x2ee3: 0x000c, + 0x2ee4: 0x000c, 0x2ee5: 0x000c, 0x2ee6: 0x000c, 0x2ee7: 0x000c, + 0x2eea: 0x000c, 0x2eeb: 0x000c, 0x2eec: 0x000c, 0x2eed: 0x000c, 0x2eee: 0x000c, 0x2eef: 0x000c, + 0x2ef0: 0x000c, 0x2ef2: 0x000c, 0x2ef3: 0x000c, 0x2ef5: 0x000c, + 0x2ef6: 0x000c, + // Block 0xbc, offset 0x2f00 + 0x2f31: 0x000c, 0x2f32: 0x000c, 0x2f33: 0x000c, 0x2f34: 0x000c, 0x2f35: 0x000c, + 0x2f36: 0x000c, 0x2f3a: 0x000c, + 0x2f3c: 0x000c, 0x2f3d: 0x000c, 0x2f3f: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f40: 0x000c, 0x2f41: 0x000c, 0x2f42: 0x000c, 0x2f43: 0x000c, 0x2f44: 0x000c, 0x2f45: 0x000c, + 0x2f47: 0x000c, + // Block 0xbe, offset 0x2f80 + 0x2fb0: 0x000c, 0x2fb1: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb4: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2ff0: 0x000c, 0x2ff1: 0x000c, 0x2ff2: 0x000c, 0x2ff3: 0x000c, 0x2ff4: 0x000c, 0x2ff5: 0x000c, + 0x2ff6: 0x000c, + // Block 0xc0, offset 0x3000 + 0x300f: 0x000c, 0x3010: 0x000c, 0x3011: 0x000c, + 0x3012: 0x000c, + // Block 0xc1, offset 0x3040 + 0x305d: 0x000c, + 0x305e: 0x000c, 0x3060: 0x000b, 0x3061: 0x000b, 0x3062: 0x000b, 0x3063: 0x000b, + // Block 0xc2, offset 0x3080 + 0x30a7: 0x000c, 0x30a8: 0x000c, 0x30a9: 0x000c, + 0x30b3: 0x000b, 0x30b4: 0x000b, 0x30b5: 0x000b, + 0x30b6: 0x000b, 0x30b7: 0x000b, 0x30b8: 0x000b, 0x30b9: 0x000b, 0x30ba: 0x000b, 0x30bb: 0x000c, + 0x30bc: 0x000c, 0x30bd: 0x000c, 0x30be: 0x000c, 0x30bf: 0x000c, + // Block 0xc3, offset 0x30c0 + 0x30c0: 0x000c, 0x30c1: 0x000c, 0x30c2: 0x000c, 0x30c5: 0x000c, + 0x30c6: 0x000c, 0x30c7: 0x000c, 0x30c8: 0x000c, 0x30c9: 0x000c, 0x30ca: 0x000c, 0x30cb: 0x000c, + 0x30ea: 0x000c, 0x30eb: 0x000c, 0x30ec: 0x000c, 0x30ed: 0x000c, + // Block 0xc4, offset 0x3100 + 0x3100: 0x000a, 0x3101: 0x000a, 0x3102: 0x000c, 0x3103: 0x000c, 0x3104: 0x000c, 0x3105: 0x000a, + // Block 0xc5, offset 0x3140 + 0x3140: 0x000a, 0x3141: 0x000a, 0x3142: 0x000a, 0x3143: 0x000a, 0x3144: 0x000a, 0x3145: 0x000a, + 0x3146: 0x000a, 0x3147: 0x000a, 0x3148: 0x000a, 0x3149: 0x000a, 0x314a: 0x000a, 0x314b: 0x000a, + 0x314c: 0x000a, 0x314d: 0x000a, 0x314e: 0x000a, 0x314f: 0x000a, 0x3150: 0x000a, 0x3151: 0x000a, + 0x3152: 0x000a, 0x3153: 0x000a, 0x3154: 0x000a, 0x3155: 0x000a, 0x3156: 0x000a, + // Block 0xc6, offset 0x3180 + 0x319b: 0x000a, + // Block 0xc7, offset 0x31c0 + 0x31d5: 0x000a, + // Block 0xc8, offset 0x3200 + 0x320f: 0x000a, + // Block 0xc9, offset 0x3240 + 0x3249: 0x000a, + // Block 0xca, offset 0x3280 + 0x3283: 0x000a, + 0x328e: 0x0002, 0x328f: 0x0002, 0x3290: 0x0002, 0x3291: 0x0002, + 0x3292: 0x0002, 0x3293: 0x0002, 0x3294: 0x0002, 0x3295: 0x0002, 0x3296: 0x0002, 0x3297: 0x0002, + 0x3298: 0x0002, 0x3299: 0x0002, 0x329a: 0x0002, 0x329b: 0x0002, 0x329c: 0x0002, 0x329d: 0x0002, + 0x329e: 0x0002, 0x329f: 0x0002, 0x32a0: 0x0002, 0x32a1: 0x0002, 0x32a2: 0x0002, 0x32a3: 0x0002, + 0x32a4: 0x0002, 0x32a5: 0x0002, 0x32a6: 0x0002, 0x32a7: 0x0002, 0x32a8: 0x0002, 0x32a9: 0x0002, + 0x32aa: 0x0002, 0x32ab: 0x0002, 0x32ac: 0x0002, 0x32ad: 0x0002, 0x32ae: 0x0002, 0x32af: 0x0002, + 0x32b0: 0x0002, 0x32b1: 0x0002, 0x32b2: 0x0002, 0x32b3: 0x0002, 0x32b4: 0x0002, 0x32b5: 0x0002, + 0x32b6: 0x0002, 0x32b7: 0x0002, 0x32b8: 0x0002, 0x32b9: 0x0002, 0x32ba: 0x0002, 0x32bb: 0x0002, + 0x32bc: 0x0002, 0x32bd: 0x0002, 0x32be: 0x0002, 0x32bf: 0x0002, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x000c, 0x32c1: 0x000c, 0x32c2: 0x000c, 0x32c3: 0x000c, 0x32c4: 0x000c, 0x32c5: 0x000c, + 0x32c6: 0x000c, 0x32c7: 0x000c, 0x32c8: 0x000c, 0x32c9: 0x000c, 0x32ca: 0x000c, 0x32cb: 0x000c, + 0x32cc: 0x000c, 0x32cd: 0x000c, 0x32ce: 0x000c, 0x32cf: 0x000c, 0x32d0: 0x000c, 0x32d1: 0x000c, + 0x32d2: 0x000c, 0x32d3: 0x000c, 0x32d4: 0x000c, 0x32d5: 0x000c, 0x32d6: 0x000c, 0x32d7: 0x000c, + 0x32d8: 0x000c, 0x32d9: 0x000c, 0x32da: 0x000c, 0x32db: 0x000c, 0x32dc: 0x000c, 0x32dd: 0x000c, + 0x32de: 0x000c, 0x32df: 0x000c, 0x32e0: 0x000c, 0x32e1: 0x000c, 0x32e2: 0x000c, 0x32e3: 0x000c, + 0x32e4: 0x000c, 0x32e5: 0x000c, 0x32e6: 0x000c, 0x32e7: 0x000c, 0x32e8: 0x000c, 0x32e9: 0x000c, + 0x32ea: 0x000c, 0x32eb: 0x000c, 0x32ec: 0x000c, 0x32ed: 0x000c, 0x32ee: 0x000c, 0x32ef: 0x000c, + 0x32f0: 0x000c, 0x32f1: 0x000c, 0x32f2: 0x000c, 0x32f3: 0x000c, 0x32f4: 0x000c, 0x32f5: 0x000c, + 0x32f6: 0x000c, 0x32fb: 0x000c, + 0x32fc: 0x000c, 0x32fd: 0x000c, 0x32fe: 0x000c, 0x32ff: 0x000c, + // Block 0xcc, offset 0x3300 + 0x3300: 0x000c, 0x3301: 0x000c, 0x3302: 0x000c, 0x3303: 0x000c, 0x3304: 0x000c, 0x3305: 0x000c, + 0x3306: 0x000c, 0x3307: 0x000c, 0x3308: 0x000c, 0x3309: 0x000c, 0x330a: 0x000c, 0x330b: 0x000c, + 0x330c: 0x000c, 0x330d: 0x000c, 0x330e: 0x000c, 0x330f: 0x000c, 0x3310: 0x000c, 0x3311: 0x000c, + 0x3312: 0x000c, 0x3313: 0x000c, 0x3314: 0x000c, 0x3315: 0x000c, 0x3316: 0x000c, 0x3317: 0x000c, + 0x3318: 0x000c, 0x3319: 0x000c, 0x331a: 0x000c, 0x331b: 0x000c, 0x331c: 0x000c, 0x331d: 0x000c, + 0x331e: 0x000c, 0x331f: 0x000c, 0x3320: 0x000c, 0x3321: 0x000c, 0x3322: 0x000c, 0x3323: 0x000c, + 0x3324: 0x000c, 0x3325: 0x000c, 0x3326: 0x000c, 0x3327: 0x000c, 0x3328: 0x000c, 0x3329: 0x000c, + 0x332a: 0x000c, 0x332b: 0x000c, 0x332c: 0x000c, + 0x3335: 0x000c, + // Block 0xcd, offset 0x3340 + 0x3344: 0x000c, + 0x335b: 0x000c, 0x335c: 0x000c, 0x335d: 0x000c, + 0x335e: 0x000c, 0x335f: 0x000c, 0x3361: 0x000c, 0x3362: 0x000c, 0x3363: 0x000c, + 0x3364: 0x000c, 0x3365: 0x000c, 0x3366: 0x000c, 0x3367: 0x000c, 0x3368: 0x000c, 0x3369: 0x000c, + 0x336a: 0x000c, 0x336b: 0x000c, 0x336c: 0x000c, 0x336d: 0x000c, 0x336e: 0x000c, 0x336f: 0x000c, + // Block 0xce, offset 0x3380 + 0x3380: 0x000c, 0x3381: 0x000c, 0x3382: 0x000c, 0x3383: 0x000c, 0x3384: 0x000c, 0x3385: 0x000c, + 0x3386: 0x000c, 0x3388: 0x000c, 0x3389: 0x000c, 0x338a: 0x000c, 0x338b: 0x000c, + 0x338c: 0x000c, 0x338d: 0x000c, 0x338e: 0x000c, 0x338f: 0x000c, 0x3390: 0x000c, 0x3391: 0x000c, + 0x3392: 0x000c, 0x3393: 0x000c, 0x3394: 0x000c, 0x3395: 0x000c, 0x3396: 0x000c, 0x3397: 0x000c, + 0x3398: 0x000c, 0x339b: 0x000c, 0x339c: 0x000c, 0x339d: 0x000c, + 0x339e: 0x000c, 0x339f: 0x000c, 0x33a0: 0x000c, 0x33a1: 0x000c, 0x33a3: 0x000c, + 0x33a4: 0x000c, 0x33a6: 0x000c, 0x33a7: 0x000c, 0x33a8: 0x000c, 0x33a9: 0x000c, + 0x33aa: 0x000c, + // Block 0xcf, offset 0x33c0 + 0x33c0: 0x0001, 0x33c1: 0x0001, 0x33c2: 0x0001, 0x33c3: 0x0001, 0x33c4: 0x0001, 0x33c5: 0x0001, + 0x33c6: 0x0001, 0x33c7: 0x0001, 0x33c8: 0x0001, 0x33c9: 0x0001, 0x33ca: 0x0001, 0x33cb: 0x0001, + 0x33cc: 0x0001, 0x33cd: 0x0001, 0x33ce: 0x0001, 0x33cf: 0x0001, 0x33d0: 0x000c, 0x33d1: 0x000c, + 0x33d2: 0x000c, 0x33d3: 0x000c, 0x33d4: 0x000c, 0x33d5: 0x000c, 0x33d6: 0x000c, 0x33d7: 0x0001, + 0x33d8: 0x0001, 0x33d9: 0x0001, 0x33da: 0x0001, 0x33db: 0x0001, 0x33dc: 0x0001, 0x33dd: 0x0001, + 0x33de: 0x0001, 0x33df: 0x0001, 0x33e0: 0x0001, 0x33e1: 0x0001, 0x33e2: 0x0001, 0x33e3: 0x0001, + 0x33e4: 0x0001, 0x33e5: 0x0001, 0x33e6: 0x0001, 0x33e7: 0x0001, 0x33e8: 0x0001, 0x33e9: 0x0001, + 0x33ea: 0x0001, 0x33eb: 0x0001, 0x33ec: 0x0001, 0x33ed: 0x0001, 0x33ee: 0x0001, 0x33ef: 0x0001, + 0x33f0: 0x0001, 0x33f1: 0x0001, 0x33f2: 0x0001, 0x33f3: 0x0001, 0x33f4: 0x0001, 0x33f5: 0x0001, + 0x33f6: 0x0001, 0x33f7: 0x0001, 0x33f8: 0x0001, 0x33f9: 0x0001, 0x33fa: 0x0001, 0x33fb: 0x0001, + 0x33fc: 0x0001, 0x33fd: 0x0001, 0x33fe: 0x0001, 0x33ff: 0x0001, + // Block 0xd0, offset 0x3400 + 0x3400: 0x0001, 0x3401: 0x0001, 0x3402: 0x0001, 0x3403: 0x0001, 0x3404: 0x000c, 0x3405: 0x000c, + 0x3406: 0x000c, 0x3407: 0x000c, 0x3408: 0x000c, 0x3409: 0x000c, 0x340a: 0x000c, 0x340b: 0x0001, + 0x340c: 0x0001, 0x340d: 0x0001, 0x340e: 0x0001, 0x340f: 0x0001, 0x3410: 0x0001, 0x3411: 0x0001, + 0x3412: 0x0001, 0x3413: 0x0001, 0x3414: 0x0001, 0x3415: 0x0001, 0x3416: 0x0001, 0x3417: 0x0001, + 0x3418: 0x0001, 0x3419: 0x0001, 0x341a: 0x0001, 0x341b: 0x0001, 0x341c: 0x0001, 0x341d: 0x0001, + 0x341e: 0x0001, 0x341f: 0x0001, 0x3420: 0x0001, 0x3421: 0x0001, 0x3422: 0x0001, 0x3423: 0x0001, + 0x3424: 0x0001, 0x3425: 0x0001, 0x3426: 0x0001, 0x3427: 0x0001, 0x3428: 0x0001, 0x3429: 0x0001, + 0x342a: 0x0001, 0x342b: 0x0001, 0x342c: 0x0001, 0x342d: 0x0001, 0x342e: 0x0001, 0x342f: 0x0001, + 0x3430: 0x0001, 0x3431: 0x0001, 0x3432: 0x0001, 0x3433: 0x0001, 0x3434: 0x0001, 0x3435: 0x0001, + 0x3436: 0x0001, 0x3437: 0x0001, 0x3438: 0x0001, 0x3439: 0x0001, 0x343a: 0x0001, 0x343b: 0x0001, + 0x343c: 0x0001, 0x343d: 0x0001, 0x343e: 0x0001, 0x343f: 0x0001, + // Block 0xd1, offset 0x3440 + 0x3440: 0x000d, 0x3441: 0x000d, 0x3442: 0x000d, 0x3443: 0x000d, 0x3444: 0x000d, 0x3445: 0x000d, + 0x3446: 0x000d, 0x3447: 0x000d, 0x3448: 0x000d, 0x3449: 0x000d, 0x344a: 0x000d, 0x344b: 0x000d, + 0x344c: 0x000d, 0x344d: 0x000d, 0x344e: 0x000d, 0x344f: 0x000d, 0x3450: 0x000d, 0x3451: 0x000d, + 0x3452: 0x000d, 0x3453: 0x000d, 0x3454: 0x000d, 0x3455: 0x000d, 0x3456: 0x000d, 0x3457: 0x000d, + 0x3458: 0x000d, 0x3459: 0x000d, 0x345a: 0x000d, 0x345b: 0x000d, 0x345c: 0x000d, 0x345d: 0x000d, + 0x345e: 0x000d, 0x345f: 0x000d, 0x3460: 0x000d, 0x3461: 0x000d, 0x3462: 0x000d, 0x3463: 0x000d, + 0x3464: 0x000d, 0x3465: 0x000d, 0x3466: 0x000d, 0x3467: 0x000d, 0x3468: 0x000d, 0x3469: 0x000d, + 0x346a: 0x000d, 0x346b: 0x000d, 0x346c: 0x000d, 0x346d: 0x000d, 0x346e: 0x000d, 0x346f: 0x000d, + 0x3470: 0x000a, 0x3471: 0x000a, 0x3472: 0x000d, 0x3473: 0x000d, 0x3474: 0x000d, 0x3475: 0x000d, + 0x3476: 0x000d, 0x3477: 0x000d, 0x3478: 0x000d, 0x3479: 0x000d, 0x347a: 0x000d, 0x347b: 0x000d, + 0x347c: 0x000d, 0x347d: 0x000d, 0x347e: 0x000d, 0x347f: 0x000d, + // Block 0xd2, offset 0x3480 + 0x3480: 0x000a, 0x3481: 0x000a, 0x3482: 0x000a, 0x3483: 0x000a, 0x3484: 0x000a, 0x3485: 0x000a, + 0x3486: 0x000a, 0x3487: 0x000a, 0x3488: 0x000a, 0x3489: 0x000a, 0x348a: 0x000a, 0x348b: 0x000a, + 0x348c: 0x000a, 0x348d: 0x000a, 0x348e: 0x000a, 0x348f: 0x000a, 0x3490: 0x000a, 0x3491: 0x000a, + 0x3492: 0x000a, 0x3493: 0x000a, 0x3494: 0x000a, 0x3495: 0x000a, 0x3496: 0x000a, 0x3497: 0x000a, + 0x3498: 0x000a, 0x3499: 0x000a, 0x349a: 0x000a, 0x349b: 0x000a, 0x349c: 0x000a, 0x349d: 0x000a, + 0x349e: 0x000a, 0x349f: 0x000a, 0x34a0: 0x000a, 0x34a1: 0x000a, 0x34a2: 0x000a, 0x34a3: 0x000a, + 0x34a4: 0x000a, 0x34a5: 0x000a, 0x34a6: 0x000a, 0x34a7: 0x000a, 0x34a8: 0x000a, 0x34a9: 0x000a, + 0x34aa: 0x000a, 0x34ab: 0x000a, + 0x34b0: 0x000a, 0x34b1: 0x000a, 0x34b2: 0x000a, 0x34b3: 0x000a, 0x34b4: 0x000a, 0x34b5: 0x000a, + 0x34b6: 0x000a, 0x34b7: 0x000a, 0x34b8: 0x000a, 0x34b9: 0x000a, 0x34ba: 0x000a, 0x34bb: 0x000a, + 0x34bc: 0x000a, 0x34bd: 0x000a, 0x34be: 0x000a, 0x34bf: 0x000a, + // Block 0xd3, offset 0x34c0 + 0x34c0: 0x000a, 0x34c1: 0x000a, 0x34c2: 0x000a, 0x34c3: 0x000a, 0x34c4: 0x000a, 0x34c5: 0x000a, + 0x34c6: 0x000a, 0x34c7: 0x000a, 0x34c8: 0x000a, 0x34c9: 0x000a, 0x34ca: 0x000a, 0x34cb: 0x000a, + 0x34cc: 0x000a, 0x34cd: 0x000a, 0x34ce: 0x000a, 0x34cf: 0x000a, 0x34d0: 0x000a, 0x34d1: 0x000a, + 0x34d2: 0x000a, 0x34d3: 0x000a, + 0x34e0: 0x000a, 0x34e1: 0x000a, 0x34e2: 0x000a, 0x34e3: 0x000a, + 0x34e4: 0x000a, 0x34e5: 0x000a, 0x34e6: 0x000a, 0x34e7: 0x000a, 0x34e8: 0x000a, 0x34e9: 0x000a, + 0x34ea: 0x000a, 0x34eb: 0x000a, 0x34ec: 0x000a, 0x34ed: 0x000a, 0x34ee: 0x000a, + 0x34f1: 0x000a, 0x34f2: 0x000a, 0x34f3: 0x000a, 0x34f4: 0x000a, 0x34f5: 0x000a, + 0x34f6: 0x000a, 0x34f7: 0x000a, 0x34f8: 0x000a, 0x34f9: 0x000a, 0x34fa: 0x000a, 0x34fb: 0x000a, + 0x34fc: 0x000a, 0x34fd: 0x000a, 0x34fe: 0x000a, 0x34ff: 0x000a, + // Block 0xd4, offset 0x3500 + 0x3501: 0x000a, 0x3502: 0x000a, 0x3503: 0x000a, 0x3504: 0x000a, 0x3505: 0x000a, + 0x3506: 0x000a, 0x3507: 0x000a, 0x3508: 0x000a, 0x3509: 0x000a, 0x350a: 0x000a, 0x350b: 0x000a, + 0x350c: 0x000a, 0x350d: 0x000a, 0x350e: 0x000a, 0x350f: 0x000a, 0x3511: 0x000a, + 0x3512: 0x000a, 0x3513: 0x000a, 0x3514: 0x000a, 0x3515: 0x000a, 0x3516: 0x000a, 0x3517: 0x000a, + 0x3518: 0x000a, 0x3519: 0x000a, 0x351a: 0x000a, 0x351b: 0x000a, 0x351c: 0x000a, 0x351d: 0x000a, + 0x351e: 0x000a, 0x351f: 0x000a, 0x3520: 0x000a, 0x3521: 0x000a, 0x3522: 0x000a, 0x3523: 0x000a, + 0x3524: 0x000a, 0x3525: 0x000a, 0x3526: 0x000a, 0x3527: 0x000a, 0x3528: 0x000a, 0x3529: 0x000a, + 0x352a: 0x000a, 0x352b: 0x000a, 0x352c: 0x000a, 0x352d: 0x000a, 0x352e: 0x000a, 0x352f: 0x000a, + 0x3530: 0x000a, 0x3531: 0x000a, 0x3532: 0x000a, 0x3533: 0x000a, 0x3534: 0x000a, 0x3535: 0x000a, + // Block 0xd5, offset 0x3540 + 0x3540: 0x0002, 0x3541: 0x0002, 0x3542: 0x0002, 0x3543: 0x0002, 0x3544: 0x0002, 0x3545: 0x0002, + 0x3546: 0x0002, 0x3547: 0x0002, 0x3548: 0x0002, 0x3549: 0x0002, 0x354a: 0x0002, 0x354b: 0x000a, + 0x354c: 0x000a, + // Block 0xd6, offset 0x3580 + 0x35aa: 0x000a, 0x35ab: 0x000a, + // Block 0xd7, offset 0x35c0 + 0x35e0: 0x000a, 0x35e1: 0x000a, 0x35e2: 0x000a, 0x35e3: 0x000a, + 0x35e4: 0x000a, 0x35e5: 0x000a, + // Block 0xd8, offset 0x3600 + 0x3600: 0x000a, 0x3601: 0x000a, 0x3602: 0x000a, 0x3603: 0x000a, 0x3604: 0x000a, 0x3605: 0x000a, + 0x3606: 0x000a, 0x3607: 0x000a, 0x3608: 0x000a, 0x3609: 0x000a, 0x360a: 0x000a, 0x360b: 0x000a, + 0x360c: 0x000a, 0x360d: 0x000a, 0x360e: 0x000a, 0x360f: 0x000a, 0x3610: 0x000a, 0x3611: 0x000a, + 0x3612: 0x000a, 0x3613: 0x000a, 0x3614: 0x000a, + 0x3620: 0x000a, 0x3621: 0x000a, 0x3622: 0x000a, 0x3623: 0x000a, + 0x3624: 0x000a, 0x3625: 0x000a, 0x3626: 0x000a, 0x3627: 0x000a, 0x3628: 0x000a, 0x3629: 0x000a, + 0x362a: 0x000a, 0x362b: 0x000a, 0x362c: 0x000a, + 0x3630: 0x000a, 0x3631: 0x000a, 0x3632: 0x000a, 0x3633: 0x000a, 0x3634: 0x000a, 0x3635: 0x000a, + 0x3636: 0x000a, 0x3637: 0x000a, 0x3638: 0x000a, + // Block 0xd9, offset 0x3640 + 0x3640: 0x000a, 0x3641: 0x000a, 0x3642: 0x000a, 0x3643: 0x000a, 0x3644: 0x000a, 0x3645: 0x000a, + 0x3646: 0x000a, 0x3647: 0x000a, 0x3648: 0x000a, 0x3649: 0x000a, 0x364a: 0x000a, 0x364b: 0x000a, + 0x364c: 0x000a, 0x364d: 0x000a, 0x364e: 0x000a, 0x364f: 0x000a, 0x3650: 0x000a, 0x3651: 0x000a, + 0x3652: 0x000a, 0x3653: 0x000a, 0x3654: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000a, 0x3683: 0x000a, 0x3684: 0x000a, 0x3685: 0x000a, + 0x3686: 0x000a, 0x3687: 0x000a, 0x3688: 0x000a, 0x3689: 0x000a, 0x368a: 0x000a, 0x368b: 0x000a, + 0x3690: 0x000a, 0x3691: 0x000a, + 0x3692: 0x000a, 0x3693: 0x000a, 0x3694: 0x000a, 0x3695: 0x000a, 0x3696: 0x000a, 0x3697: 0x000a, + 0x3698: 0x000a, 0x3699: 0x000a, 0x369a: 0x000a, 0x369b: 0x000a, 0x369c: 0x000a, 0x369d: 0x000a, + 0x369e: 0x000a, 0x369f: 0x000a, 0x36a0: 0x000a, 0x36a1: 0x000a, 0x36a2: 0x000a, 0x36a3: 0x000a, + 0x36a4: 0x000a, 0x36a5: 0x000a, 0x36a6: 0x000a, 0x36a7: 0x000a, 0x36a8: 0x000a, 0x36a9: 0x000a, + 0x36aa: 0x000a, 0x36ab: 0x000a, 0x36ac: 0x000a, 0x36ad: 0x000a, 0x36ae: 0x000a, 0x36af: 0x000a, + 0x36b0: 0x000a, 0x36b1: 0x000a, 0x36b2: 0x000a, 0x36b3: 0x000a, 0x36b4: 0x000a, 0x36b5: 0x000a, + 0x36b6: 0x000a, 0x36b7: 0x000a, 0x36b8: 0x000a, 0x36b9: 0x000a, 0x36ba: 0x000a, 0x36bb: 0x000a, + 0x36bc: 0x000a, 0x36bd: 0x000a, 0x36be: 0x000a, 0x36bf: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36c0: 0x000a, 0x36c1: 0x000a, 0x36c2: 0x000a, 0x36c3: 0x000a, 0x36c4: 0x000a, 0x36c5: 0x000a, + 0x36c6: 0x000a, 0x36c7: 0x000a, + 0x36d0: 0x000a, 0x36d1: 0x000a, + 0x36d2: 0x000a, 0x36d3: 0x000a, 0x36d4: 0x000a, 0x36d5: 0x000a, 0x36d6: 0x000a, 0x36d7: 0x000a, + 0x36d8: 0x000a, 0x36d9: 0x000a, + 0x36e0: 0x000a, 0x36e1: 0x000a, 0x36e2: 0x000a, 0x36e3: 0x000a, + 0x36e4: 0x000a, 0x36e5: 0x000a, 0x36e6: 0x000a, 0x36e7: 0x000a, 0x36e8: 0x000a, 0x36e9: 0x000a, + 0x36ea: 0x000a, 0x36eb: 0x000a, 0x36ec: 0x000a, 0x36ed: 0x000a, 0x36ee: 0x000a, 0x36ef: 0x000a, + 0x36f0: 0x000a, 0x36f1: 0x000a, 0x36f2: 0x000a, 0x36f3: 0x000a, 0x36f4: 0x000a, 0x36f5: 0x000a, + 0x36f6: 0x000a, 0x36f7: 0x000a, 0x36f8: 0x000a, 0x36f9: 0x000a, 0x36fa: 0x000a, 0x36fb: 0x000a, + 0x36fc: 0x000a, 0x36fd: 0x000a, 0x36fe: 0x000a, 0x36ff: 0x000a, + // Block 0xdc, offset 0x3700 + 0x3700: 0x000a, 0x3701: 0x000a, 0x3702: 0x000a, 0x3703: 0x000a, 0x3704: 0x000a, 0x3705: 0x000a, + 0x3706: 0x000a, 0x3707: 0x000a, + 0x3710: 0x000a, 0x3711: 0x000a, + 0x3712: 0x000a, 0x3713: 0x000a, 0x3714: 0x000a, 0x3715: 0x000a, 0x3716: 0x000a, 0x3717: 0x000a, + 0x3718: 0x000a, 0x3719: 0x000a, 0x371a: 0x000a, 0x371b: 0x000a, 0x371c: 0x000a, 0x371d: 0x000a, + 0x371e: 0x000a, 0x371f: 0x000a, 0x3720: 0x000a, 0x3721: 0x000a, 0x3722: 0x000a, 0x3723: 0x000a, + 0x3724: 0x000a, 0x3725: 0x000a, 0x3726: 0x000a, 0x3727: 0x000a, 0x3728: 0x000a, 0x3729: 0x000a, + 0x372a: 0x000a, 0x372b: 0x000a, 0x372c: 0x000a, 0x372d: 0x000a, + // Block 0xdd, offset 0x3740 + 0x3740: 0x000a, 0x3741: 0x000a, 0x3742: 0x000a, 0x3743: 0x000a, 0x3744: 0x000a, 0x3745: 0x000a, + 0x3746: 0x000a, 0x3747: 0x000a, 0x3748: 0x000a, 0x3749: 0x000a, 0x374a: 0x000a, 0x374b: 0x000a, + 0x3750: 0x000a, 0x3751: 0x000a, + 0x3752: 0x000a, 0x3753: 0x000a, 0x3754: 0x000a, 0x3755: 0x000a, 0x3756: 0x000a, 0x3757: 0x000a, + 0x3758: 0x000a, 0x3759: 0x000a, 0x375a: 0x000a, 0x375b: 0x000a, 0x375c: 0x000a, 0x375d: 0x000a, + 0x375e: 0x000a, 0x375f: 0x000a, 0x3760: 0x000a, 0x3761: 0x000a, 0x3762: 0x000a, 0x3763: 0x000a, + 0x3764: 0x000a, 0x3765: 0x000a, 0x3766: 0x000a, 0x3767: 0x000a, 0x3768: 0x000a, 0x3769: 0x000a, + 0x376a: 0x000a, 0x376b: 0x000a, 0x376c: 0x000a, 0x376d: 0x000a, 0x376e: 0x000a, 0x376f: 0x000a, + 0x3770: 0x000a, 0x3771: 0x000a, 0x3772: 0x000a, 0x3773: 0x000a, 0x3774: 0x000a, 0x3775: 0x000a, + 0x3776: 0x000a, 0x3777: 0x000a, 0x3778: 0x000a, 0x3779: 0x000a, 0x377a: 0x000a, 0x377b: 0x000a, + 0x377c: 0x000a, 0x377d: 0x000a, 0x377e: 0x000a, + // Block 0xde, offset 0x3780 + 0x3780: 0x000a, 0x3781: 0x000a, 0x3782: 0x000a, 0x3783: 0x000a, 0x3784: 0x000a, 0x3785: 0x000a, + 0x3786: 0x000a, 0x3787: 0x000a, 0x3788: 0x000a, 0x3789: 0x000a, 0x378a: 0x000a, 0x378b: 0x000a, + 0x378c: 0x000a, 0x3790: 0x000a, 0x3791: 0x000a, + 0x3792: 0x000a, 0x3793: 0x000a, 0x3794: 0x000a, 0x3795: 0x000a, 0x3796: 0x000a, 0x3797: 0x000a, + 0x3798: 0x000a, 0x3799: 0x000a, 0x379a: 0x000a, 0x379b: 0x000a, 0x379c: 0x000a, 0x379d: 0x000a, + 0x379e: 0x000a, 0x379f: 0x000a, 0x37a0: 0x000a, 0x37a1: 0x000a, 0x37a2: 0x000a, 0x37a3: 0x000a, + 0x37a4: 0x000a, 0x37a5: 0x000a, 0x37a6: 0x000a, 0x37a7: 0x000a, 0x37a8: 0x000a, 0x37a9: 0x000a, + 0x37aa: 0x000a, 0x37ab: 0x000a, + // Block 0xdf, offset 0x37c0 + 0x37c0: 0x000a, 0x37c1: 0x000a, 0x37c2: 0x000a, 0x37c3: 0x000a, 0x37c4: 0x000a, 0x37c5: 0x000a, + 0x37c6: 0x000a, 0x37c7: 0x000a, 0x37c8: 0x000a, 0x37c9: 0x000a, 0x37ca: 0x000a, 0x37cb: 0x000a, + 0x37cc: 0x000a, 0x37cd: 0x000a, 0x37ce: 0x000a, 0x37cf: 0x000a, 0x37d0: 0x000a, 0x37d1: 0x000a, + 0x37d2: 0x000a, 0x37d3: 0x000a, 0x37d4: 0x000a, 0x37d5: 0x000a, 0x37d6: 0x000a, 0x37d7: 0x000a, + // Block 0xe0, offset 0x3800 + 0x3800: 0x000a, + 0x3810: 0x000a, 0x3811: 0x000a, + 0x3812: 0x000a, 0x3813: 0x000a, 0x3814: 0x000a, 0x3815: 0x000a, 0x3816: 0x000a, 0x3817: 0x000a, + 0x3818: 0x000a, 0x3819: 0x000a, 0x381a: 0x000a, 0x381b: 0x000a, 0x381c: 0x000a, 0x381d: 0x000a, + 0x381e: 0x000a, 0x381f: 0x000a, 0x3820: 0x000a, 0x3821: 0x000a, 0x3822: 0x000a, 0x3823: 0x000a, + 0x3824: 0x000a, 0x3825: 0x000a, 0x3826: 0x000a, + // Block 0xe1, offset 0x3840 + 0x387e: 0x000b, 0x387f: 0x000b, + // Block 0xe2, offset 0x3880 + 0x3880: 0x000b, 0x3881: 0x000b, 0x3882: 0x000b, 0x3883: 0x000b, 0x3884: 0x000b, 0x3885: 0x000b, + 0x3886: 0x000b, 0x3887: 0x000b, 0x3888: 0x000b, 0x3889: 0x000b, 0x388a: 0x000b, 0x388b: 0x000b, + 0x388c: 0x000b, 0x388d: 0x000b, 0x388e: 0x000b, 0x388f: 0x000b, 0x3890: 0x000b, 0x3891: 0x000b, + 0x3892: 0x000b, 0x3893: 0x000b, 0x3894: 0x000b, 0x3895: 0x000b, 0x3896: 0x000b, 0x3897: 0x000b, + 0x3898: 0x000b, 0x3899: 0x000b, 0x389a: 0x000b, 0x389b: 0x000b, 0x389c: 0x000b, 0x389d: 0x000b, + 0x389e: 0x000b, 0x389f: 0x000b, 0x38a0: 0x000b, 0x38a1: 0x000b, 0x38a2: 0x000b, 0x38a3: 0x000b, + 0x38a4: 0x000b, 0x38a5: 0x000b, 0x38a6: 0x000b, 0x38a7: 0x000b, 0x38a8: 0x000b, 0x38a9: 0x000b, + 0x38aa: 0x000b, 0x38ab: 0x000b, 0x38ac: 0x000b, 0x38ad: 0x000b, 0x38ae: 0x000b, 0x38af: 0x000b, + 0x38b0: 0x000b, 0x38b1: 0x000b, 0x38b2: 0x000b, 0x38b3: 0x000b, 0x38b4: 0x000b, 0x38b5: 0x000b, + 0x38b6: 0x000b, 0x38b7: 0x000b, 0x38b8: 0x000b, 0x38b9: 0x000b, 0x38ba: 0x000b, 0x38bb: 0x000b, + 0x38bc: 0x000b, 0x38bd: 0x000b, 0x38be: 0x000b, 0x38bf: 0x000b, + // Block 0xe3, offset 0x38c0 + 0x38c0: 0x000c, 0x38c1: 0x000c, 0x38c2: 0x000c, 0x38c3: 0x000c, 0x38c4: 0x000c, 0x38c5: 0x000c, + 0x38c6: 0x000c, 0x38c7: 0x000c, 0x38c8: 0x000c, 0x38c9: 0x000c, 0x38ca: 0x000c, 0x38cb: 0x000c, + 0x38cc: 0x000c, 0x38cd: 0x000c, 0x38ce: 0x000c, 0x38cf: 0x000c, 0x38d0: 0x000c, 0x38d1: 0x000c, + 0x38d2: 0x000c, 0x38d3: 0x000c, 0x38d4: 0x000c, 0x38d5: 0x000c, 0x38d6: 0x000c, 0x38d7: 0x000c, + 0x38d8: 0x000c, 0x38d9: 0x000c, 0x38da: 0x000c, 0x38db: 0x000c, 0x38dc: 0x000c, 0x38dd: 0x000c, + 0x38de: 0x000c, 0x38df: 0x000c, 0x38e0: 0x000c, 0x38e1: 0x000c, 0x38e2: 0x000c, 0x38e3: 0x000c, + 0x38e4: 0x000c, 0x38e5: 0x000c, 0x38e6: 0x000c, 0x38e7: 0x000c, 0x38e8: 0x000c, 0x38e9: 0x000c, + 0x38ea: 0x000c, 0x38eb: 0x000c, 0x38ec: 0x000c, 0x38ed: 0x000c, 0x38ee: 0x000c, 0x38ef: 0x000c, + 0x38f0: 0x000b, 0x38f1: 0x000b, 0x38f2: 0x000b, 0x38f3: 0x000b, 0x38f4: 0x000b, 0x38f5: 0x000b, + 0x38f6: 0x000b, 0x38f7: 0x000b, 0x38f8: 0x000b, 0x38f9: 0x000b, 0x38fa: 0x000b, 0x38fb: 0x000b, + 0x38fc: 0x000b, 0x38fd: 0x000b, 0x38fe: 0x000b, 0x38ff: 0x000b, +} + +// bidiIndex: 24 blocks, 1536 entries, 1536 bytes +// Block 0 is the zero block. +var bidiIndex = [1536]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x11, 0xf1: 0x12, 0xf2: 0x12, 0xf3: 0x14, 0xf4: 0x15, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x137: 0x28, + 0x138: 0x29, 0x139: 0x2a, 0x13a: 0x2b, 0x13b: 0x2c, 0x13c: 0x2d, 0x13d: 0x2e, 0x13e: 0x2f, 0x13f: 0x30, + // Block 0x5, offset 0x140 + 0x140: 0x31, 0x141: 0x32, 0x142: 0x33, + 0x14d: 0x34, 0x14e: 0x35, + 0x150: 0x36, + 0x15a: 0x37, 0x15c: 0x38, 0x15d: 0x39, 0x15e: 0x3a, 0x15f: 0x3b, + 0x160: 0x3c, 0x162: 0x3d, 0x164: 0x3e, 0x165: 0x3f, 0x167: 0x40, + 0x168: 0x41, 0x169: 0x42, 0x16a: 0x43, 0x16c: 0x44, 0x16d: 0x45, 0x16e: 0x46, 0x16f: 0x47, + 0x170: 0x48, 0x173: 0x49, 0x177: 0x4a, + 0x17e: 0x4b, 0x17f: 0x4c, + // Block 0x6, offset 0x180 + 0x180: 0x4d, 0x181: 0x4e, 0x182: 0x4f, 0x183: 0x50, 0x184: 0x51, 0x185: 0x52, 0x186: 0x53, 0x187: 0x54, + 0x188: 0x55, 0x189: 0x54, 0x18a: 0x54, 0x18b: 0x54, 0x18c: 0x56, 0x18d: 0x57, 0x18e: 0x58, 0x18f: 0x54, + 0x190: 0x59, 0x191: 0x5a, 0x192: 0x5b, 0x193: 0x5c, 0x194: 0x54, 0x195: 0x54, 0x196: 0x54, 0x197: 0x54, + 0x198: 0x54, 0x199: 0x54, 0x19a: 0x5d, 0x19b: 0x54, 0x19c: 0x54, 0x19d: 0x5e, 0x19e: 0x54, 0x19f: 0x5f, + 0x1a4: 0x54, 0x1a5: 0x54, 0x1a6: 0x60, 0x1a7: 0x61, + 0x1a8: 0x54, 0x1a9: 0x54, 0x1aa: 0x54, 0x1ab: 0x54, 0x1ac: 0x54, 0x1ad: 0x62, 0x1ae: 0x63, 0x1af: 0x64, + 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67, + 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x54, 0x1bd: 0x54, 0x1be: 0x54, 0x1bf: 0x6c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70, + 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76, + // Block 0x8, offset 0x200 + 0x237: 0x54, + // Block 0x9, offset 0x240 + 0x252: 0x77, 0x253: 0x78, + 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e, + 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85, + 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26f: 0x8a, + // Block 0xa, offset 0x280 + 0x2ac: 0x8b, 0x2ad: 0x8c, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8d, 0x2b5: 0x0e, 0x2b6: 0x0e, 0x2b7: 0x8e, + 0x2b8: 0x8f, 0x2b9: 0x90, 0x2ba: 0x0e, 0x2bb: 0x91, 0x2bc: 0x92, 0x2bd: 0x93, 0x2bf: 0x94, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x95, 0x2c5: 0x54, 0x2c6: 0x96, 0x2c7: 0x97, + 0x2cb: 0x98, 0x2cd: 0x99, + 0x2e0: 0x9a, 0x2e1: 0x9a, 0x2e2: 0x9a, 0x2e3: 0x9a, 0x2e4: 0x9b, 0x2e5: 0x9a, 0x2e6: 0x9a, 0x2e7: 0x9a, + 0x2e8: 0x9c, 0x2e9: 0x9a, 0x2ea: 0x9a, 0x2eb: 0x9d, 0x2ec: 0x9e, 0x2ed: 0x9a, 0x2ee: 0x9a, 0x2ef: 0x9a, + 0x2f0: 0x9a, 0x2f1: 0x9a, 0x2f2: 0x9a, 0x2f3: 0x9a, 0x2f4: 0x9a, 0x2f5: 0x9a, 0x2f6: 0x9a, 0x2f7: 0x9a, + 0x2f8: 0x9a, 0x2f9: 0x9f, 0x2fa: 0x9a, 0x2fb: 0x9a, 0x2fc: 0x9a, 0x2fd: 0x9a, 0x2fe: 0x9a, 0x2ff: 0x9a, + // Block 0xc, offset 0x300 + 0x300: 0xa0, 0x301: 0xa1, 0x302: 0xa2, 0x304: 0xa3, 0x305: 0xa4, 0x306: 0xa5, 0x307: 0xa6, + 0x308: 0xa7, 0x30b: 0xa8, 0x30c: 0xa9, 0x30d: 0xaa, + 0x310: 0xab, 0x311: 0xac, 0x312: 0xad, 0x313: 0xae, 0x316: 0xaf, 0x317: 0xb0, + 0x318: 0xb1, 0x319: 0xb2, 0x31a: 0xb3, 0x31c: 0xb4, + 0x328: 0xb5, 0x329: 0xb6, 0x32a: 0xb7, + 0x330: 0xb8, 0x332: 0xb9, 0x334: 0xba, 0x335: 0xbb, + // Block 0xd, offset 0x340 + 0x36b: 0xbc, 0x36c: 0xbd, + 0x37e: 0xbe, + // Block 0xe, offset 0x380 + 0x3b2: 0xbf, + // Block 0xf, offset 0x3c0 + 0x3c5: 0xc0, 0x3c6: 0xc1, + 0x3c8: 0x54, 0x3c9: 0xc2, 0x3cc: 0x54, 0x3cd: 0xc3, + 0x3db: 0xc4, 0x3dc: 0xc5, 0x3dd: 0xc6, 0x3de: 0xc7, 0x3df: 0xc8, + 0x3e8: 0xc9, 0x3e9: 0xca, 0x3ea: 0xcb, + // Block 0x10, offset 0x400 + 0x400: 0xcc, + 0x420: 0x9a, 0x421: 0x9a, 0x422: 0x9a, 0x423: 0xcd, 0x424: 0x9a, 0x425: 0xce, 0x426: 0x9a, 0x427: 0x9a, + 0x428: 0x9a, 0x429: 0x9a, 0x42a: 0x9a, 0x42b: 0x9a, 0x42c: 0x9a, 0x42d: 0x9a, 0x42e: 0x9a, 0x42f: 0x9a, + 0x430: 0x9a, 0x431: 0x9a, 0x432: 0x9a, 0x433: 0x9a, 0x434: 0x9a, 0x435: 0x9a, 0x436: 0x9a, 0x437: 0x9a, + 0x438: 0x0e, 0x439: 0x0e, 0x43a: 0x0e, 0x43b: 0xcf, 0x43c: 0x9a, 0x43d: 0x9a, 0x43e: 0x9a, 0x43f: 0x9a, + // Block 0x11, offset 0x440 + 0x440: 0xd0, 0x441: 0x54, 0x442: 0xd1, 0x443: 0xd2, 0x444: 0xd3, 0x445: 0xd4, + 0x449: 0xd5, 0x44c: 0x54, 0x44d: 0x54, 0x44e: 0x54, 0x44f: 0x54, + 0x450: 0x54, 0x451: 0x54, 0x452: 0x54, 0x453: 0x54, 0x454: 0x54, 0x455: 0x54, 0x456: 0x54, 0x457: 0x54, + 0x458: 0x54, 0x459: 0x54, 0x45a: 0x54, 0x45b: 0xd6, 0x45c: 0x54, 0x45d: 0x6b, 0x45e: 0x54, 0x45f: 0xd7, + 0x460: 0xd8, 0x461: 0xd9, 0x462: 0xda, 0x464: 0xdb, 0x465: 0xdc, 0x466: 0xdd, 0x467: 0xde, + 0x47f: 0xdf, + // Block 0x12, offset 0x480 + 0x4bf: 0xdf, + // Block 0x13, offset 0x4c0 + 0x4d0: 0x09, 0x4d1: 0x0a, 0x4d6: 0x0b, + 0x4db: 0x0c, 0x4dd: 0x0d, 0x4de: 0x0e, 0x4df: 0x0f, + 0x4ef: 0x10, + 0x4ff: 0x10, + // Block 0x14, offset 0x500 + 0x50f: 0x10, + 0x51f: 0x10, + 0x52f: 0x10, + 0x53f: 0x10, + // Block 0x15, offset 0x540 + 0x540: 0xe0, 0x541: 0xe0, 0x542: 0xe0, 0x543: 0xe0, 0x544: 0x05, 0x545: 0x05, 0x546: 0x05, 0x547: 0xe1, + 0x548: 0xe0, 0x549: 0xe0, 0x54a: 0xe0, 0x54b: 0xe0, 0x54c: 0xe0, 0x54d: 0xe0, 0x54e: 0xe0, 0x54f: 0xe0, + 0x550: 0xe0, 0x551: 0xe0, 0x552: 0xe0, 0x553: 0xe0, 0x554: 0xe0, 0x555: 0xe0, 0x556: 0xe0, 0x557: 0xe0, + 0x558: 0xe0, 0x559: 0xe0, 0x55a: 0xe0, 0x55b: 0xe0, 0x55c: 0xe0, 0x55d: 0xe0, 0x55e: 0xe0, 0x55f: 0xe0, + 0x560: 0xe0, 0x561: 0xe0, 0x562: 0xe0, 0x563: 0xe0, 0x564: 0xe0, 0x565: 0xe0, 0x566: 0xe0, 0x567: 0xe0, + 0x568: 0xe0, 0x569: 0xe0, 0x56a: 0xe0, 0x56b: 0xe0, 0x56c: 0xe0, 0x56d: 0xe0, 0x56e: 0xe0, 0x56f: 0xe0, + 0x570: 0xe0, 0x571: 0xe0, 0x572: 0xe0, 0x573: 0xe0, 0x574: 0xe0, 0x575: 0xe0, 0x576: 0xe0, 0x577: 0xe0, + 0x578: 0xe0, 0x579: 0xe0, 0x57a: 0xe0, 0x57b: 0xe0, 0x57c: 0xe0, 0x57d: 0xe0, 0x57e: 0xe0, 0x57f: 0xe0, + // Block 0x16, offset 0x580 + 0x58f: 0x10, + 0x59f: 0x10, + 0x5a0: 0x13, + 0x5af: 0x10, + 0x5bf: 0x10, + // Block 0x17, offset 0x5c0 + 0x5cf: 0x10, +} + +// Total table size 16184 bytes (15KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go new file mode 100644 index 0000000000..022e3c6909 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables11.0.0.go @@ -0,0 +1,1887 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// +build go1.13 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "11.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 16512 bytes (16.12 KiB). Checksum: 2a9cf1317f2ffaa. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 234 blocks, 14976 entries, 14976 bytes +// The third block is the zero block. +var bidiValues = [14976]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x000c, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x000d, 0x5e1: 0x000d, 0x5e2: 0x000d, 0x5e3: 0x000d, + 0x5e4: 0x000d, 0x5e5: 0x000d, 0x5e6: 0x000d, 0x5e7: 0x000d, 0x5e8: 0x000d, 0x5e9: 0x000d, + 0x5ea: 0x000d, 0x5eb: 0x000d, 0x5ec: 0x000d, 0x5ed: 0x000d, 0x5ee: 0x000d, 0x5ef: 0x000d, + 0x5f0: 0x0001, 0x5f1: 0x0001, 0x5f2: 0x0001, 0x5f3: 0x0001, 0x5f4: 0x0001, 0x5f5: 0x0001, + 0x5f6: 0x0001, 0x5f7: 0x0001, 0x5f8: 0x0001, 0x5f9: 0x0001, 0x5fa: 0x0001, 0x5fb: 0x0001, + 0x5fc: 0x0001, 0x5fd: 0x0001, 0x5fe: 0x0001, 0x5ff: 0x0001, + // Block 0x18, offset 0x600 + 0x600: 0x0001, 0x601: 0x0001, 0x602: 0x0001, 0x603: 0x0001, 0x604: 0x0001, 0x605: 0x0001, + 0x606: 0x0001, 0x607: 0x0001, 0x608: 0x0001, 0x609: 0x0001, 0x60a: 0x0001, 0x60b: 0x0001, + 0x60c: 0x0001, 0x60d: 0x0001, 0x60e: 0x0001, 0x60f: 0x0001, 0x610: 0x0001, 0x611: 0x0001, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x0001, 0x619: 0x0001, 0x61a: 0x0001, 0x61b: 0x0001, 0x61c: 0x0001, 0x61d: 0x0001, + 0x61e: 0x0001, 0x61f: 0x0001, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000d, 0x64b: 0x000d, + 0x64c: 0x000d, 0x64d: 0x000d, 0x64e: 0x000d, 0x64f: 0x000d, 0x650: 0x000d, 0x651: 0x000d, + 0x652: 0x000d, 0x653: 0x000c, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + 0x77e: 0x000c, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + 0x83a: 0x000c, 0x83b: 0x000c, + 0x83c: 0x000c, 0x83d: 0x000c, 0x83e: 0x000c, 0x83f: 0x000c, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, 0x944: 0x000c, + 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa00: 0x000c, 0xa01: 0x000c, + 0xa3b: 0x000c, + 0xa3c: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa8a: 0x000c, + 0xa92: 0x000c, 0xa93: 0x000c, 0xa94: 0x000c, 0xa96: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaf1: 0x000c, 0xaf4: 0x000c, 0xaf5: 0x000c, + 0xaf6: 0x000c, 0xaf7: 0x000c, 0xaf8: 0x000c, 0xaf9: 0x000c, 0xafa: 0x000c, + 0xaff: 0x0004, + // Block 0x2c, offset 0xb00 + 0xb07: 0x000c, 0xb08: 0x000c, 0xb09: 0x000c, 0xb0a: 0x000c, 0xb0b: 0x000c, + 0xb0c: 0x000c, 0xb0d: 0x000c, 0xb0e: 0x000c, + // Block 0x2d, offset 0xb40 + 0xb71: 0x000c, 0xb74: 0x000c, 0xb75: 0x000c, + 0xb76: 0x000c, 0xb77: 0x000c, 0xb78: 0x000c, 0xb79: 0x000c, 0xb7b: 0x000c, + 0xb7c: 0x000c, + // Block 0x2e, offset 0xb80 + 0xb88: 0x000c, 0xb89: 0x000c, 0xb8a: 0x000c, 0xb8b: 0x000c, + 0xb8c: 0x000c, 0xb8d: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbd8: 0x000c, 0xbd9: 0x000c, + 0xbf5: 0x000c, + 0xbf7: 0x000c, 0xbf9: 0x000c, 0xbfa: 0x003a, 0xbfb: 0x002a, + 0xbfc: 0x003a, 0xbfd: 0x002a, + // Block 0x30, offset 0xc00 + 0xc31: 0x000c, 0xc32: 0x000c, 0xc33: 0x000c, 0xc34: 0x000c, 0xc35: 0x000c, + 0xc36: 0x000c, 0xc37: 0x000c, 0xc38: 0x000c, 0xc39: 0x000c, 0xc3a: 0x000c, 0xc3b: 0x000c, + 0xc3c: 0x000c, 0xc3d: 0x000c, 0xc3e: 0x000c, + // Block 0x31, offset 0xc40 + 0xc40: 0x000c, 0xc41: 0x000c, 0xc42: 0x000c, 0xc43: 0x000c, 0xc44: 0x000c, + 0xc46: 0x000c, 0xc47: 0x000c, + 0xc4d: 0x000c, 0xc4e: 0x000c, 0xc4f: 0x000c, 0xc50: 0x000c, 0xc51: 0x000c, + 0xc52: 0x000c, 0xc53: 0x000c, 0xc54: 0x000c, 0xc55: 0x000c, 0xc56: 0x000c, 0xc57: 0x000c, + 0xc59: 0x000c, 0xc5a: 0x000c, 0xc5b: 0x000c, 0xc5c: 0x000c, 0xc5d: 0x000c, + 0xc5e: 0x000c, 0xc5f: 0x000c, 0xc60: 0x000c, 0xc61: 0x000c, 0xc62: 0x000c, 0xc63: 0x000c, + 0xc64: 0x000c, 0xc65: 0x000c, 0xc66: 0x000c, 0xc67: 0x000c, 0xc68: 0x000c, 0xc69: 0x000c, + 0xc6a: 0x000c, 0xc6b: 0x000c, 0xc6c: 0x000c, 0xc6d: 0x000c, 0xc6e: 0x000c, 0xc6f: 0x000c, + 0xc70: 0x000c, 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, + // Block 0x32, offset 0xc80 + 0xc86: 0x000c, + // Block 0x33, offset 0xcc0 + 0xced: 0x000c, 0xcee: 0x000c, 0xcef: 0x000c, + 0xcf0: 0x000c, 0xcf2: 0x000c, 0xcf3: 0x000c, 0xcf4: 0x000c, 0xcf5: 0x000c, + 0xcf6: 0x000c, 0xcf7: 0x000c, 0xcf9: 0x000c, 0xcfa: 0x000c, + 0xcfd: 0x000c, 0xcfe: 0x000c, + // Block 0x34, offset 0xd00 + 0xd18: 0x000c, 0xd19: 0x000c, + 0xd1e: 0x000c, 0xd1f: 0x000c, 0xd20: 0x000c, + 0xd31: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, + // Block 0x35, offset 0xd40 + 0xd42: 0x000c, 0xd45: 0x000c, + 0xd46: 0x000c, + 0xd4d: 0x000c, + 0xd5d: 0x000c, + // Block 0x36, offset 0xd80 + 0xd9d: 0x000c, + 0xd9e: 0x000c, 0xd9f: 0x000c, + // Block 0x37, offset 0xdc0 + 0xdd0: 0x000a, 0xdd1: 0x000a, + 0xdd2: 0x000a, 0xdd3: 0x000a, 0xdd4: 0x000a, 0xdd5: 0x000a, 0xdd6: 0x000a, 0xdd7: 0x000a, + 0xdd8: 0x000a, 0xdd9: 0x000a, + // Block 0x38, offset 0xe00 + 0xe00: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0009, + 0xe5b: 0x007a, 0xe5c: 0x006a, + // Block 0x3a, offset 0xe80 + 0xe92: 0x000c, 0xe93: 0x000c, 0xe94: 0x000c, + 0xeb2: 0x000c, 0xeb3: 0x000c, 0xeb4: 0x000c, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf34: 0x000c, 0xf35: 0x000c, + 0xf37: 0x000c, 0xf38: 0x000c, 0xf39: 0x000c, 0xf3a: 0x000c, 0xf3b: 0x000c, + 0xf3c: 0x000c, 0xf3d: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf46: 0x000c, 0xf49: 0x000c, 0xf4a: 0x000c, 0xf4b: 0x000c, + 0xf4c: 0x000c, 0xf4d: 0x000c, 0xf4e: 0x000c, 0xf4f: 0x000c, 0xf50: 0x000c, 0xf51: 0x000c, + 0xf52: 0x000c, 0xf53: 0x000c, + 0xf5b: 0x0004, 0xf5d: 0x000c, + 0xf70: 0x000a, 0xf71: 0x000a, 0xf72: 0x000a, 0xf73: 0x000a, 0xf74: 0x000a, 0xf75: 0x000a, + 0xf76: 0x000a, 0xf77: 0x000a, 0xf78: 0x000a, 0xf79: 0x000a, + // Block 0x3e, offset 0xf80 + 0xf80: 0x000a, 0xf81: 0x000a, 0xf82: 0x000a, 0xf83: 0x000a, 0xf84: 0x000a, 0xf85: 0x000a, + 0xf86: 0x000a, 0xf87: 0x000a, 0xf88: 0x000a, 0xf89: 0x000a, 0xf8a: 0x000a, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000b, + // Block 0x3f, offset 0xfc0 + 0xfc5: 0x000c, + 0xfc6: 0x000c, + 0xfe9: 0x000c, + // Block 0x40, offset 0x1000 + 0x1020: 0x000c, 0x1021: 0x000c, 0x1022: 0x000c, + 0x1027: 0x000c, 0x1028: 0x000c, + 0x1032: 0x000c, + 0x1039: 0x000c, 0x103a: 0x000c, 0x103b: 0x000c, + // Block 0x41, offset 0x1040 + 0x1040: 0x000a, 0x1044: 0x000a, 0x1045: 0x000a, + // Block 0x42, offset 0x1080 + 0x109e: 0x000a, 0x109f: 0x000a, 0x10a0: 0x000a, 0x10a1: 0x000a, 0x10a2: 0x000a, 0x10a3: 0x000a, + 0x10a4: 0x000a, 0x10a5: 0x000a, 0x10a6: 0x000a, 0x10a7: 0x000a, 0x10a8: 0x000a, 0x10a9: 0x000a, + 0x10aa: 0x000a, 0x10ab: 0x000a, 0x10ac: 0x000a, 0x10ad: 0x000a, 0x10ae: 0x000a, 0x10af: 0x000a, + 0x10b0: 0x000a, 0x10b1: 0x000a, 0x10b2: 0x000a, 0x10b3: 0x000a, 0x10b4: 0x000a, 0x10b5: 0x000a, + 0x10b6: 0x000a, 0x10b7: 0x000a, 0x10b8: 0x000a, 0x10b9: 0x000a, 0x10ba: 0x000a, 0x10bb: 0x000a, + 0x10bc: 0x000a, 0x10bd: 0x000a, 0x10be: 0x000a, 0x10bf: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10d7: 0x000c, + 0x10d8: 0x000c, 0x10db: 0x000c, + // Block 0x44, offset 0x1100 + 0x1116: 0x000c, + 0x1118: 0x000c, 0x1119: 0x000c, 0x111a: 0x000c, 0x111b: 0x000c, 0x111c: 0x000c, 0x111d: 0x000c, + 0x111e: 0x000c, 0x1120: 0x000c, 0x1122: 0x000c, + 0x1125: 0x000c, 0x1126: 0x000c, 0x1127: 0x000c, 0x1128: 0x000c, 0x1129: 0x000c, + 0x112a: 0x000c, 0x112b: 0x000c, 0x112c: 0x000c, + 0x1133: 0x000c, 0x1134: 0x000c, 0x1135: 0x000c, + 0x1136: 0x000c, 0x1137: 0x000c, 0x1138: 0x000c, 0x1139: 0x000c, 0x113a: 0x000c, 0x113b: 0x000c, + 0x113c: 0x000c, 0x113f: 0x000c, + // Block 0x45, offset 0x1140 + 0x1170: 0x000c, 0x1171: 0x000c, 0x1172: 0x000c, 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117d: 0x000c, 0x117e: 0x000c, + // Block 0x46, offset 0x1180 + 0x1180: 0x000c, 0x1181: 0x000c, 0x1182: 0x000c, 0x1183: 0x000c, + 0x11b4: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, + 0x11bc: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c2: 0x000c, + 0x11eb: 0x000c, 0x11ec: 0x000c, 0x11ed: 0x000c, 0x11ee: 0x000c, 0x11ef: 0x000c, + 0x11f0: 0x000c, 0x11f1: 0x000c, 0x11f2: 0x000c, 0x11f3: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, + 0x1222: 0x000c, 0x1223: 0x000c, + 0x1224: 0x000c, 0x1225: 0x000c, 0x1228: 0x000c, 0x1229: 0x000c, + 0x122b: 0x000c, 0x122c: 0x000c, 0x122d: 0x000c, + // Block 0x49, offset 0x1240 + 0x1266: 0x000c, 0x1268: 0x000c, 0x1269: 0x000c, + 0x126d: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, + // Block 0x4a, offset 0x1280 + 0x12ac: 0x000c, 0x12ad: 0x000c, 0x12ae: 0x000c, 0x12af: 0x000c, + 0x12b0: 0x000c, 0x12b1: 0x000c, 0x12b2: 0x000c, 0x12b3: 0x000c, + 0x12b6: 0x000c, 0x12b7: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12d0: 0x000c, 0x12d1: 0x000c, + 0x12d2: 0x000c, 0x12d4: 0x000c, 0x12d5: 0x000c, 0x12d6: 0x000c, 0x12d7: 0x000c, + 0x12d8: 0x000c, 0x12d9: 0x000c, 0x12da: 0x000c, 0x12db: 0x000c, 0x12dc: 0x000c, 0x12dd: 0x000c, + 0x12de: 0x000c, 0x12df: 0x000c, 0x12e0: 0x000c, 0x12e2: 0x000c, 0x12e3: 0x000c, + 0x12e4: 0x000c, 0x12e5: 0x000c, 0x12e6: 0x000c, 0x12e7: 0x000c, 0x12e8: 0x000c, + 0x12ed: 0x000c, + 0x12f4: 0x000c, + 0x12f8: 0x000c, 0x12f9: 0x000c, + // Block 0x4c, offset 0x1300 + 0x1300: 0x000c, 0x1301: 0x000c, 0x1302: 0x000c, 0x1303: 0x000c, 0x1304: 0x000c, 0x1305: 0x000c, + 0x1306: 0x000c, 0x1307: 0x000c, 0x1308: 0x000c, 0x1309: 0x000c, 0x130a: 0x000c, 0x130b: 0x000c, + 0x130c: 0x000c, 0x130d: 0x000c, 0x130e: 0x000c, 0x130f: 0x000c, 0x1310: 0x000c, 0x1311: 0x000c, + 0x1312: 0x000c, 0x1313: 0x000c, 0x1314: 0x000c, 0x1315: 0x000c, 0x1316: 0x000c, 0x1317: 0x000c, + 0x1318: 0x000c, 0x1319: 0x000c, 0x131a: 0x000c, 0x131b: 0x000c, 0x131c: 0x000c, 0x131d: 0x000c, + 0x131e: 0x000c, 0x131f: 0x000c, 0x1320: 0x000c, 0x1321: 0x000c, 0x1322: 0x000c, 0x1323: 0x000c, + 0x1324: 0x000c, 0x1325: 0x000c, 0x1326: 0x000c, 0x1327: 0x000c, 0x1328: 0x000c, 0x1329: 0x000c, + 0x132a: 0x000c, 0x132b: 0x000c, 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, 0x1334: 0x000c, 0x1335: 0x000c, + 0x1336: 0x000c, 0x1337: 0x000c, 0x1338: 0x000c, 0x1339: 0x000c, 0x133b: 0x000c, + 0x133c: 0x000c, 0x133d: 0x000c, 0x133e: 0x000c, 0x133f: 0x000c, + // Block 0x4d, offset 0x1340 + 0x137d: 0x000a, 0x137f: 0x000a, + // Block 0x4e, offset 0x1380 + 0x1380: 0x000a, 0x1381: 0x000a, + 0x138d: 0x000a, 0x138e: 0x000a, 0x138f: 0x000a, + 0x139d: 0x000a, + 0x139e: 0x000a, 0x139f: 0x000a, + 0x13ad: 0x000a, 0x13ae: 0x000a, 0x13af: 0x000a, + 0x13bd: 0x000a, 0x13be: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0009, 0x13c1: 0x0009, 0x13c2: 0x0009, 0x13c3: 0x0009, 0x13c4: 0x0009, 0x13c5: 0x0009, + 0x13c6: 0x0009, 0x13c7: 0x0009, 0x13c8: 0x0009, 0x13c9: 0x0009, 0x13ca: 0x0009, 0x13cb: 0x000b, + 0x13cc: 0x000b, 0x13cd: 0x000b, 0x13cf: 0x0001, 0x13d0: 0x000a, 0x13d1: 0x000a, + 0x13d2: 0x000a, 0x13d3: 0x000a, 0x13d4: 0x000a, 0x13d5: 0x000a, 0x13d6: 0x000a, 0x13d7: 0x000a, + 0x13d8: 0x000a, 0x13d9: 0x000a, 0x13da: 0x000a, 0x13db: 0x000a, 0x13dc: 0x000a, 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, 0x13e0: 0x000a, 0x13e1: 0x000a, 0x13e2: 0x000a, 0x13e3: 0x000a, + 0x13e4: 0x000a, 0x13e5: 0x000a, 0x13e6: 0x000a, 0x13e7: 0x000a, 0x13e8: 0x0009, 0x13e9: 0x0007, + 0x13ea: 0x000e, 0x13eb: 0x000e, 0x13ec: 0x000e, 0x13ed: 0x000e, 0x13ee: 0x000e, 0x13ef: 0x0006, + 0x13f0: 0x0004, 0x13f1: 0x0004, 0x13f2: 0x0004, 0x13f3: 0x0004, 0x13f4: 0x0004, 0x13f5: 0x000a, + 0x13f6: 0x000a, 0x13f7: 0x000a, 0x13f8: 0x000a, 0x13f9: 0x000a, 0x13fa: 0x000a, 0x13fb: 0x000a, + 0x13fc: 0x000a, 0x13fd: 0x000a, 0x13fe: 0x000a, 0x13ff: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x000a, 0x1401: 0x000a, 0x1402: 0x000a, 0x1403: 0x000a, 0x1404: 0x0006, 0x1405: 0x009a, + 0x1406: 0x008a, 0x1407: 0x000a, 0x1408: 0x000a, 0x1409: 0x000a, 0x140a: 0x000a, 0x140b: 0x000a, + 0x140c: 0x000a, 0x140d: 0x000a, 0x140e: 0x000a, 0x140f: 0x000a, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x0009, 0x1420: 0x000b, 0x1421: 0x000b, 0x1422: 0x000b, 0x1423: 0x000b, + 0x1424: 0x000b, 0x1425: 0x000b, 0x1426: 0x000e, 0x1427: 0x000e, 0x1428: 0x000e, 0x1429: 0x000e, + 0x142a: 0x000b, 0x142b: 0x000b, 0x142c: 0x000b, 0x142d: 0x000b, 0x142e: 0x000b, 0x142f: 0x000b, + 0x1430: 0x0002, 0x1434: 0x0002, 0x1435: 0x0002, + 0x1436: 0x0002, 0x1437: 0x0002, 0x1438: 0x0002, 0x1439: 0x0002, 0x143a: 0x0003, 0x143b: 0x0003, + 0x143c: 0x000a, 0x143d: 0x009a, 0x143e: 0x008a, + // Block 0x51, offset 0x1440 + 0x1440: 0x0002, 0x1441: 0x0002, 0x1442: 0x0002, 0x1443: 0x0002, 0x1444: 0x0002, 0x1445: 0x0002, + 0x1446: 0x0002, 0x1447: 0x0002, 0x1448: 0x0002, 0x1449: 0x0002, 0x144a: 0x0003, 0x144b: 0x0003, + 0x144c: 0x000a, 0x144d: 0x009a, 0x144e: 0x008a, + 0x1460: 0x0004, 0x1461: 0x0004, 0x1462: 0x0004, 0x1463: 0x0004, + 0x1464: 0x0004, 0x1465: 0x0004, 0x1466: 0x0004, 0x1467: 0x0004, 0x1468: 0x0004, 0x1469: 0x0004, + 0x146a: 0x0004, 0x146b: 0x0004, 0x146c: 0x0004, 0x146d: 0x0004, 0x146e: 0x0004, 0x146f: 0x0004, + 0x1470: 0x0004, 0x1471: 0x0004, 0x1472: 0x0004, 0x1473: 0x0004, 0x1474: 0x0004, 0x1475: 0x0004, + 0x1476: 0x0004, 0x1477: 0x0004, 0x1478: 0x0004, 0x1479: 0x0004, 0x147a: 0x0004, 0x147b: 0x0004, + 0x147c: 0x0004, 0x147d: 0x0004, 0x147e: 0x0004, 0x147f: 0x0004, + // Block 0x52, offset 0x1480 + 0x1480: 0x0004, 0x1481: 0x0004, 0x1482: 0x0004, 0x1483: 0x0004, 0x1484: 0x0004, 0x1485: 0x0004, + 0x1486: 0x0004, 0x1487: 0x0004, 0x1488: 0x0004, 0x1489: 0x0004, 0x148a: 0x0004, 0x148b: 0x0004, + 0x148c: 0x0004, 0x148d: 0x0004, 0x148e: 0x0004, 0x148f: 0x0004, 0x1490: 0x000c, 0x1491: 0x000c, + 0x1492: 0x000c, 0x1493: 0x000c, 0x1494: 0x000c, 0x1495: 0x000c, 0x1496: 0x000c, 0x1497: 0x000c, + 0x1498: 0x000c, 0x1499: 0x000c, 0x149a: 0x000c, 0x149b: 0x000c, 0x149c: 0x000c, 0x149d: 0x000c, + 0x149e: 0x000c, 0x149f: 0x000c, 0x14a0: 0x000c, 0x14a1: 0x000c, 0x14a2: 0x000c, 0x14a3: 0x000c, + 0x14a4: 0x000c, 0x14a5: 0x000c, 0x14a6: 0x000c, 0x14a7: 0x000c, 0x14a8: 0x000c, 0x14a9: 0x000c, + 0x14aa: 0x000c, 0x14ab: 0x000c, 0x14ac: 0x000c, 0x14ad: 0x000c, 0x14ae: 0x000c, 0x14af: 0x000c, + 0x14b0: 0x000c, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x000a, 0x14c1: 0x000a, 0x14c3: 0x000a, 0x14c4: 0x000a, 0x14c5: 0x000a, + 0x14c6: 0x000a, 0x14c8: 0x000a, 0x14c9: 0x000a, + 0x14d4: 0x000a, 0x14d6: 0x000a, 0x14d7: 0x000a, + 0x14d8: 0x000a, + 0x14de: 0x000a, 0x14df: 0x000a, 0x14e0: 0x000a, 0x14e1: 0x000a, 0x14e2: 0x000a, 0x14e3: 0x000a, + 0x14e5: 0x000a, 0x14e7: 0x000a, 0x14e9: 0x000a, + 0x14ee: 0x0004, + 0x14fa: 0x000a, 0x14fb: 0x000a, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1502: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, + 0x150a: 0x000a, 0x150b: 0x000a, + 0x150c: 0x000a, 0x150d: 0x000a, 0x1510: 0x000a, 0x1511: 0x000a, + 0x1512: 0x000a, 0x1513: 0x000a, 0x1514: 0x000a, 0x1515: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, 0x1519: 0x000a, 0x151a: 0x000a, 0x151b: 0x000a, 0x151c: 0x000a, 0x151d: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, + // Block 0x55, offset 0x1540 + 0x1549: 0x000a, 0x154a: 0x000a, 0x154b: 0x000a, + 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, 0x1560: 0x000a, 0x1561: 0x000a, 0x1562: 0x000a, 0x1563: 0x000a, + 0x1564: 0x000a, 0x1565: 0x000a, 0x1566: 0x000a, 0x1567: 0x000a, 0x1568: 0x000a, 0x1569: 0x000a, + 0x156a: 0x000a, 0x156b: 0x000a, 0x156c: 0x000a, 0x156d: 0x000a, 0x156e: 0x000a, 0x156f: 0x000a, + 0x1570: 0x000a, 0x1571: 0x000a, 0x1572: 0x000a, 0x1573: 0x000a, 0x1574: 0x000a, 0x1575: 0x000a, + 0x1576: 0x000a, 0x1577: 0x000a, 0x1578: 0x000a, 0x1579: 0x000a, 0x157a: 0x000a, 0x157b: 0x000a, + 0x157c: 0x000a, 0x157d: 0x000a, 0x157e: 0x000a, 0x157f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1580: 0x000a, 0x1581: 0x000a, 0x1582: 0x000a, 0x1583: 0x000a, 0x1584: 0x000a, 0x1585: 0x000a, + 0x1586: 0x000a, 0x1587: 0x000a, 0x1588: 0x000a, 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x158c: 0x000a, 0x158d: 0x000a, 0x158e: 0x000a, 0x158f: 0x000a, 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x0003, 0x15d3: 0x0004, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x003a, 0x1609: 0x002a, 0x160a: 0x003a, 0x160b: 0x002a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x000a, 0x1613: 0x000a, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x009a, + 0x162a: 0x008a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + // Block 0x59, offset 0x1640 + 0x167b: 0x000a, + 0x167c: 0x000a, 0x167d: 0x000a, 0x167e: 0x000a, 0x167f: 0x000a, + // Block 0x5a, offset 0x1680 + 0x1680: 0x000a, 0x1681: 0x000a, 0x1682: 0x000a, 0x1683: 0x000a, 0x1684: 0x000a, 0x1685: 0x000a, + 0x1686: 0x000a, 0x1687: 0x000a, 0x1688: 0x000a, 0x1689: 0x000a, 0x168a: 0x000a, 0x168b: 0x000a, + 0x168c: 0x000a, 0x168d: 0x000a, 0x168e: 0x000a, 0x168f: 0x000a, 0x1690: 0x000a, 0x1691: 0x000a, + 0x1692: 0x000a, 0x1693: 0x000a, 0x1694: 0x000a, 0x1696: 0x000a, 0x1697: 0x000a, + 0x1698: 0x000a, 0x1699: 0x000a, 0x169a: 0x000a, 0x169b: 0x000a, 0x169c: 0x000a, 0x169d: 0x000a, + 0x169e: 0x000a, 0x169f: 0x000a, 0x16a0: 0x000a, 0x16a1: 0x000a, 0x16a2: 0x000a, 0x16a3: 0x000a, + 0x16a4: 0x000a, 0x16a5: 0x000a, 0x16a6: 0x000a, 0x16a7: 0x000a, 0x16a8: 0x000a, 0x16a9: 0x000a, + 0x16aa: 0x000a, 0x16ab: 0x000a, 0x16ac: 0x000a, 0x16ad: 0x000a, 0x16ae: 0x000a, 0x16af: 0x000a, + 0x16b0: 0x000a, 0x16b1: 0x000a, 0x16b2: 0x000a, 0x16b3: 0x000a, 0x16b4: 0x000a, 0x16b5: 0x000a, + 0x16b6: 0x000a, 0x16b7: 0x000a, 0x16b8: 0x000a, 0x16b9: 0x000a, 0x16ba: 0x000a, 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d5: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, + 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, 0x1727: 0x000a, 0x1728: 0x000a, 0x1729: 0x000a, + 0x172a: 0x000a, 0x172b: 0x000a, 0x172c: 0x000a, 0x172d: 0x000a, 0x172e: 0x000a, 0x172f: 0x000a, + 0x1730: 0x000a, 0x1731: 0x000a, 0x1732: 0x000a, 0x1733: 0x000a, 0x1734: 0x000a, 0x1735: 0x000a, + 0x1736: 0x000a, 0x1737: 0x000a, 0x1738: 0x000a, 0x1739: 0x000a, 0x173a: 0x000a, 0x173b: 0x000a, + 0x173c: 0x000a, 0x173d: 0x000a, 0x173e: 0x000a, 0x173f: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x0002, 0x1749: 0x0002, 0x174a: 0x0002, 0x174b: 0x0002, + 0x174c: 0x0002, 0x174d: 0x0002, 0x174e: 0x0002, 0x174f: 0x0002, 0x1750: 0x0002, 0x1751: 0x0002, + 0x1752: 0x0002, 0x1753: 0x0002, 0x1754: 0x0002, 0x1755: 0x0002, 0x1756: 0x0002, 0x1757: 0x0002, + 0x1758: 0x0002, 0x1759: 0x0002, 0x175a: 0x0002, 0x175b: 0x0002, + // Block 0x5e, offset 0x1780 + 0x17aa: 0x000a, 0x17ab: 0x000a, 0x17ac: 0x000a, 0x17ad: 0x000a, 0x17ae: 0x000a, 0x17af: 0x000a, + 0x17b0: 0x000a, 0x17b1: 0x000a, 0x17b2: 0x000a, 0x17b3: 0x000a, 0x17b4: 0x000a, 0x17b5: 0x000a, + 0x17b6: 0x000a, 0x17b7: 0x000a, 0x17b8: 0x000a, 0x17b9: 0x000a, 0x17ba: 0x000a, 0x17bb: 0x000a, + 0x17bc: 0x000a, 0x17bd: 0x000a, 0x17be: 0x000a, 0x17bf: 0x000a, + // Block 0x5f, offset 0x17c0 + 0x17c0: 0x000a, 0x17c1: 0x000a, 0x17c2: 0x000a, 0x17c3: 0x000a, 0x17c4: 0x000a, 0x17c5: 0x000a, + 0x17c6: 0x000a, 0x17c7: 0x000a, 0x17c8: 0x000a, 0x17c9: 0x000a, 0x17ca: 0x000a, 0x17cb: 0x000a, + 0x17cc: 0x000a, 0x17cd: 0x000a, 0x17ce: 0x000a, 0x17cf: 0x000a, 0x17d0: 0x000a, 0x17d1: 0x000a, + 0x17d2: 0x000a, 0x17d3: 0x000a, 0x17d4: 0x000a, 0x17d5: 0x000a, 0x17d6: 0x000a, 0x17d7: 0x000a, + 0x17d8: 0x000a, 0x17d9: 0x000a, 0x17da: 0x000a, 0x17db: 0x000a, 0x17dc: 0x000a, 0x17dd: 0x000a, + 0x17de: 0x000a, 0x17df: 0x000a, 0x17e0: 0x000a, 0x17e1: 0x000a, 0x17e2: 0x000a, 0x17e3: 0x000a, + 0x17e4: 0x000a, 0x17e5: 0x000a, 0x17e6: 0x000a, 0x17e7: 0x000a, 0x17e8: 0x000a, 0x17e9: 0x000a, + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x003a, 0x1829: 0x002a, + 0x182a: 0x003a, 0x182b: 0x002a, 0x182c: 0x003a, 0x182d: 0x002a, 0x182e: 0x003a, 0x182f: 0x002a, + 0x1830: 0x003a, 0x1831: 0x002a, 0x1832: 0x003a, 0x1833: 0x002a, 0x1834: 0x003a, 0x1835: 0x002a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x009a, + 0x1846: 0x008a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x003a, 0x1867: 0x002a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x000a, 0x1871: 0x000a, 0x1872: 0x000a, 0x1873: 0x000a, 0x1874: 0x000a, 0x1875: 0x000a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x007a, 0x1884: 0x006a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x00ba, 0x1888: 0x00aa, 0x1889: 0x009a, 0x188a: 0x008a, 0x188b: 0x007a, + 0x188c: 0x006a, 0x188d: 0x00da, 0x188e: 0x002a, 0x188f: 0x003a, 0x1890: 0x00ca, 0x1891: 0x009a, + 0x1892: 0x008a, 0x1893: 0x007a, 0x1894: 0x006a, 0x1895: 0x009a, 0x1896: 0x008a, 0x1897: 0x00ba, + 0x1898: 0x00aa, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x000a, 0x18a7: 0x000a, 0x18a8: 0x000a, 0x18a9: 0x000a, + 0x18aa: 0x000a, 0x18ab: 0x000a, 0x18ac: 0x000a, 0x18ad: 0x000a, 0x18ae: 0x000a, 0x18af: 0x000a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x000a, 0x18c4: 0x000a, 0x18c5: 0x000a, + 0x18c6: 0x000a, 0x18c7: 0x000a, 0x18c8: 0x000a, 0x18c9: 0x000a, 0x18ca: 0x000a, 0x18cb: 0x000a, + 0x18cc: 0x000a, 0x18cd: 0x000a, 0x18ce: 0x000a, 0x18cf: 0x000a, 0x18d0: 0x000a, 0x18d1: 0x000a, + 0x18d2: 0x000a, 0x18d3: 0x000a, 0x18d4: 0x000a, 0x18d5: 0x000a, 0x18d6: 0x000a, 0x18d7: 0x000a, + 0x18d8: 0x003a, 0x18d9: 0x002a, 0x18da: 0x003a, 0x18db: 0x002a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x003a, 0x18fd: 0x002a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x000a, 0x1919: 0x000a, 0x191a: 0x000a, 0x191b: 0x000a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x000a, 0x193d: 0x000a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, 0x1974: 0x000a, 0x1975: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a, + 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, 0x1996: 0x000a, 0x1997: 0x000a, + 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a, + 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a, + 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a, + 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a, + 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, 0x19ba: 0x000a, 0x19bb: 0x000a, + 0x19bc: 0x000a, 0x19bd: 0x000a, 0x19be: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19e5: 0x000a, 0x19e6: 0x000a, 0x19e7: 0x000a, 0x19e8: 0x000a, 0x19e9: 0x000a, + 0x19ea: 0x000a, 0x19ef: 0x000c, + 0x19f0: 0x000c, 0x19f1: 0x000c, + 0x19f9: 0x000a, 0x19fa: 0x000a, 0x19fb: 0x000a, + 0x19fc: 0x000a, 0x19fd: 0x000a, 0x19fe: 0x000a, 0x19ff: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a3f: 0x000c, + // Block 0x69, offset 0x1a40 + 0x1a60: 0x000c, 0x1a61: 0x000c, 0x1a62: 0x000c, 0x1a63: 0x000c, + 0x1a64: 0x000c, 0x1a65: 0x000c, 0x1a66: 0x000c, 0x1a67: 0x000c, 0x1a68: 0x000c, 0x1a69: 0x000c, + 0x1a6a: 0x000c, 0x1a6b: 0x000c, 0x1a6c: 0x000c, 0x1a6d: 0x000c, 0x1a6e: 0x000c, 0x1a6f: 0x000c, + 0x1a70: 0x000c, 0x1a71: 0x000c, 0x1a72: 0x000c, 0x1a73: 0x000c, 0x1a74: 0x000c, 0x1a75: 0x000c, + 0x1a76: 0x000c, 0x1a77: 0x000c, 0x1a78: 0x000c, 0x1a79: 0x000c, 0x1a7a: 0x000c, 0x1a7b: 0x000c, + 0x1a7c: 0x000c, 0x1a7d: 0x000c, 0x1a7e: 0x000c, 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1a80: 0x000a, 0x1a81: 0x000a, 0x1a82: 0x000a, 0x1a83: 0x000a, 0x1a84: 0x000a, 0x1a85: 0x000a, + 0x1a86: 0x000a, 0x1a87: 0x000a, 0x1a88: 0x000a, 0x1a89: 0x000a, 0x1a8a: 0x000a, 0x1a8b: 0x000a, + 0x1a8c: 0x000a, 0x1a8d: 0x000a, 0x1a8e: 0x000a, 0x1a8f: 0x000a, 0x1a90: 0x000a, 0x1a91: 0x000a, + 0x1a92: 0x000a, 0x1a93: 0x000a, 0x1a94: 0x000a, 0x1a95: 0x000a, 0x1a96: 0x000a, 0x1a97: 0x000a, + 0x1a98: 0x000a, 0x1a99: 0x000a, 0x1a9a: 0x000a, 0x1a9b: 0x000a, 0x1a9c: 0x000a, 0x1a9d: 0x000a, + 0x1a9e: 0x000a, 0x1a9f: 0x000a, 0x1aa0: 0x000a, 0x1aa1: 0x000a, 0x1aa2: 0x003a, 0x1aa3: 0x002a, + 0x1aa4: 0x003a, 0x1aa5: 0x002a, 0x1aa6: 0x003a, 0x1aa7: 0x002a, 0x1aa8: 0x003a, 0x1aa9: 0x002a, + 0x1aaa: 0x000a, 0x1aab: 0x000a, 0x1aac: 0x000a, 0x1aad: 0x000a, 0x1aae: 0x000a, 0x1aaf: 0x000a, + 0x1ab0: 0x000a, 0x1ab1: 0x000a, 0x1ab2: 0x000a, 0x1ab3: 0x000a, 0x1ab4: 0x000a, 0x1ab5: 0x000a, + 0x1ab6: 0x000a, 0x1ab7: 0x000a, 0x1ab8: 0x000a, 0x1ab9: 0x000a, 0x1aba: 0x000a, 0x1abb: 0x000a, + 0x1abc: 0x000a, 0x1abd: 0x000a, 0x1abe: 0x000a, 0x1abf: 0x000a, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a, + 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, 0x1b05: 0x000a, + 0x1b06: 0x000a, 0x1b07: 0x000a, 0x1b08: 0x000a, 0x1b09: 0x000a, 0x1b0a: 0x000a, 0x1b0b: 0x000a, + 0x1b0c: 0x000a, 0x1b0d: 0x000a, 0x1b0e: 0x000a, 0x1b0f: 0x000a, 0x1b10: 0x000a, 0x1b11: 0x000a, + 0x1b12: 0x000a, 0x1b13: 0x000a, 0x1b14: 0x000a, 0x1b15: 0x000a, 0x1b16: 0x000a, 0x1b17: 0x000a, + 0x1b18: 0x000a, 0x1b19: 0x000a, 0x1b1b: 0x000a, 0x1b1c: 0x000a, 0x1b1d: 0x000a, + 0x1b1e: 0x000a, 0x1b1f: 0x000a, 0x1b20: 0x000a, 0x1b21: 0x000a, 0x1b22: 0x000a, 0x1b23: 0x000a, + 0x1b24: 0x000a, 0x1b25: 0x000a, 0x1b26: 0x000a, 0x1b27: 0x000a, 0x1b28: 0x000a, 0x1b29: 0x000a, + 0x1b2a: 0x000a, 0x1b2b: 0x000a, 0x1b2c: 0x000a, 0x1b2d: 0x000a, 0x1b2e: 0x000a, 0x1b2f: 0x000a, + 0x1b30: 0x000a, 0x1b31: 0x000a, 0x1b32: 0x000a, 0x1b33: 0x000a, 0x1b34: 0x000a, 0x1b35: 0x000a, + 0x1b36: 0x000a, 0x1b37: 0x000a, 0x1b38: 0x000a, 0x1b39: 0x000a, 0x1b3a: 0x000a, 0x1b3b: 0x000a, + 0x1b3c: 0x000a, 0x1b3d: 0x000a, 0x1b3e: 0x000a, 0x1b3f: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5a: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, 0x1bb4: 0x000a, 0x1bb5: 0x000a, + 0x1bb6: 0x000a, 0x1bb7: 0x000a, 0x1bb8: 0x000a, 0x1bb9: 0x000a, 0x1bba: 0x000a, 0x1bbb: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x0009, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, + 0x1bc8: 0x003a, 0x1bc9: 0x002a, 0x1bca: 0x003a, 0x1bcb: 0x002a, + 0x1bcc: 0x003a, 0x1bcd: 0x002a, 0x1bce: 0x003a, 0x1bcf: 0x002a, 0x1bd0: 0x003a, 0x1bd1: 0x002a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x003a, 0x1bd5: 0x002a, 0x1bd6: 0x003a, 0x1bd7: 0x002a, + 0x1bd8: 0x003a, 0x1bd9: 0x002a, 0x1bda: 0x003a, 0x1bdb: 0x002a, 0x1bdc: 0x000a, 0x1bdd: 0x000a, + 0x1bde: 0x000a, 0x1bdf: 0x000a, 0x1be0: 0x000a, + 0x1bea: 0x000c, 0x1beb: 0x000c, 0x1bec: 0x000c, 0x1bed: 0x000c, + 0x1bf0: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, + 0x1bfd: 0x000a, 0x1bfe: 0x000a, 0x1bff: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c19: 0x000c, 0x1c1a: 0x000c, 0x1c1b: 0x000a, 0x1c1c: 0x000a, + 0x1c20: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c7b: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1c80: 0x000a, 0x1c81: 0x000a, 0x1c82: 0x000a, 0x1c83: 0x000a, 0x1c84: 0x000a, 0x1c85: 0x000a, + 0x1c86: 0x000a, 0x1c87: 0x000a, 0x1c88: 0x000a, 0x1c89: 0x000a, 0x1c8a: 0x000a, 0x1c8b: 0x000a, + 0x1c8c: 0x000a, 0x1c8d: 0x000a, 0x1c8e: 0x000a, 0x1c8f: 0x000a, 0x1c90: 0x000a, 0x1c91: 0x000a, + 0x1c92: 0x000a, 0x1c93: 0x000a, 0x1c94: 0x000a, 0x1c95: 0x000a, 0x1c96: 0x000a, 0x1c97: 0x000a, + 0x1c98: 0x000a, 0x1c99: 0x000a, 0x1c9a: 0x000a, 0x1c9b: 0x000a, 0x1c9c: 0x000a, 0x1c9d: 0x000a, + 0x1c9e: 0x000a, 0x1c9f: 0x000a, 0x1ca0: 0x000a, 0x1ca1: 0x000a, 0x1ca2: 0x000a, 0x1ca3: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cdd: 0x000a, + 0x1cde: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d10: 0x000a, 0x1d11: 0x000a, + 0x1d12: 0x000a, 0x1d13: 0x000a, 0x1d14: 0x000a, 0x1d15: 0x000a, 0x1d16: 0x000a, 0x1d17: 0x000a, + 0x1d18: 0x000a, 0x1d19: 0x000a, 0x1d1a: 0x000a, 0x1d1b: 0x000a, 0x1d1c: 0x000a, 0x1d1d: 0x000a, + 0x1d1e: 0x000a, 0x1d1f: 0x000a, + 0x1d3c: 0x000a, 0x1d3d: 0x000a, 0x1d3e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d71: 0x000a, 0x1d72: 0x000a, 0x1d73: 0x000a, 0x1d74: 0x000a, 0x1d75: 0x000a, + 0x1d76: 0x000a, 0x1d77: 0x000a, 0x1d78: 0x000a, 0x1d79: 0x000a, 0x1d7a: 0x000a, 0x1d7b: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, 0x1d7f: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1d8c: 0x000a, 0x1d8d: 0x000a, 0x1d8e: 0x000a, 0x1d8f: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1df7: 0x000a, 0x1df8: 0x000a, 0x1df9: 0x000a, 0x1dfa: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e1e: 0x000a, 0x1e1f: 0x000a, + 0x1e3f: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e50: 0x000a, 0x1e51: 0x000a, + 0x1e52: 0x000a, 0x1e53: 0x000a, 0x1e54: 0x000a, 0x1e55: 0x000a, 0x1e56: 0x000a, 0x1e57: 0x000a, + 0x1e58: 0x000a, 0x1e59: 0x000a, 0x1e5a: 0x000a, 0x1e5b: 0x000a, 0x1e5c: 0x000a, 0x1e5d: 0x000a, + 0x1e5e: 0x000a, 0x1e5f: 0x000a, 0x1e60: 0x000a, 0x1e61: 0x000a, 0x1e62: 0x000a, 0x1e63: 0x000a, + 0x1e64: 0x000a, 0x1e65: 0x000a, 0x1e66: 0x000a, 0x1e67: 0x000a, 0x1e68: 0x000a, 0x1e69: 0x000a, + 0x1e6a: 0x000a, 0x1e6b: 0x000a, 0x1e6c: 0x000a, 0x1e6d: 0x000a, 0x1e6e: 0x000a, 0x1e6f: 0x000a, + 0x1e70: 0x000a, 0x1e71: 0x000a, 0x1e72: 0x000a, 0x1e73: 0x000a, 0x1e74: 0x000a, 0x1e75: 0x000a, + 0x1e76: 0x000a, 0x1e77: 0x000a, 0x1e78: 0x000a, 0x1e79: 0x000a, 0x1e7a: 0x000a, 0x1e7b: 0x000a, + 0x1e7c: 0x000a, 0x1e7d: 0x000a, 0x1e7e: 0x000a, 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e80: 0x000a, 0x1e81: 0x000a, 0x1e82: 0x000a, 0x1e83: 0x000a, 0x1e84: 0x000a, 0x1e85: 0x000a, + 0x1e86: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ecd: 0x000a, 0x1ece: 0x000a, 0x1ecf: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f2f: 0x000c, + 0x1f30: 0x000c, 0x1f31: 0x000c, 0x1f32: 0x000c, 0x1f33: 0x000a, 0x1f34: 0x000c, 0x1f35: 0x000c, + 0x1f36: 0x000c, 0x1f37: 0x000c, 0x1f38: 0x000c, 0x1f39: 0x000c, 0x1f3a: 0x000c, 0x1f3b: 0x000c, + 0x1f3c: 0x000c, 0x1f3d: 0x000c, 0x1f3e: 0x000a, 0x1f3f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f5e: 0x000c, 0x1f5f: 0x000c, + // Block 0x7e, offset 0x1f80 + 0x1fb0: 0x000c, 0x1fb1: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1fc0: 0x000a, 0x1fc1: 0x000a, 0x1fc2: 0x000a, 0x1fc3: 0x000a, 0x1fc4: 0x000a, 0x1fc5: 0x000a, + 0x1fc6: 0x000a, 0x1fc7: 0x000a, 0x1fc8: 0x000a, 0x1fc9: 0x000a, 0x1fca: 0x000a, 0x1fcb: 0x000a, + 0x1fcc: 0x000a, 0x1fcd: 0x000a, 0x1fce: 0x000a, 0x1fcf: 0x000a, 0x1fd0: 0x000a, 0x1fd1: 0x000a, + 0x1fd2: 0x000a, 0x1fd3: 0x000a, 0x1fd4: 0x000a, 0x1fd5: 0x000a, 0x1fd6: 0x000a, 0x1fd7: 0x000a, + 0x1fd8: 0x000a, 0x1fd9: 0x000a, 0x1fda: 0x000a, 0x1fdb: 0x000a, 0x1fdc: 0x000a, 0x1fdd: 0x000a, + 0x1fde: 0x000a, 0x1fdf: 0x000a, 0x1fe0: 0x000a, 0x1fe1: 0x000a, + // Block 0x80, offset 0x2000 + 0x2008: 0x000a, + // Block 0x81, offset 0x2040 + 0x2042: 0x000c, + 0x2046: 0x000c, 0x204b: 0x000c, + 0x2065: 0x000c, 0x2066: 0x000c, 0x2068: 0x000a, 0x2069: 0x000a, + 0x206a: 0x000a, 0x206b: 0x000a, + 0x2078: 0x0004, 0x2079: 0x0004, + // Block 0x82, offset 0x2080 + 0x20b4: 0x000a, 0x20b5: 0x000a, + 0x20b6: 0x000a, 0x20b7: 0x000a, + // Block 0x83, offset 0x20c0 + 0x20c4: 0x000c, 0x20c5: 0x000c, + 0x20e0: 0x000c, 0x20e1: 0x000c, 0x20e2: 0x000c, 0x20e3: 0x000c, + 0x20e4: 0x000c, 0x20e5: 0x000c, 0x20e6: 0x000c, 0x20e7: 0x000c, 0x20e8: 0x000c, 0x20e9: 0x000c, + 0x20ea: 0x000c, 0x20eb: 0x000c, 0x20ec: 0x000c, 0x20ed: 0x000c, 0x20ee: 0x000c, 0x20ef: 0x000c, + 0x20f0: 0x000c, 0x20f1: 0x000c, + 0x20ff: 0x000c, + // Block 0x84, offset 0x2100 + 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, + // Block 0x85, offset 0x2140 + 0x2147: 0x000c, 0x2148: 0x000c, 0x2149: 0x000c, 0x214a: 0x000c, 0x214b: 0x000c, + 0x214c: 0x000c, 0x214d: 0x000c, 0x214e: 0x000c, 0x214f: 0x000c, 0x2150: 0x000c, 0x2151: 0x000c, + // Block 0x86, offset 0x2180 + 0x2180: 0x000c, 0x2181: 0x000c, 0x2182: 0x000c, + 0x21b3: 0x000c, + 0x21b6: 0x000c, 0x21b7: 0x000c, 0x21b8: 0x000c, 0x21b9: 0x000c, + 0x21bc: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21e5: 0x000c, + // Block 0x88, offset 0x2200 + 0x2229: 0x000c, + 0x222a: 0x000c, 0x222b: 0x000c, 0x222c: 0x000c, 0x222d: 0x000c, 0x222e: 0x000c, + 0x2231: 0x000c, 0x2232: 0x000c, 0x2235: 0x000c, + 0x2236: 0x000c, + // Block 0x89, offset 0x2240 + 0x2243: 0x000c, + 0x224c: 0x000c, + 0x227c: 0x000c, + // Block 0x8a, offset 0x2280 + 0x22b0: 0x000c, 0x22b2: 0x000c, 0x22b3: 0x000c, 0x22b4: 0x000c, + 0x22b7: 0x000c, 0x22b8: 0x000c, + 0x22be: 0x000c, 0x22bf: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22c1: 0x000c, + 0x22ec: 0x000c, 0x22ed: 0x000c, + 0x22f6: 0x000c, + // Block 0x8c, offset 0x2300 + 0x2325: 0x000c, 0x2328: 0x000c, + 0x232d: 0x000c, + // Block 0x8d, offset 0x2340 + 0x235d: 0x0001, + 0x235e: 0x000c, 0x235f: 0x0001, 0x2360: 0x0001, 0x2361: 0x0001, 0x2362: 0x0001, 0x2363: 0x0001, + 0x2364: 0x0001, 0x2365: 0x0001, 0x2366: 0x0001, 0x2367: 0x0001, 0x2368: 0x0001, 0x2369: 0x0003, + 0x236a: 0x0001, 0x236b: 0x0001, 0x236c: 0x0001, 0x236d: 0x0001, 0x236e: 0x0001, 0x236f: 0x0001, + 0x2370: 0x0001, 0x2371: 0x0001, 0x2372: 0x0001, 0x2373: 0x0001, 0x2374: 0x0001, 0x2375: 0x0001, + 0x2376: 0x0001, 0x2377: 0x0001, 0x2378: 0x0001, 0x2379: 0x0001, 0x237a: 0x0001, 0x237b: 0x0001, + 0x237c: 0x0001, 0x237d: 0x0001, 0x237e: 0x0001, 0x237f: 0x0001, + // Block 0x8e, offset 0x2380 + 0x2380: 0x0001, 0x2381: 0x0001, 0x2382: 0x0001, 0x2383: 0x0001, 0x2384: 0x0001, 0x2385: 0x0001, + 0x2386: 0x0001, 0x2387: 0x0001, 0x2388: 0x0001, 0x2389: 0x0001, 0x238a: 0x0001, 0x238b: 0x0001, + 0x238c: 0x0001, 0x238d: 0x0001, 0x238e: 0x0001, 0x238f: 0x0001, 0x2390: 0x000d, 0x2391: 0x000d, + 0x2392: 0x000d, 0x2393: 0x000d, 0x2394: 0x000d, 0x2395: 0x000d, 0x2396: 0x000d, 0x2397: 0x000d, + 0x2398: 0x000d, 0x2399: 0x000d, 0x239a: 0x000d, 0x239b: 0x000d, 0x239c: 0x000d, 0x239d: 0x000d, + 0x239e: 0x000d, 0x239f: 0x000d, 0x23a0: 0x000d, 0x23a1: 0x000d, 0x23a2: 0x000d, 0x23a3: 0x000d, + 0x23a4: 0x000d, 0x23a5: 0x000d, 0x23a6: 0x000d, 0x23a7: 0x000d, 0x23a8: 0x000d, 0x23a9: 0x000d, + 0x23aa: 0x000d, 0x23ab: 0x000d, 0x23ac: 0x000d, 0x23ad: 0x000d, 0x23ae: 0x000d, 0x23af: 0x000d, + 0x23b0: 0x000d, 0x23b1: 0x000d, 0x23b2: 0x000d, 0x23b3: 0x000d, 0x23b4: 0x000d, 0x23b5: 0x000d, + 0x23b6: 0x000d, 0x23b7: 0x000d, 0x23b8: 0x000d, 0x23b9: 0x000d, 0x23ba: 0x000d, 0x23bb: 0x000d, + 0x23bc: 0x000d, 0x23bd: 0x000d, 0x23be: 0x000d, 0x23bf: 0x000d, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x000d, 0x23c1: 0x000d, 0x23c2: 0x000d, 0x23c3: 0x000d, 0x23c4: 0x000d, 0x23c5: 0x000d, + 0x23c6: 0x000d, 0x23c7: 0x000d, 0x23c8: 0x000d, 0x23c9: 0x000d, 0x23ca: 0x000d, 0x23cb: 0x000d, + 0x23cc: 0x000d, 0x23cd: 0x000d, 0x23ce: 0x000d, 0x23cf: 0x000d, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000a, 0x23ff: 0x000a, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000b, 0x2411: 0x000b, + 0x2412: 0x000b, 0x2413: 0x000b, 0x2414: 0x000b, 0x2415: 0x000b, 0x2416: 0x000b, 0x2417: 0x000b, + 0x2418: 0x000b, 0x2419: 0x000b, 0x241a: 0x000b, 0x241b: 0x000b, 0x241c: 0x000b, 0x241d: 0x000b, + 0x241e: 0x000b, 0x241f: 0x000b, 0x2420: 0x000b, 0x2421: 0x000b, 0x2422: 0x000b, 0x2423: 0x000b, + 0x2424: 0x000b, 0x2425: 0x000b, 0x2426: 0x000b, 0x2427: 0x000b, 0x2428: 0x000b, 0x2429: 0x000b, + 0x242a: 0x000b, 0x242b: 0x000b, 0x242c: 0x000b, 0x242d: 0x000b, 0x242e: 0x000b, 0x242f: 0x000b, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000a, 0x243e: 0x000d, 0x243f: 0x000d, + // Block 0x91, offset 0x2440 + 0x2440: 0x000c, 0x2441: 0x000c, 0x2442: 0x000c, 0x2443: 0x000c, 0x2444: 0x000c, 0x2445: 0x000c, + 0x2446: 0x000c, 0x2447: 0x000c, 0x2448: 0x000c, 0x2449: 0x000c, 0x244a: 0x000c, 0x244b: 0x000c, + 0x244c: 0x000c, 0x244d: 0x000c, 0x244e: 0x000c, 0x244f: 0x000c, 0x2450: 0x000a, 0x2451: 0x000a, + 0x2452: 0x000a, 0x2453: 0x000a, 0x2454: 0x000a, 0x2455: 0x000a, 0x2456: 0x000a, 0x2457: 0x000a, + 0x2458: 0x000a, 0x2459: 0x000a, + 0x2460: 0x000c, 0x2461: 0x000c, 0x2462: 0x000c, 0x2463: 0x000c, + 0x2464: 0x000c, 0x2465: 0x000c, 0x2466: 0x000c, 0x2467: 0x000c, 0x2468: 0x000c, 0x2469: 0x000c, + 0x246a: 0x000c, 0x246b: 0x000c, 0x246c: 0x000c, 0x246d: 0x000c, 0x246e: 0x000c, 0x246f: 0x000c, + 0x2470: 0x000a, 0x2471: 0x000a, 0x2472: 0x000a, 0x2473: 0x000a, 0x2474: 0x000a, 0x2475: 0x000a, + 0x2476: 0x000a, 0x2477: 0x000a, 0x2478: 0x000a, 0x2479: 0x000a, 0x247a: 0x000a, 0x247b: 0x000a, + 0x247c: 0x000a, 0x247d: 0x000a, 0x247e: 0x000a, 0x247f: 0x000a, + // Block 0x92, offset 0x2480 + 0x2480: 0x000a, 0x2481: 0x000a, 0x2482: 0x000a, 0x2483: 0x000a, 0x2484: 0x000a, 0x2485: 0x000a, + 0x2486: 0x000a, 0x2487: 0x000a, 0x2488: 0x000a, 0x2489: 0x000a, 0x248a: 0x000a, 0x248b: 0x000a, + 0x248c: 0x000a, 0x248d: 0x000a, 0x248e: 0x000a, 0x248f: 0x000a, 0x2490: 0x0006, 0x2491: 0x000a, + 0x2492: 0x0006, 0x2494: 0x000a, 0x2495: 0x0006, 0x2496: 0x000a, 0x2497: 0x000a, + 0x2498: 0x000a, 0x2499: 0x009a, 0x249a: 0x008a, 0x249b: 0x007a, 0x249c: 0x006a, 0x249d: 0x009a, + 0x249e: 0x008a, 0x249f: 0x0004, 0x24a0: 0x000a, 0x24a1: 0x000a, 0x24a2: 0x0003, 0x24a3: 0x0003, + 0x24a4: 0x000a, 0x24a5: 0x000a, 0x24a6: 0x000a, 0x24a8: 0x000a, 0x24a9: 0x0004, + 0x24aa: 0x0004, 0x24ab: 0x000a, + 0x24b0: 0x000d, 0x24b1: 0x000d, 0x24b2: 0x000d, 0x24b3: 0x000d, 0x24b4: 0x000d, 0x24b5: 0x000d, + 0x24b6: 0x000d, 0x24b7: 0x000d, 0x24b8: 0x000d, 0x24b9: 0x000d, 0x24ba: 0x000d, 0x24bb: 0x000d, + 0x24bc: 0x000d, 0x24bd: 0x000d, 0x24be: 0x000d, 0x24bf: 0x000d, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000d, 0x24c1: 0x000d, 0x24c2: 0x000d, 0x24c3: 0x000d, 0x24c4: 0x000d, 0x24c5: 0x000d, + 0x24c6: 0x000d, 0x24c7: 0x000d, 0x24c8: 0x000d, 0x24c9: 0x000d, 0x24ca: 0x000d, 0x24cb: 0x000d, + 0x24cc: 0x000d, 0x24cd: 0x000d, 0x24ce: 0x000d, 0x24cf: 0x000d, 0x24d0: 0x000d, 0x24d1: 0x000d, + 0x24d2: 0x000d, 0x24d3: 0x000d, 0x24d4: 0x000d, 0x24d5: 0x000d, 0x24d6: 0x000d, 0x24d7: 0x000d, + 0x24d8: 0x000d, 0x24d9: 0x000d, 0x24da: 0x000d, 0x24db: 0x000d, 0x24dc: 0x000d, 0x24dd: 0x000d, + 0x24de: 0x000d, 0x24df: 0x000d, 0x24e0: 0x000d, 0x24e1: 0x000d, 0x24e2: 0x000d, 0x24e3: 0x000d, + 0x24e4: 0x000d, 0x24e5: 0x000d, 0x24e6: 0x000d, 0x24e7: 0x000d, 0x24e8: 0x000d, 0x24e9: 0x000d, + 0x24ea: 0x000d, 0x24eb: 0x000d, 0x24ec: 0x000d, 0x24ed: 0x000d, 0x24ee: 0x000d, 0x24ef: 0x000d, + 0x24f0: 0x000d, 0x24f1: 0x000d, 0x24f2: 0x000d, 0x24f3: 0x000d, 0x24f4: 0x000d, 0x24f5: 0x000d, + 0x24f6: 0x000d, 0x24f7: 0x000d, 0x24f8: 0x000d, 0x24f9: 0x000d, 0x24fa: 0x000d, 0x24fb: 0x000d, + 0x24fc: 0x000d, 0x24fd: 0x000d, 0x24fe: 0x000d, 0x24ff: 0x000b, + // Block 0x94, offset 0x2500 + 0x2501: 0x000a, 0x2502: 0x000a, 0x2503: 0x0004, 0x2504: 0x0004, 0x2505: 0x0004, + 0x2506: 0x000a, 0x2507: 0x000a, 0x2508: 0x003a, 0x2509: 0x002a, 0x250a: 0x000a, 0x250b: 0x0003, + 0x250c: 0x0006, 0x250d: 0x0003, 0x250e: 0x0006, 0x250f: 0x0006, 0x2510: 0x0002, 0x2511: 0x0002, + 0x2512: 0x0002, 0x2513: 0x0002, 0x2514: 0x0002, 0x2515: 0x0002, 0x2516: 0x0002, 0x2517: 0x0002, + 0x2518: 0x0002, 0x2519: 0x0002, 0x251a: 0x0006, 0x251b: 0x000a, 0x251c: 0x000a, 0x251d: 0x000a, + 0x251e: 0x000a, 0x251f: 0x000a, 0x2520: 0x000a, + 0x253b: 0x005a, + 0x253c: 0x000a, 0x253d: 0x004a, 0x253e: 0x000a, 0x253f: 0x000a, + // Block 0x95, offset 0x2540 + 0x2540: 0x000a, + 0x255b: 0x005a, 0x255c: 0x000a, 0x255d: 0x004a, + 0x255e: 0x000a, 0x255f: 0x00fa, 0x2560: 0x00ea, 0x2561: 0x000a, 0x2562: 0x003a, 0x2563: 0x002a, + 0x2564: 0x000a, 0x2565: 0x000a, + // Block 0x96, offset 0x2580 + 0x25a0: 0x0004, 0x25a1: 0x0004, 0x25a2: 0x000a, 0x25a3: 0x000a, + 0x25a4: 0x000a, 0x25a5: 0x0004, 0x25a6: 0x0004, 0x25a8: 0x000a, 0x25a9: 0x000a, + 0x25aa: 0x000a, 0x25ab: 0x000a, 0x25ac: 0x000a, 0x25ad: 0x000a, 0x25ae: 0x000a, + 0x25b0: 0x000b, 0x25b1: 0x000b, 0x25b2: 0x000b, 0x25b3: 0x000b, 0x25b4: 0x000b, 0x25b5: 0x000b, + 0x25b6: 0x000b, 0x25b7: 0x000b, 0x25b8: 0x000b, 0x25b9: 0x000a, 0x25ba: 0x000a, 0x25bb: 0x000a, + 0x25bc: 0x000a, 0x25bd: 0x000a, 0x25be: 0x000b, 0x25bf: 0x000b, + // Block 0x97, offset 0x25c0 + 0x25c1: 0x000a, + // Block 0x98, offset 0x2600 + 0x2600: 0x000a, 0x2601: 0x000a, 0x2602: 0x000a, 0x2603: 0x000a, 0x2604: 0x000a, 0x2605: 0x000a, + 0x2606: 0x000a, 0x2607: 0x000a, 0x2608: 0x000a, 0x2609: 0x000a, 0x260a: 0x000a, 0x260b: 0x000a, + 0x260c: 0x000a, 0x2610: 0x000a, 0x2611: 0x000a, + 0x2612: 0x000a, 0x2613: 0x000a, 0x2614: 0x000a, 0x2615: 0x000a, 0x2616: 0x000a, 0x2617: 0x000a, + 0x2618: 0x000a, 0x2619: 0x000a, 0x261a: 0x000a, 0x261b: 0x000a, + 0x2620: 0x000a, + // Block 0x99, offset 0x2640 + 0x267d: 0x000c, + // Block 0x9a, offset 0x2680 + 0x26a0: 0x000c, 0x26a1: 0x0002, 0x26a2: 0x0002, 0x26a3: 0x0002, + 0x26a4: 0x0002, 0x26a5: 0x0002, 0x26a6: 0x0002, 0x26a7: 0x0002, 0x26a8: 0x0002, 0x26a9: 0x0002, + 0x26aa: 0x0002, 0x26ab: 0x0002, 0x26ac: 0x0002, 0x26ad: 0x0002, 0x26ae: 0x0002, 0x26af: 0x0002, + 0x26b0: 0x0002, 0x26b1: 0x0002, 0x26b2: 0x0002, 0x26b3: 0x0002, 0x26b4: 0x0002, 0x26b5: 0x0002, + 0x26b6: 0x0002, 0x26b7: 0x0002, 0x26b8: 0x0002, 0x26b9: 0x0002, 0x26ba: 0x0002, 0x26bb: 0x0002, + // Block 0x9b, offset 0x26c0 + 0x26f6: 0x000c, 0x26f7: 0x000c, 0x26f8: 0x000c, 0x26f9: 0x000c, 0x26fa: 0x000c, + // Block 0x9c, offset 0x2700 + 0x2700: 0x0001, 0x2701: 0x0001, 0x2702: 0x0001, 0x2703: 0x0001, 0x2704: 0x0001, 0x2705: 0x0001, + 0x2706: 0x0001, 0x2707: 0x0001, 0x2708: 0x0001, 0x2709: 0x0001, 0x270a: 0x0001, 0x270b: 0x0001, + 0x270c: 0x0001, 0x270d: 0x0001, 0x270e: 0x0001, 0x270f: 0x0001, 0x2710: 0x0001, 0x2711: 0x0001, + 0x2712: 0x0001, 0x2713: 0x0001, 0x2714: 0x0001, 0x2715: 0x0001, 0x2716: 0x0001, 0x2717: 0x0001, + 0x2718: 0x0001, 0x2719: 0x0001, 0x271a: 0x0001, 0x271b: 0x0001, 0x271c: 0x0001, 0x271d: 0x0001, + 0x271e: 0x0001, 0x271f: 0x0001, 0x2720: 0x0001, 0x2721: 0x0001, 0x2722: 0x0001, 0x2723: 0x0001, + 0x2724: 0x0001, 0x2725: 0x0001, 0x2726: 0x0001, 0x2727: 0x0001, 0x2728: 0x0001, 0x2729: 0x0001, + 0x272a: 0x0001, 0x272b: 0x0001, 0x272c: 0x0001, 0x272d: 0x0001, 0x272e: 0x0001, 0x272f: 0x0001, + 0x2730: 0x0001, 0x2731: 0x0001, 0x2732: 0x0001, 0x2733: 0x0001, 0x2734: 0x0001, 0x2735: 0x0001, + 0x2736: 0x0001, 0x2737: 0x0001, 0x2738: 0x0001, 0x2739: 0x0001, 0x273a: 0x0001, 0x273b: 0x0001, + 0x273c: 0x0001, 0x273d: 0x0001, 0x273e: 0x0001, 0x273f: 0x0001, + // Block 0x9d, offset 0x2740 + 0x2740: 0x0001, 0x2741: 0x0001, 0x2742: 0x0001, 0x2743: 0x0001, 0x2744: 0x0001, 0x2745: 0x0001, + 0x2746: 0x0001, 0x2747: 0x0001, 0x2748: 0x0001, 0x2749: 0x0001, 0x274a: 0x0001, 0x274b: 0x0001, + 0x274c: 0x0001, 0x274d: 0x0001, 0x274e: 0x0001, 0x274f: 0x0001, 0x2750: 0x0001, 0x2751: 0x0001, + 0x2752: 0x0001, 0x2753: 0x0001, 0x2754: 0x0001, 0x2755: 0x0001, 0x2756: 0x0001, 0x2757: 0x0001, + 0x2758: 0x0001, 0x2759: 0x0001, 0x275a: 0x0001, 0x275b: 0x0001, 0x275c: 0x0001, 0x275d: 0x0001, + 0x275e: 0x0001, 0x275f: 0x000a, 0x2760: 0x0001, 0x2761: 0x0001, 0x2762: 0x0001, 0x2763: 0x0001, + 0x2764: 0x0001, 0x2765: 0x0001, 0x2766: 0x0001, 0x2767: 0x0001, 0x2768: 0x0001, 0x2769: 0x0001, + 0x276a: 0x0001, 0x276b: 0x0001, 0x276c: 0x0001, 0x276d: 0x0001, 0x276e: 0x0001, 0x276f: 0x0001, + 0x2770: 0x0001, 0x2771: 0x0001, 0x2772: 0x0001, 0x2773: 0x0001, 0x2774: 0x0001, 0x2775: 0x0001, + 0x2776: 0x0001, 0x2777: 0x0001, 0x2778: 0x0001, 0x2779: 0x0001, 0x277a: 0x0001, 0x277b: 0x0001, + 0x277c: 0x0001, 0x277d: 0x0001, 0x277e: 0x0001, 0x277f: 0x0001, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x000c, 0x2782: 0x000c, 0x2783: 0x000c, 0x2784: 0x0001, 0x2785: 0x000c, + 0x2786: 0x000c, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x000c, 0x278d: 0x000c, 0x278e: 0x000c, 0x278f: 0x000c, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x0001, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x000c, 0x27b9: 0x000c, 0x27ba: 0x000c, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x000c, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x0001, 0x27c2: 0x0001, 0x27c3: 0x0001, 0x27c4: 0x0001, 0x27c5: 0x0001, + 0x27c6: 0x0001, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x0001, 0x27cd: 0x0001, 0x27ce: 0x0001, 0x27cf: 0x0001, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x0001, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x000c, 0x27e6: 0x000c, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x0001, 0x27f9: 0x0001, 0x27fa: 0x0001, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x0001, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x0001, 0x2802: 0x0001, 0x2803: 0x0001, 0x2804: 0x0001, 0x2805: 0x0001, + 0x2806: 0x0001, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x0001, 0x280d: 0x0001, 0x280e: 0x0001, 0x280f: 0x0001, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x0001, 0x2826: 0x0001, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x0001, 0x2839: 0x000a, 0x283a: 0x000a, 0x283b: 0x000a, + 0x283c: 0x000a, 0x283d: 0x000a, 0x283e: 0x000a, 0x283f: 0x000a, + // Block 0xa1, offset 0x2840 + 0x2840: 0x000d, 0x2841: 0x000d, 0x2842: 0x000d, 0x2843: 0x000d, 0x2844: 0x000d, 0x2845: 0x000d, + 0x2846: 0x000d, 0x2847: 0x000d, 0x2848: 0x000d, 0x2849: 0x000d, 0x284a: 0x000d, 0x284b: 0x000d, + 0x284c: 0x000d, 0x284d: 0x000d, 0x284e: 0x000d, 0x284f: 0x000d, 0x2850: 0x000d, 0x2851: 0x000d, + 0x2852: 0x000d, 0x2853: 0x000d, 0x2854: 0x000d, 0x2855: 0x000d, 0x2856: 0x000d, 0x2857: 0x000d, + 0x2858: 0x000d, 0x2859: 0x000d, 0x285a: 0x000d, 0x285b: 0x000d, 0x285c: 0x000d, 0x285d: 0x000d, + 0x285e: 0x000d, 0x285f: 0x000d, 0x2860: 0x000d, 0x2861: 0x000d, 0x2862: 0x000d, 0x2863: 0x000d, + 0x2864: 0x000c, 0x2865: 0x000c, 0x2866: 0x000c, 0x2867: 0x000c, 0x2868: 0x000d, 0x2869: 0x000d, + 0x286a: 0x000d, 0x286b: 0x000d, 0x286c: 0x000d, 0x286d: 0x000d, 0x286e: 0x000d, 0x286f: 0x000d, + 0x2870: 0x0005, 0x2871: 0x0005, 0x2872: 0x0005, 0x2873: 0x0005, 0x2874: 0x0005, 0x2875: 0x0005, + 0x2876: 0x0005, 0x2877: 0x0005, 0x2878: 0x0005, 0x2879: 0x0005, 0x287a: 0x000d, 0x287b: 0x000d, + 0x287c: 0x000d, 0x287d: 0x000d, 0x287e: 0x000d, 0x287f: 0x000d, + // Block 0xa2, offset 0x2880 + 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001, + 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001, + 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001, + 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001, + 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001, + 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0005, 0x28a1: 0x0005, 0x28a2: 0x0005, 0x28a3: 0x0005, + 0x28a4: 0x0005, 0x28a5: 0x0005, 0x28a6: 0x0005, 0x28a7: 0x0005, 0x28a8: 0x0005, 0x28a9: 0x0005, + 0x28aa: 0x0005, 0x28ab: 0x0005, 0x28ac: 0x0005, 0x28ad: 0x0005, 0x28ae: 0x0005, 0x28af: 0x0005, + 0x28b0: 0x0005, 0x28b1: 0x0005, 0x28b2: 0x0005, 0x28b3: 0x0005, 0x28b4: 0x0005, 0x28b5: 0x0005, + 0x28b6: 0x0005, 0x28b7: 0x0005, 0x28b8: 0x0005, 0x28b9: 0x0005, 0x28ba: 0x0005, 0x28bb: 0x0005, + 0x28bc: 0x0005, 0x28bd: 0x0005, 0x28be: 0x0005, 0x28bf: 0x0001, + // Block 0xa3, offset 0x28c0 + 0x28c0: 0x0001, 0x28c1: 0x0001, 0x28c2: 0x0001, 0x28c3: 0x0001, 0x28c4: 0x0001, 0x28c5: 0x0001, + 0x28c6: 0x0001, 0x28c7: 0x0001, 0x28c8: 0x0001, 0x28c9: 0x0001, 0x28ca: 0x0001, 0x28cb: 0x0001, + 0x28cc: 0x0001, 0x28cd: 0x0001, 0x28ce: 0x0001, 0x28cf: 0x0001, 0x28d0: 0x0001, 0x28d1: 0x0001, + 0x28d2: 0x0001, 0x28d3: 0x0001, 0x28d4: 0x0001, 0x28d5: 0x0001, 0x28d6: 0x0001, 0x28d7: 0x0001, + 0x28d8: 0x0001, 0x28d9: 0x0001, 0x28da: 0x0001, 0x28db: 0x0001, 0x28dc: 0x0001, 0x28dd: 0x0001, + 0x28de: 0x0001, 0x28df: 0x0001, 0x28e0: 0x0001, 0x28e1: 0x0001, 0x28e2: 0x0001, 0x28e3: 0x0001, + 0x28e4: 0x0001, 0x28e5: 0x0001, 0x28e6: 0x0001, 0x28e7: 0x0001, 0x28e8: 0x0001, 0x28e9: 0x0001, + 0x28ea: 0x0001, 0x28eb: 0x0001, 0x28ec: 0x0001, 0x28ed: 0x0001, 0x28ee: 0x0001, 0x28ef: 0x0001, + 0x28f0: 0x000d, 0x28f1: 0x000d, 0x28f2: 0x000d, 0x28f3: 0x000d, 0x28f4: 0x000d, 0x28f5: 0x000d, + 0x28f6: 0x000d, 0x28f7: 0x000d, 0x28f8: 0x000d, 0x28f9: 0x000d, 0x28fa: 0x000d, 0x28fb: 0x000d, + 0x28fc: 0x000d, 0x28fd: 0x000d, 0x28fe: 0x000d, 0x28ff: 0x000d, + // Block 0xa4, offset 0x2900 + 0x2900: 0x000d, 0x2901: 0x000d, 0x2902: 0x000d, 0x2903: 0x000d, 0x2904: 0x000d, 0x2905: 0x000d, + 0x2906: 0x000c, 0x2907: 0x000c, 0x2908: 0x000c, 0x2909: 0x000c, 0x290a: 0x000c, 0x290b: 0x000c, + 0x290c: 0x000c, 0x290d: 0x000c, 0x290e: 0x000c, 0x290f: 0x000c, 0x2910: 0x000c, 0x2911: 0x000d, + 0x2912: 0x000d, 0x2913: 0x000d, 0x2914: 0x000d, 0x2915: 0x000d, 0x2916: 0x000d, 0x2917: 0x000d, + 0x2918: 0x000d, 0x2919: 0x000d, 0x291a: 0x000d, 0x291b: 0x000d, 0x291c: 0x000d, 0x291d: 0x000d, + 0x291e: 0x000d, 0x291f: 0x000d, 0x2920: 0x000d, 0x2921: 0x000d, 0x2922: 0x000d, 0x2923: 0x000d, + 0x2924: 0x000d, 0x2925: 0x000d, 0x2926: 0x000d, 0x2927: 0x000d, 0x2928: 0x000d, 0x2929: 0x000d, + 0x292a: 0x000d, 0x292b: 0x000d, 0x292c: 0x000d, 0x292d: 0x000d, 0x292e: 0x000d, 0x292f: 0x000d, + 0x2930: 0x0001, 0x2931: 0x0001, 0x2932: 0x0001, 0x2933: 0x0001, 0x2934: 0x0001, 0x2935: 0x0001, + 0x2936: 0x0001, 0x2937: 0x0001, 0x2938: 0x0001, 0x2939: 0x0001, 0x293a: 0x0001, 0x293b: 0x0001, + 0x293c: 0x0001, 0x293d: 0x0001, 0x293e: 0x0001, 0x293f: 0x0001, + // Block 0xa5, offset 0x2940 + 0x2941: 0x000c, + 0x2978: 0x000c, 0x2979: 0x000c, 0x297a: 0x000c, 0x297b: 0x000c, + 0x297c: 0x000c, 0x297d: 0x000c, 0x297e: 0x000c, 0x297f: 0x000c, + // Block 0xa6, offset 0x2980 + 0x2980: 0x000c, 0x2981: 0x000c, 0x2982: 0x000c, 0x2983: 0x000c, 0x2984: 0x000c, 0x2985: 0x000c, + 0x2986: 0x000c, + 0x2992: 0x000a, 0x2993: 0x000a, 0x2994: 0x000a, 0x2995: 0x000a, 0x2996: 0x000a, 0x2997: 0x000a, + 0x2998: 0x000a, 0x2999: 0x000a, 0x299a: 0x000a, 0x299b: 0x000a, 0x299c: 0x000a, 0x299d: 0x000a, + 0x299e: 0x000a, 0x299f: 0x000a, 0x29a0: 0x000a, 0x29a1: 0x000a, 0x29a2: 0x000a, 0x29a3: 0x000a, + 0x29a4: 0x000a, 0x29a5: 0x000a, + 0x29bf: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29c0: 0x000c, 0x29c1: 0x000c, + 0x29f3: 0x000c, 0x29f4: 0x000c, 0x29f5: 0x000c, + 0x29f6: 0x000c, 0x29f9: 0x000c, 0x29fa: 0x000c, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x000c, 0x2a01: 0x000c, 0x2a02: 0x000c, + 0x2a27: 0x000c, 0x2a28: 0x000c, 0x2a29: 0x000c, + 0x2a2a: 0x000c, 0x2a2b: 0x000c, 0x2a2d: 0x000c, 0x2a2e: 0x000c, 0x2a2f: 0x000c, + 0x2a30: 0x000c, 0x2a31: 0x000c, 0x2a32: 0x000c, 0x2a33: 0x000c, 0x2a34: 0x000c, + // Block 0xa9, offset 0x2a40 + 0x2a73: 0x000c, + // Block 0xaa, offset 0x2a80 + 0x2a80: 0x000c, 0x2a81: 0x000c, + 0x2ab6: 0x000c, 0x2ab7: 0x000c, 0x2ab8: 0x000c, 0x2ab9: 0x000c, 0x2aba: 0x000c, 0x2abb: 0x000c, + 0x2abc: 0x000c, 0x2abd: 0x000c, 0x2abe: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2ac9: 0x000c, 0x2aca: 0x000c, 0x2acb: 0x000c, + 0x2acc: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b2f: 0x000c, + 0x2b30: 0x000c, 0x2b31: 0x000c, 0x2b34: 0x000c, + 0x2b36: 0x000c, 0x2b37: 0x000c, + 0x2b3e: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b5f: 0x000c, 0x2b63: 0x000c, + 0x2b64: 0x000c, 0x2b65: 0x000c, 0x2b66: 0x000c, 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c, + 0x2b6a: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2b80: 0x000c, + 0x2ba6: 0x000c, 0x2ba7: 0x000c, 0x2ba8: 0x000c, 0x2ba9: 0x000c, + 0x2baa: 0x000c, 0x2bab: 0x000c, 0x2bac: 0x000c, + 0x2bb0: 0x000c, 0x2bb1: 0x000c, 0x2bb2: 0x000c, 0x2bb3: 0x000c, 0x2bb4: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bf8: 0x000c, 0x2bf9: 0x000c, 0x2bfa: 0x000c, 0x2bfb: 0x000c, + 0x2bfc: 0x000c, 0x2bfd: 0x000c, 0x2bfe: 0x000c, 0x2bff: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c02: 0x000c, 0x2c03: 0x000c, 0x2c04: 0x000c, + 0x2c06: 0x000c, + 0x2c1e: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c73: 0x000c, 0x2c74: 0x000c, 0x2c75: 0x000c, + 0x2c76: 0x000c, 0x2c77: 0x000c, 0x2c78: 0x000c, 0x2c7a: 0x000c, + 0x2c7f: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2c80: 0x000c, 0x2c82: 0x000c, 0x2c83: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cf2: 0x000c, 0x2cf3: 0x000c, 0x2cf4: 0x000c, 0x2cf5: 0x000c, + 0x2cfc: 0x000c, 0x2cfd: 0x000c, 0x2cff: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d00: 0x000c, + 0x2d1c: 0x000c, 0x2d1d: 0x000c, + // Block 0xb5, offset 0x2d40 + 0x2d73: 0x000c, 0x2d74: 0x000c, 0x2d75: 0x000c, + 0x2d76: 0x000c, 0x2d77: 0x000c, 0x2d78: 0x000c, 0x2d79: 0x000c, 0x2d7a: 0x000c, + 0x2d7d: 0x000c, 0x2d7f: 0x000c, + // Block 0xb6, offset 0x2d80 + 0x2d80: 0x000c, + 0x2da0: 0x000a, 0x2da1: 0x000a, 0x2da2: 0x000a, 0x2da3: 0x000a, + 0x2da4: 0x000a, 0x2da5: 0x000a, 0x2da6: 0x000a, 0x2da7: 0x000a, 0x2da8: 0x000a, 0x2da9: 0x000a, + 0x2daa: 0x000a, 0x2dab: 0x000a, 0x2dac: 0x000a, + // Block 0xb7, offset 0x2dc0 + 0x2deb: 0x000c, 0x2ded: 0x000c, + 0x2df0: 0x000c, 0x2df1: 0x000c, 0x2df2: 0x000c, 0x2df3: 0x000c, 0x2df4: 0x000c, 0x2df5: 0x000c, + 0x2df7: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e1d: 0x000c, + 0x2e1e: 0x000c, 0x2e1f: 0x000c, 0x2e22: 0x000c, 0x2e23: 0x000c, + 0x2e24: 0x000c, 0x2e25: 0x000c, 0x2e27: 0x000c, 0x2e28: 0x000c, 0x2e29: 0x000c, + 0x2e2a: 0x000c, 0x2e2b: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e6f: 0x000c, + 0x2e70: 0x000c, 0x2e71: 0x000c, 0x2e72: 0x000c, 0x2e73: 0x000c, 0x2e74: 0x000c, 0x2e75: 0x000c, + 0x2e76: 0x000c, 0x2e77: 0x000c, 0x2e79: 0x000c, 0x2e7a: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2e81: 0x000c, 0x2e82: 0x000c, 0x2e83: 0x000c, 0x2e84: 0x000c, 0x2e85: 0x000c, + 0x2e86: 0x000c, 0x2e89: 0x000c, 0x2e8a: 0x000c, + 0x2eb3: 0x000c, 0x2eb4: 0x000c, 0x2eb5: 0x000c, + 0x2eb6: 0x000c, 0x2eb7: 0x000c, 0x2eb8: 0x000c, 0x2ebb: 0x000c, + 0x2ebc: 0x000c, 0x2ebd: 0x000c, 0x2ebe: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ec7: 0x000c, + 0x2ed1: 0x000c, + 0x2ed2: 0x000c, 0x2ed3: 0x000c, 0x2ed4: 0x000c, 0x2ed5: 0x000c, 0x2ed6: 0x000c, + 0x2ed9: 0x000c, 0x2eda: 0x000c, 0x2edb: 0x000c, + // Block 0xbc, offset 0x2f00 + 0x2f0a: 0x000c, 0x2f0b: 0x000c, + 0x2f0c: 0x000c, 0x2f0d: 0x000c, 0x2f0e: 0x000c, 0x2f0f: 0x000c, 0x2f10: 0x000c, 0x2f11: 0x000c, + 0x2f12: 0x000c, 0x2f13: 0x000c, 0x2f14: 0x000c, 0x2f15: 0x000c, 0x2f16: 0x000c, + 0x2f18: 0x000c, 0x2f19: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f70: 0x000c, 0x2f71: 0x000c, 0x2f72: 0x000c, 0x2f73: 0x000c, 0x2f74: 0x000c, 0x2f75: 0x000c, + 0x2f76: 0x000c, 0x2f78: 0x000c, 0x2f79: 0x000c, 0x2f7a: 0x000c, 0x2f7b: 0x000c, + 0x2f7c: 0x000c, 0x2f7d: 0x000c, + // Block 0xbe, offset 0x2f80 + 0x2f92: 0x000c, 0x2f93: 0x000c, 0x2f94: 0x000c, 0x2f95: 0x000c, 0x2f96: 0x000c, 0x2f97: 0x000c, + 0x2f98: 0x000c, 0x2f99: 0x000c, 0x2f9a: 0x000c, 0x2f9b: 0x000c, 0x2f9c: 0x000c, 0x2f9d: 0x000c, + 0x2f9e: 0x000c, 0x2f9f: 0x000c, 0x2fa0: 0x000c, 0x2fa1: 0x000c, 0x2fa2: 0x000c, 0x2fa3: 0x000c, + 0x2fa4: 0x000c, 0x2fa5: 0x000c, 0x2fa6: 0x000c, 0x2fa7: 0x000c, + 0x2faa: 0x000c, 0x2fab: 0x000c, 0x2fac: 0x000c, 0x2fad: 0x000c, 0x2fae: 0x000c, 0x2faf: 0x000c, + 0x2fb0: 0x000c, 0x2fb2: 0x000c, 0x2fb3: 0x000c, 0x2fb5: 0x000c, + 0x2fb6: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2ff1: 0x000c, 0x2ff2: 0x000c, 0x2ff3: 0x000c, 0x2ff4: 0x000c, 0x2ff5: 0x000c, + 0x2ff6: 0x000c, 0x2ffa: 0x000c, + 0x2ffc: 0x000c, 0x2ffd: 0x000c, 0x2fff: 0x000c, + // Block 0xc0, offset 0x3000 + 0x3000: 0x000c, 0x3001: 0x000c, 0x3002: 0x000c, 0x3003: 0x000c, 0x3004: 0x000c, 0x3005: 0x000c, + 0x3007: 0x000c, + // Block 0xc1, offset 0x3040 + 0x3050: 0x000c, 0x3051: 0x000c, + 0x3055: 0x000c, 0x3057: 0x000c, + // Block 0xc2, offset 0x3080 + 0x30b3: 0x000c, 0x30b4: 0x000c, + // Block 0xc3, offset 0x30c0 + 0x30f0: 0x000c, 0x30f1: 0x000c, 0x30f2: 0x000c, 0x30f3: 0x000c, 0x30f4: 0x000c, + // Block 0xc4, offset 0x3100 + 0x3130: 0x000c, 0x3131: 0x000c, 0x3132: 0x000c, 0x3133: 0x000c, 0x3134: 0x000c, 0x3135: 0x000c, + 0x3136: 0x000c, + // Block 0xc5, offset 0x3140 + 0x314f: 0x000c, 0x3150: 0x000c, 0x3151: 0x000c, + 0x3152: 0x000c, + // Block 0xc6, offset 0x3180 + 0x319d: 0x000c, + 0x319e: 0x000c, 0x31a0: 0x000b, 0x31a1: 0x000b, 0x31a2: 0x000b, 0x31a3: 0x000b, + // Block 0xc7, offset 0x31c0 + 0x31e7: 0x000c, 0x31e8: 0x000c, 0x31e9: 0x000c, + 0x31f3: 0x000b, 0x31f4: 0x000b, 0x31f5: 0x000b, + 0x31f6: 0x000b, 0x31f7: 0x000b, 0x31f8: 0x000b, 0x31f9: 0x000b, 0x31fa: 0x000b, 0x31fb: 0x000c, + 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31fe: 0x000c, 0x31ff: 0x000c, + // Block 0xc8, offset 0x3200 + 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3205: 0x000c, + 0x3206: 0x000c, 0x3207: 0x000c, 0x3208: 0x000c, 0x3209: 0x000c, 0x320a: 0x000c, 0x320b: 0x000c, + 0x322a: 0x000c, 0x322b: 0x000c, 0x322c: 0x000c, 0x322d: 0x000c, + // Block 0xc9, offset 0x3240 + 0x3240: 0x000a, 0x3241: 0x000a, 0x3242: 0x000c, 0x3243: 0x000c, 0x3244: 0x000c, 0x3245: 0x000a, + // Block 0xca, offset 0x3280 + 0x3280: 0x000a, 0x3281: 0x000a, 0x3282: 0x000a, 0x3283: 0x000a, 0x3284: 0x000a, 0x3285: 0x000a, + 0x3286: 0x000a, 0x3287: 0x000a, 0x3288: 0x000a, 0x3289: 0x000a, 0x328a: 0x000a, 0x328b: 0x000a, + 0x328c: 0x000a, 0x328d: 0x000a, 0x328e: 0x000a, 0x328f: 0x000a, 0x3290: 0x000a, 0x3291: 0x000a, + 0x3292: 0x000a, 0x3293: 0x000a, 0x3294: 0x000a, 0x3295: 0x000a, 0x3296: 0x000a, + // Block 0xcb, offset 0x32c0 + 0x32db: 0x000a, + // Block 0xcc, offset 0x3300 + 0x3315: 0x000a, + // Block 0xcd, offset 0x3340 + 0x334f: 0x000a, + // Block 0xce, offset 0x3380 + 0x3389: 0x000a, + // Block 0xcf, offset 0x33c0 + 0x33c3: 0x000a, + 0x33ce: 0x0002, 0x33cf: 0x0002, 0x33d0: 0x0002, 0x33d1: 0x0002, + 0x33d2: 0x0002, 0x33d3: 0x0002, 0x33d4: 0x0002, 0x33d5: 0x0002, 0x33d6: 0x0002, 0x33d7: 0x0002, + 0x33d8: 0x0002, 0x33d9: 0x0002, 0x33da: 0x0002, 0x33db: 0x0002, 0x33dc: 0x0002, 0x33dd: 0x0002, + 0x33de: 0x0002, 0x33df: 0x0002, 0x33e0: 0x0002, 0x33e1: 0x0002, 0x33e2: 0x0002, 0x33e3: 0x0002, + 0x33e4: 0x0002, 0x33e5: 0x0002, 0x33e6: 0x0002, 0x33e7: 0x0002, 0x33e8: 0x0002, 0x33e9: 0x0002, + 0x33ea: 0x0002, 0x33eb: 0x0002, 0x33ec: 0x0002, 0x33ed: 0x0002, 0x33ee: 0x0002, 0x33ef: 0x0002, + 0x33f0: 0x0002, 0x33f1: 0x0002, 0x33f2: 0x0002, 0x33f3: 0x0002, 0x33f4: 0x0002, 0x33f5: 0x0002, + 0x33f6: 0x0002, 0x33f7: 0x0002, 0x33f8: 0x0002, 0x33f9: 0x0002, 0x33fa: 0x0002, 0x33fb: 0x0002, + 0x33fc: 0x0002, 0x33fd: 0x0002, 0x33fe: 0x0002, 0x33ff: 0x0002, + // Block 0xd0, offset 0x3400 + 0x3400: 0x000c, 0x3401: 0x000c, 0x3402: 0x000c, 0x3403: 0x000c, 0x3404: 0x000c, 0x3405: 0x000c, + 0x3406: 0x000c, 0x3407: 0x000c, 0x3408: 0x000c, 0x3409: 0x000c, 0x340a: 0x000c, 0x340b: 0x000c, + 0x340c: 0x000c, 0x340d: 0x000c, 0x340e: 0x000c, 0x340f: 0x000c, 0x3410: 0x000c, 0x3411: 0x000c, + 0x3412: 0x000c, 0x3413: 0x000c, 0x3414: 0x000c, 0x3415: 0x000c, 0x3416: 0x000c, 0x3417: 0x000c, + 0x3418: 0x000c, 0x3419: 0x000c, 0x341a: 0x000c, 0x341b: 0x000c, 0x341c: 0x000c, 0x341d: 0x000c, + 0x341e: 0x000c, 0x341f: 0x000c, 0x3420: 0x000c, 0x3421: 0x000c, 0x3422: 0x000c, 0x3423: 0x000c, + 0x3424: 0x000c, 0x3425: 0x000c, 0x3426: 0x000c, 0x3427: 0x000c, 0x3428: 0x000c, 0x3429: 0x000c, + 0x342a: 0x000c, 0x342b: 0x000c, 0x342c: 0x000c, 0x342d: 0x000c, 0x342e: 0x000c, 0x342f: 0x000c, + 0x3430: 0x000c, 0x3431: 0x000c, 0x3432: 0x000c, 0x3433: 0x000c, 0x3434: 0x000c, 0x3435: 0x000c, + 0x3436: 0x000c, 0x343b: 0x000c, + 0x343c: 0x000c, 0x343d: 0x000c, 0x343e: 0x000c, 0x343f: 0x000c, + // Block 0xd1, offset 0x3440 + 0x3440: 0x000c, 0x3441: 0x000c, 0x3442: 0x000c, 0x3443: 0x000c, 0x3444: 0x000c, 0x3445: 0x000c, + 0x3446: 0x000c, 0x3447: 0x000c, 0x3448: 0x000c, 0x3449: 0x000c, 0x344a: 0x000c, 0x344b: 0x000c, + 0x344c: 0x000c, 0x344d: 0x000c, 0x344e: 0x000c, 0x344f: 0x000c, 0x3450: 0x000c, 0x3451: 0x000c, + 0x3452: 0x000c, 0x3453: 0x000c, 0x3454: 0x000c, 0x3455: 0x000c, 0x3456: 0x000c, 0x3457: 0x000c, + 0x3458: 0x000c, 0x3459: 0x000c, 0x345a: 0x000c, 0x345b: 0x000c, 0x345c: 0x000c, 0x345d: 0x000c, + 0x345e: 0x000c, 0x345f: 0x000c, 0x3460: 0x000c, 0x3461: 0x000c, 0x3462: 0x000c, 0x3463: 0x000c, + 0x3464: 0x000c, 0x3465: 0x000c, 0x3466: 0x000c, 0x3467: 0x000c, 0x3468: 0x000c, 0x3469: 0x000c, + 0x346a: 0x000c, 0x346b: 0x000c, 0x346c: 0x000c, + 0x3475: 0x000c, + // Block 0xd2, offset 0x3480 + 0x3484: 0x000c, + 0x349b: 0x000c, 0x349c: 0x000c, 0x349d: 0x000c, + 0x349e: 0x000c, 0x349f: 0x000c, 0x34a1: 0x000c, 0x34a2: 0x000c, 0x34a3: 0x000c, + 0x34a4: 0x000c, 0x34a5: 0x000c, 0x34a6: 0x000c, 0x34a7: 0x000c, 0x34a8: 0x000c, 0x34a9: 0x000c, + 0x34aa: 0x000c, 0x34ab: 0x000c, 0x34ac: 0x000c, 0x34ad: 0x000c, 0x34ae: 0x000c, 0x34af: 0x000c, + // Block 0xd3, offset 0x34c0 + 0x34c0: 0x000c, 0x34c1: 0x000c, 0x34c2: 0x000c, 0x34c3: 0x000c, 0x34c4: 0x000c, 0x34c5: 0x000c, + 0x34c6: 0x000c, 0x34c8: 0x000c, 0x34c9: 0x000c, 0x34ca: 0x000c, 0x34cb: 0x000c, + 0x34cc: 0x000c, 0x34cd: 0x000c, 0x34ce: 0x000c, 0x34cf: 0x000c, 0x34d0: 0x000c, 0x34d1: 0x000c, + 0x34d2: 0x000c, 0x34d3: 0x000c, 0x34d4: 0x000c, 0x34d5: 0x000c, 0x34d6: 0x000c, 0x34d7: 0x000c, + 0x34d8: 0x000c, 0x34db: 0x000c, 0x34dc: 0x000c, 0x34dd: 0x000c, + 0x34de: 0x000c, 0x34df: 0x000c, 0x34e0: 0x000c, 0x34e1: 0x000c, 0x34e3: 0x000c, + 0x34e4: 0x000c, 0x34e6: 0x000c, 0x34e7: 0x000c, 0x34e8: 0x000c, 0x34e9: 0x000c, + 0x34ea: 0x000c, + // Block 0xd4, offset 0x3500 + 0x3500: 0x0001, 0x3501: 0x0001, 0x3502: 0x0001, 0x3503: 0x0001, 0x3504: 0x0001, 0x3505: 0x0001, + 0x3506: 0x0001, 0x3507: 0x0001, 0x3508: 0x0001, 0x3509: 0x0001, 0x350a: 0x0001, 0x350b: 0x0001, + 0x350c: 0x0001, 0x350d: 0x0001, 0x350e: 0x0001, 0x350f: 0x0001, 0x3510: 0x000c, 0x3511: 0x000c, + 0x3512: 0x000c, 0x3513: 0x000c, 0x3514: 0x000c, 0x3515: 0x000c, 0x3516: 0x000c, 0x3517: 0x0001, + 0x3518: 0x0001, 0x3519: 0x0001, 0x351a: 0x0001, 0x351b: 0x0001, 0x351c: 0x0001, 0x351d: 0x0001, + 0x351e: 0x0001, 0x351f: 0x0001, 0x3520: 0x0001, 0x3521: 0x0001, 0x3522: 0x0001, 0x3523: 0x0001, + 0x3524: 0x0001, 0x3525: 0x0001, 0x3526: 0x0001, 0x3527: 0x0001, 0x3528: 0x0001, 0x3529: 0x0001, + 0x352a: 0x0001, 0x352b: 0x0001, 0x352c: 0x0001, 0x352d: 0x0001, 0x352e: 0x0001, 0x352f: 0x0001, + 0x3530: 0x0001, 0x3531: 0x0001, 0x3532: 0x0001, 0x3533: 0x0001, 0x3534: 0x0001, 0x3535: 0x0001, + 0x3536: 0x0001, 0x3537: 0x0001, 0x3538: 0x0001, 0x3539: 0x0001, 0x353a: 0x0001, 0x353b: 0x0001, + 0x353c: 0x0001, 0x353d: 0x0001, 0x353e: 0x0001, 0x353f: 0x0001, + // Block 0xd5, offset 0x3540 + 0x3540: 0x0001, 0x3541: 0x0001, 0x3542: 0x0001, 0x3543: 0x0001, 0x3544: 0x000c, 0x3545: 0x000c, + 0x3546: 0x000c, 0x3547: 0x000c, 0x3548: 0x000c, 0x3549: 0x000c, 0x354a: 0x000c, 0x354b: 0x0001, + 0x354c: 0x0001, 0x354d: 0x0001, 0x354e: 0x0001, 0x354f: 0x0001, 0x3550: 0x0001, 0x3551: 0x0001, + 0x3552: 0x0001, 0x3553: 0x0001, 0x3554: 0x0001, 0x3555: 0x0001, 0x3556: 0x0001, 0x3557: 0x0001, + 0x3558: 0x0001, 0x3559: 0x0001, 0x355a: 0x0001, 0x355b: 0x0001, 0x355c: 0x0001, 0x355d: 0x0001, + 0x355e: 0x0001, 0x355f: 0x0001, 0x3560: 0x0001, 0x3561: 0x0001, 0x3562: 0x0001, 0x3563: 0x0001, + 0x3564: 0x0001, 0x3565: 0x0001, 0x3566: 0x0001, 0x3567: 0x0001, 0x3568: 0x0001, 0x3569: 0x0001, + 0x356a: 0x0001, 0x356b: 0x0001, 0x356c: 0x0001, 0x356d: 0x0001, 0x356e: 0x0001, 0x356f: 0x0001, + 0x3570: 0x0001, 0x3571: 0x0001, 0x3572: 0x0001, 0x3573: 0x0001, 0x3574: 0x0001, 0x3575: 0x0001, + 0x3576: 0x0001, 0x3577: 0x0001, 0x3578: 0x0001, 0x3579: 0x0001, 0x357a: 0x0001, 0x357b: 0x0001, + 0x357c: 0x0001, 0x357d: 0x0001, 0x357e: 0x0001, 0x357f: 0x0001, + // Block 0xd6, offset 0x3580 + 0x3580: 0x000d, 0x3581: 0x000d, 0x3582: 0x000d, 0x3583: 0x000d, 0x3584: 0x000d, 0x3585: 0x000d, + 0x3586: 0x000d, 0x3587: 0x000d, 0x3588: 0x000d, 0x3589: 0x000d, 0x358a: 0x000d, 0x358b: 0x000d, + 0x358c: 0x000d, 0x358d: 0x000d, 0x358e: 0x000d, 0x358f: 0x000d, 0x3590: 0x000d, 0x3591: 0x000d, + 0x3592: 0x000d, 0x3593: 0x000d, 0x3594: 0x000d, 0x3595: 0x000d, 0x3596: 0x000d, 0x3597: 0x000d, + 0x3598: 0x000d, 0x3599: 0x000d, 0x359a: 0x000d, 0x359b: 0x000d, 0x359c: 0x000d, 0x359d: 0x000d, + 0x359e: 0x000d, 0x359f: 0x000d, 0x35a0: 0x000d, 0x35a1: 0x000d, 0x35a2: 0x000d, 0x35a3: 0x000d, + 0x35a4: 0x000d, 0x35a5: 0x000d, 0x35a6: 0x000d, 0x35a7: 0x000d, 0x35a8: 0x000d, 0x35a9: 0x000d, + 0x35aa: 0x000d, 0x35ab: 0x000d, 0x35ac: 0x000d, 0x35ad: 0x000d, 0x35ae: 0x000d, 0x35af: 0x000d, + 0x35b0: 0x000a, 0x35b1: 0x000a, 0x35b2: 0x000d, 0x35b3: 0x000d, 0x35b4: 0x000d, 0x35b5: 0x000d, + 0x35b6: 0x000d, 0x35b7: 0x000d, 0x35b8: 0x000d, 0x35b9: 0x000d, 0x35ba: 0x000d, 0x35bb: 0x000d, + 0x35bc: 0x000d, 0x35bd: 0x000d, 0x35be: 0x000d, 0x35bf: 0x000d, + // Block 0xd7, offset 0x35c0 + 0x35c0: 0x000a, 0x35c1: 0x000a, 0x35c2: 0x000a, 0x35c3: 0x000a, 0x35c4: 0x000a, 0x35c5: 0x000a, + 0x35c6: 0x000a, 0x35c7: 0x000a, 0x35c8: 0x000a, 0x35c9: 0x000a, 0x35ca: 0x000a, 0x35cb: 0x000a, + 0x35cc: 0x000a, 0x35cd: 0x000a, 0x35ce: 0x000a, 0x35cf: 0x000a, 0x35d0: 0x000a, 0x35d1: 0x000a, + 0x35d2: 0x000a, 0x35d3: 0x000a, 0x35d4: 0x000a, 0x35d5: 0x000a, 0x35d6: 0x000a, 0x35d7: 0x000a, + 0x35d8: 0x000a, 0x35d9: 0x000a, 0x35da: 0x000a, 0x35db: 0x000a, 0x35dc: 0x000a, 0x35dd: 0x000a, + 0x35de: 0x000a, 0x35df: 0x000a, 0x35e0: 0x000a, 0x35e1: 0x000a, 0x35e2: 0x000a, 0x35e3: 0x000a, + 0x35e4: 0x000a, 0x35e5: 0x000a, 0x35e6: 0x000a, 0x35e7: 0x000a, 0x35e8: 0x000a, 0x35e9: 0x000a, + 0x35ea: 0x000a, 0x35eb: 0x000a, + 0x35f0: 0x000a, 0x35f1: 0x000a, 0x35f2: 0x000a, 0x35f3: 0x000a, 0x35f4: 0x000a, 0x35f5: 0x000a, + 0x35f6: 0x000a, 0x35f7: 0x000a, 0x35f8: 0x000a, 0x35f9: 0x000a, 0x35fa: 0x000a, 0x35fb: 0x000a, + 0x35fc: 0x000a, 0x35fd: 0x000a, 0x35fe: 0x000a, 0x35ff: 0x000a, + // Block 0xd8, offset 0x3600 + 0x3600: 0x000a, 0x3601: 0x000a, 0x3602: 0x000a, 0x3603: 0x000a, 0x3604: 0x000a, 0x3605: 0x000a, + 0x3606: 0x000a, 0x3607: 0x000a, 0x3608: 0x000a, 0x3609: 0x000a, 0x360a: 0x000a, 0x360b: 0x000a, + 0x360c: 0x000a, 0x360d: 0x000a, 0x360e: 0x000a, 0x360f: 0x000a, 0x3610: 0x000a, 0x3611: 0x000a, + 0x3612: 0x000a, 0x3613: 0x000a, + 0x3620: 0x000a, 0x3621: 0x000a, 0x3622: 0x000a, 0x3623: 0x000a, + 0x3624: 0x000a, 0x3625: 0x000a, 0x3626: 0x000a, 0x3627: 0x000a, 0x3628: 0x000a, 0x3629: 0x000a, + 0x362a: 0x000a, 0x362b: 0x000a, 0x362c: 0x000a, 0x362d: 0x000a, 0x362e: 0x000a, + 0x3631: 0x000a, 0x3632: 0x000a, 0x3633: 0x000a, 0x3634: 0x000a, 0x3635: 0x000a, + 0x3636: 0x000a, 0x3637: 0x000a, 0x3638: 0x000a, 0x3639: 0x000a, 0x363a: 0x000a, 0x363b: 0x000a, + 0x363c: 0x000a, 0x363d: 0x000a, 0x363e: 0x000a, 0x363f: 0x000a, + // Block 0xd9, offset 0x3640 + 0x3641: 0x000a, 0x3642: 0x000a, 0x3643: 0x000a, 0x3644: 0x000a, 0x3645: 0x000a, + 0x3646: 0x000a, 0x3647: 0x000a, 0x3648: 0x000a, 0x3649: 0x000a, 0x364a: 0x000a, 0x364b: 0x000a, + 0x364c: 0x000a, 0x364d: 0x000a, 0x364e: 0x000a, 0x364f: 0x000a, 0x3651: 0x000a, + 0x3652: 0x000a, 0x3653: 0x000a, 0x3654: 0x000a, 0x3655: 0x000a, 0x3656: 0x000a, 0x3657: 0x000a, + 0x3658: 0x000a, 0x3659: 0x000a, 0x365a: 0x000a, 0x365b: 0x000a, 0x365c: 0x000a, 0x365d: 0x000a, + 0x365e: 0x000a, 0x365f: 0x000a, 0x3660: 0x000a, 0x3661: 0x000a, 0x3662: 0x000a, 0x3663: 0x000a, + 0x3664: 0x000a, 0x3665: 0x000a, 0x3666: 0x000a, 0x3667: 0x000a, 0x3668: 0x000a, 0x3669: 0x000a, + 0x366a: 0x000a, 0x366b: 0x000a, 0x366c: 0x000a, 0x366d: 0x000a, 0x366e: 0x000a, 0x366f: 0x000a, + 0x3670: 0x000a, 0x3671: 0x000a, 0x3672: 0x000a, 0x3673: 0x000a, 0x3674: 0x000a, 0x3675: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x0002, 0x3681: 0x0002, 0x3682: 0x0002, 0x3683: 0x0002, 0x3684: 0x0002, 0x3685: 0x0002, + 0x3686: 0x0002, 0x3687: 0x0002, 0x3688: 0x0002, 0x3689: 0x0002, 0x368a: 0x0002, 0x368b: 0x000a, + 0x368c: 0x000a, + 0x36af: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36ea: 0x000a, 0x36eb: 0x000a, + // Block 0xdc, offset 0x3700 + 0x3720: 0x000a, 0x3721: 0x000a, 0x3722: 0x000a, 0x3723: 0x000a, + 0x3724: 0x000a, 0x3725: 0x000a, + // Block 0xdd, offset 0x3740 + 0x3740: 0x000a, 0x3741: 0x000a, 0x3742: 0x000a, 0x3743: 0x000a, 0x3744: 0x000a, 0x3745: 0x000a, + 0x3746: 0x000a, 0x3747: 0x000a, 0x3748: 0x000a, 0x3749: 0x000a, 0x374a: 0x000a, 0x374b: 0x000a, + 0x374c: 0x000a, 0x374d: 0x000a, 0x374e: 0x000a, 0x374f: 0x000a, 0x3750: 0x000a, 0x3751: 0x000a, + 0x3752: 0x000a, 0x3753: 0x000a, 0x3754: 0x000a, + 0x3760: 0x000a, 0x3761: 0x000a, 0x3762: 0x000a, 0x3763: 0x000a, + 0x3764: 0x000a, 0x3765: 0x000a, 0x3766: 0x000a, 0x3767: 0x000a, 0x3768: 0x000a, 0x3769: 0x000a, + 0x376a: 0x000a, 0x376b: 0x000a, 0x376c: 0x000a, + 0x3770: 0x000a, 0x3771: 0x000a, 0x3772: 0x000a, 0x3773: 0x000a, 0x3774: 0x000a, 0x3775: 0x000a, + 0x3776: 0x000a, 0x3777: 0x000a, 0x3778: 0x000a, 0x3779: 0x000a, + // Block 0xde, offset 0x3780 + 0x3780: 0x000a, 0x3781: 0x000a, 0x3782: 0x000a, 0x3783: 0x000a, 0x3784: 0x000a, 0x3785: 0x000a, + 0x3786: 0x000a, 0x3787: 0x000a, 0x3788: 0x000a, 0x3789: 0x000a, 0x378a: 0x000a, 0x378b: 0x000a, + 0x378c: 0x000a, 0x378d: 0x000a, 0x378e: 0x000a, 0x378f: 0x000a, 0x3790: 0x000a, 0x3791: 0x000a, + 0x3792: 0x000a, 0x3793: 0x000a, 0x3794: 0x000a, 0x3795: 0x000a, 0x3796: 0x000a, 0x3797: 0x000a, + 0x3798: 0x000a, + // Block 0xdf, offset 0x37c0 + 0x37c0: 0x000a, 0x37c1: 0x000a, 0x37c2: 0x000a, 0x37c3: 0x000a, 0x37c4: 0x000a, 0x37c5: 0x000a, + 0x37c6: 0x000a, 0x37c7: 0x000a, 0x37c8: 0x000a, 0x37c9: 0x000a, 0x37ca: 0x000a, 0x37cb: 0x000a, + 0x37d0: 0x000a, 0x37d1: 0x000a, + 0x37d2: 0x000a, 0x37d3: 0x000a, 0x37d4: 0x000a, 0x37d5: 0x000a, 0x37d6: 0x000a, 0x37d7: 0x000a, + 0x37d8: 0x000a, 0x37d9: 0x000a, 0x37da: 0x000a, 0x37db: 0x000a, 0x37dc: 0x000a, 0x37dd: 0x000a, + 0x37de: 0x000a, 0x37df: 0x000a, 0x37e0: 0x000a, 0x37e1: 0x000a, 0x37e2: 0x000a, 0x37e3: 0x000a, + 0x37e4: 0x000a, 0x37e5: 0x000a, 0x37e6: 0x000a, 0x37e7: 0x000a, 0x37e8: 0x000a, 0x37e9: 0x000a, + 0x37ea: 0x000a, 0x37eb: 0x000a, 0x37ec: 0x000a, 0x37ed: 0x000a, 0x37ee: 0x000a, 0x37ef: 0x000a, + 0x37f0: 0x000a, 0x37f1: 0x000a, 0x37f2: 0x000a, 0x37f3: 0x000a, 0x37f4: 0x000a, 0x37f5: 0x000a, + 0x37f6: 0x000a, 0x37f7: 0x000a, 0x37f8: 0x000a, 0x37f9: 0x000a, 0x37fa: 0x000a, 0x37fb: 0x000a, + 0x37fc: 0x000a, 0x37fd: 0x000a, 0x37fe: 0x000a, 0x37ff: 0x000a, + // Block 0xe0, offset 0x3800 + 0x3800: 0x000a, 0x3801: 0x000a, 0x3802: 0x000a, 0x3803: 0x000a, 0x3804: 0x000a, 0x3805: 0x000a, + 0x3806: 0x000a, 0x3807: 0x000a, + 0x3810: 0x000a, 0x3811: 0x000a, + 0x3812: 0x000a, 0x3813: 0x000a, 0x3814: 0x000a, 0x3815: 0x000a, 0x3816: 0x000a, 0x3817: 0x000a, + 0x3818: 0x000a, 0x3819: 0x000a, + 0x3820: 0x000a, 0x3821: 0x000a, 0x3822: 0x000a, 0x3823: 0x000a, + 0x3824: 0x000a, 0x3825: 0x000a, 0x3826: 0x000a, 0x3827: 0x000a, 0x3828: 0x000a, 0x3829: 0x000a, + 0x382a: 0x000a, 0x382b: 0x000a, 0x382c: 0x000a, 0x382d: 0x000a, 0x382e: 0x000a, 0x382f: 0x000a, + 0x3830: 0x000a, 0x3831: 0x000a, 0x3832: 0x000a, 0x3833: 0x000a, 0x3834: 0x000a, 0x3835: 0x000a, + 0x3836: 0x000a, 0x3837: 0x000a, 0x3838: 0x000a, 0x3839: 0x000a, 0x383a: 0x000a, 0x383b: 0x000a, + 0x383c: 0x000a, 0x383d: 0x000a, 0x383e: 0x000a, 0x383f: 0x000a, + // Block 0xe1, offset 0x3840 + 0x3840: 0x000a, 0x3841: 0x000a, 0x3842: 0x000a, 0x3843: 0x000a, 0x3844: 0x000a, 0x3845: 0x000a, + 0x3846: 0x000a, 0x3847: 0x000a, + 0x3850: 0x000a, 0x3851: 0x000a, + 0x3852: 0x000a, 0x3853: 0x000a, 0x3854: 0x000a, 0x3855: 0x000a, 0x3856: 0x000a, 0x3857: 0x000a, + 0x3858: 0x000a, 0x3859: 0x000a, 0x385a: 0x000a, 0x385b: 0x000a, 0x385c: 0x000a, 0x385d: 0x000a, + 0x385e: 0x000a, 0x385f: 0x000a, 0x3860: 0x000a, 0x3861: 0x000a, 0x3862: 0x000a, 0x3863: 0x000a, + 0x3864: 0x000a, 0x3865: 0x000a, 0x3866: 0x000a, 0x3867: 0x000a, 0x3868: 0x000a, 0x3869: 0x000a, + 0x386a: 0x000a, 0x386b: 0x000a, 0x386c: 0x000a, 0x386d: 0x000a, + // Block 0xe2, offset 0x3880 + 0x3880: 0x000a, 0x3881: 0x000a, 0x3882: 0x000a, 0x3883: 0x000a, 0x3884: 0x000a, 0x3885: 0x000a, + 0x3886: 0x000a, 0x3887: 0x000a, 0x3888: 0x000a, 0x3889: 0x000a, 0x388a: 0x000a, 0x388b: 0x000a, + 0x3890: 0x000a, 0x3891: 0x000a, + 0x3892: 0x000a, 0x3893: 0x000a, 0x3894: 0x000a, 0x3895: 0x000a, 0x3896: 0x000a, 0x3897: 0x000a, + 0x3898: 0x000a, 0x3899: 0x000a, 0x389a: 0x000a, 0x389b: 0x000a, 0x389c: 0x000a, 0x389d: 0x000a, + 0x389e: 0x000a, 0x389f: 0x000a, 0x38a0: 0x000a, 0x38a1: 0x000a, 0x38a2: 0x000a, 0x38a3: 0x000a, + 0x38a4: 0x000a, 0x38a5: 0x000a, 0x38a6: 0x000a, 0x38a7: 0x000a, 0x38a8: 0x000a, 0x38a9: 0x000a, + 0x38aa: 0x000a, 0x38ab: 0x000a, 0x38ac: 0x000a, 0x38ad: 0x000a, 0x38ae: 0x000a, 0x38af: 0x000a, + 0x38b0: 0x000a, 0x38b1: 0x000a, 0x38b2: 0x000a, 0x38b3: 0x000a, 0x38b4: 0x000a, 0x38b5: 0x000a, + 0x38b6: 0x000a, 0x38b7: 0x000a, 0x38b8: 0x000a, 0x38b9: 0x000a, 0x38ba: 0x000a, 0x38bb: 0x000a, + 0x38bc: 0x000a, 0x38bd: 0x000a, 0x38be: 0x000a, + // Block 0xe3, offset 0x38c0 + 0x38c0: 0x000a, 0x38c1: 0x000a, 0x38c2: 0x000a, 0x38c3: 0x000a, 0x38c4: 0x000a, 0x38c5: 0x000a, + 0x38c6: 0x000a, 0x38c7: 0x000a, 0x38c8: 0x000a, 0x38c9: 0x000a, 0x38ca: 0x000a, 0x38cb: 0x000a, + 0x38cc: 0x000a, 0x38cd: 0x000a, 0x38ce: 0x000a, 0x38cf: 0x000a, 0x38d0: 0x000a, 0x38d1: 0x000a, + 0x38d2: 0x000a, 0x38d3: 0x000a, 0x38d4: 0x000a, 0x38d5: 0x000a, 0x38d6: 0x000a, 0x38d7: 0x000a, + 0x38d8: 0x000a, 0x38d9: 0x000a, 0x38da: 0x000a, 0x38db: 0x000a, 0x38dc: 0x000a, 0x38dd: 0x000a, + 0x38de: 0x000a, 0x38df: 0x000a, 0x38e0: 0x000a, 0x38e1: 0x000a, 0x38e2: 0x000a, 0x38e3: 0x000a, + 0x38e4: 0x000a, 0x38e5: 0x000a, 0x38e6: 0x000a, 0x38e7: 0x000a, 0x38e8: 0x000a, 0x38e9: 0x000a, + 0x38ea: 0x000a, 0x38eb: 0x000a, 0x38ec: 0x000a, 0x38ed: 0x000a, 0x38ee: 0x000a, 0x38ef: 0x000a, + 0x38f0: 0x000a, 0x38f3: 0x000a, 0x38f4: 0x000a, 0x38f5: 0x000a, + 0x38f6: 0x000a, 0x38fa: 0x000a, + 0x38fc: 0x000a, 0x38fd: 0x000a, 0x38fe: 0x000a, 0x38ff: 0x000a, + // Block 0xe4, offset 0x3900 + 0x3900: 0x000a, 0x3901: 0x000a, 0x3902: 0x000a, 0x3903: 0x000a, 0x3904: 0x000a, 0x3905: 0x000a, + 0x3906: 0x000a, 0x3907: 0x000a, 0x3908: 0x000a, 0x3909: 0x000a, 0x390a: 0x000a, 0x390b: 0x000a, + 0x390c: 0x000a, 0x390d: 0x000a, 0x390e: 0x000a, 0x390f: 0x000a, 0x3910: 0x000a, 0x3911: 0x000a, + 0x3912: 0x000a, 0x3913: 0x000a, 0x3914: 0x000a, 0x3915: 0x000a, 0x3916: 0x000a, 0x3917: 0x000a, + 0x3918: 0x000a, 0x3919: 0x000a, 0x391a: 0x000a, 0x391b: 0x000a, 0x391c: 0x000a, 0x391d: 0x000a, + 0x391e: 0x000a, 0x391f: 0x000a, 0x3920: 0x000a, 0x3921: 0x000a, 0x3922: 0x000a, + 0x3930: 0x000a, 0x3931: 0x000a, 0x3932: 0x000a, 0x3933: 0x000a, 0x3934: 0x000a, 0x3935: 0x000a, + 0x3936: 0x000a, 0x3937: 0x000a, 0x3938: 0x000a, 0x3939: 0x000a, + // Block 0xe5, offset 0x3940 + 0x3940: 0x000a, 0x3941: 0x000a, 0x3942: 0x000a, + 0x3950: 0x000a, 0x3951: 0x000a, + 0x3952: 0x000a, 0x3953: 0x000a, 0x3954: 0x000a, 0x3955: 0x000a, 0x3956: 0x000a, 0x3957: 0x000a, + 0x3958: 0x000a, 0x3959: 0x000a, 0x395a: 0x000a, 0x395b: 0x000a, 0x395c: 0x000a, 0x395d: 0x000a, + 0x395e: 0x000a, 0x395f: 0x000a, 0x3960: 0x000a, 0x3961: 0x000a, 0x3962: 0x000a, 0x3963: 0x000a, + 0x3964: 0x000a, 0x3965: 0x000a, 0x3966: 0x000a, 0x3967: 0x000a, 0x3968: 0x000a, 0x3969: 0x000a, + 0x396a: 0x000a, 0x396b: 0x000a, 0x396c: 0x000a, 0x396d: 0x000a, 0x396e: 0x000a, 0x396f: 0x000a, + 0x3970: 0x000a, 0x3971: 0x000a, 0x3972: 0x000a, 0x3973: 0x000a, 0x3974: 0x000a, 0x3975: 0x000a, + 0x3976: 0x000a, 0x3977: 0x000a, 0x3978: 0x000a, 0x3979: 0x000a, 0x397a: 0x000a, 0x397b: 0x000a, + 0x397c: 0x000a, 0x397d: 0x000a, 0x397e: 0x000a, 0x397f: 0x000a, + // Block 0xe6, offset 0x3980 + 0x39a0: 0x000a, 0x39a1: 0x000a, 0x39a2: 0x000a, 0x39a3: 0x000a, + 0x39a4: 0x000a, 0x39a5: 0x000a, 0x39a6: 0x000a, 0x39a7: 0x000a, 0x39a8: 0x000a, 0x39a9: 0x000a, + 0x39aa: 0x000a, 0x39ab: 0x000a, 0x39ac: 0x000a, 0x39ad: 0x000a, + // Block 0xe7, offset 0x39c0 + 0x39fe: 0x000b, 0x39ff: 0x000b, + // Block 0xe8, offset 0x3a00 + 0x3a00: 0x000b, 0x3a01: 0x000b, 0x3a02: 0x000b, 0x3a03: 0x000b, 0x3a04: 0x000b, 0x3a05: 0x000b, + 0x3a06: 0x000b, 0x3a07: 0x000b, 0x3a08: 0x000b, 0x3a09: 0x000b, 0x3a0a: 0x000b, 0x3a0b: 0x000b, + 0x3a0c: 0x000b, 0x3a0d: 0x000b, 0x3a0e: 0x000b, 0x3a0f: 0x000b, 0x3a10: 0x000b, 0x3a11: 0x000b, + 0x3a12: 0x000b, 0x3a13: 0x000b, 0x3a14: 0x000b, 0x3a15: 0x000b, 0x3a16: 0x000b, 0x3a17: 0x000b, + 0x3a18: 0x000b, 0x3a19: 0x000b, 0x3a1a: 0x000b, 0x3a1b: 0x000b, 0x3a1c: 0x000b, 0x3a1d: 0x000b, + 0x3a1e: 0x000b, 0x3a1f: 0x000b, 0x3a20: 0x000b, 0x3a21: 0x000b, 0x3a22: 0x000b, 0x3a23: 0x000b, + 0x3a24: 0x000b, 0x3a25: 0x000b, 0x3a26: 0x000b, 0x3a27: 0x000b, 0x3a28: 0x000b, 0x3a29: 0x000b, + 0x3a2a: 0x000b, 0x3a2b: 0x000b, 0x3a2c: 0x000b, 0x3a2d: 0x000b, 0x3a2e: 0x000b, 0x3a2f: 0x000b, + 0x3a30: 0x000b, 0x3a31: 0x000b, 0x3a32: 0x000b, 0x3a33: 0x000b, 0x3a34: 0x000b, 0x3a35: 0x000b, + 0x3a36: 0x000b, 0x3a37: 0x000b, 0x3a38: 0x000b, 0x3a39: 0x000b, 0x3a3a: 0x000b, 0x3a3b: 0x000b, + 0x3a3c: 0x000b, 0x3a3d: 0x000b, 0x3a3e: 0x000b, 0x3a3f: 0x000b, + // Block 0xe9, offset 0x3a40 + 0x3a40: 0x000c, 0x3a41: 0x000c, 0x3a42: 0x000c, 0x3a43: 0x000c, 0x3a44: 0x000c, 0x3a45: 0x000c, + 0x3a46: 0x000c, 0x3a47: 0x000c, 0x3a48: 0x000c, 0x3a49: 0x000c, 0x3a4a: 0x000c, 0x3a4b: 0x000c, + 0x3a4c: 0x000c, 0x3a4d: 0x000c, 0x3a4e: 0x000c, 0x3a4f: 0x000c, 0x3a50: 0x000c, 0x3a51: 0x000c, + 0x3a52: 0x000c, 0x3a53: 0x000c, 0x3a54: 0x000c, 0x3a55: 0x000c, 0x3a56: 0x000c, 0x3a57: 0x000c, + 0x3a58: 0x000c, 0x3a59: 0x000c, 0x3a5a: 0x000c, 0x3a5b: 0x000c, 0x3a5c: 0x000c, 0x3a5d: 0x000c, + 0x3a5e: 0x000c, 0x3a5f: 0x000c, 0x3a60: 0x000c, 0x3a61: 0x000c, 0x3a62: 0x000c, 0x3a63: 0x000c, + 0x3a64: 0x000c, 0x3a65: 0x000c, 0x3a66: 0x000c, 0x3a67: 0x000c, 0x3a68: 0x000c, 0x3a69: 0x000c, + 0x3a6a: 0x000c, 0x3a6b: 0x000c, 0x3a6c: 0x000c, 0x3a6d: 0x000c, 0x3a6e: 0x000c, 0x3a6f: 0x000c, + 0x3a70: 0x000b, 0x3a71: 0x000b, 0x3a72: 0x000b, 0x3a73: 0x000b, 0x3a74: 0x000b, 0x3a75: 0x000b, + 0x3a76: 0x000b, 0x3a77: 0x000b, 0x3a78: 0x000b, 0x3a79: 0x000b, 0x3a7a: 0x000b, 0x3a7b: 0x000b, + 0x3a7c: 0x000b, 0x3a7d: 0x000b, 0x3a7e: 0x000b, 0x3a7f: 0x000b, +} + +// bidiIndex: 24 blocks, 1536 entries, 1536 bytes +// Block 0 is the zero block. +var bidiIndex = [1536]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x11, 0xf1: 0x12, 0xf2: 0x12, 0xf3: 0x14, 0xf4: 0x15, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x137: 0x28, + 0x138: 0x29, 0x139: 0x2a, 0x13a: 0x2b, 0x13b: 0x2c, 0x13c: 0x2d, 0x13d: 0x2e, 0x13e: 0x2f, 0x13f: 0x30, + // Block 0x5, offset 0x140 + 0x140: 0x31, 0x141: 0x32, 0x142: 0x33, + 0x14d: 0x34, 0x14e: 0x35, + 0x150: 0x36, + 0x15a: 0x37, 0x15c: 0x38, 0x15d: 0x39, 0x15e: 0x3a, 0x15f: 0x3b, + 0x160: 0x3c, 0x162: 0x3d, 0x164: 0x3e, 0x165: 0x3f, 0x167: 0x40, + 0x168: 0x41, 0x169: 0x42, 0x16a: 0x43, 0x16c: 0x44, 0x16d: 0x45, 0x16e: 0x46, 0x16f: 0x47, + 0x170: 0x48, 0x173: 0x49, 0x177: 0x4a, + 0x17e: 0x4b, 0x17f: 0x4c, + // Block 0x6, offset 0x180 + 0x180: 0x4d, 0x181: 0x4e, 0x182: 0x4f, 0x183: 0x50, 0x184: 0x51, 0x185: 0x52, 0x186: 0x53, 0x187: 0x54, + 0x188: 0x55, 0x189: 0x54, 0x18a: 0x54, 0x18b: 0x54, 0x18c: 0x56, 0x18d: 0x57, 0x18e: 0x58, 0x18f: 0x54, + 0x190: 0x59, 0x191: 0x5a, 0x192: 0x5b, 0x193: 0x5c, 0x194: 0x54, 0x195: 0x54, 0x196: 0x54, 0x197: 0x54, + 0x198: 0x54, 0x199: 0x54, 0x19a: 0x5d, 0x19b: 0x54, 0x19c: 0x54, 0x19d: 0x5e, 0x19e: 0x54, 0x19f: 0x5f, + 0x1a4: 0x54, 0x1a5: 0x54, 0x1a6: 0x60, 0x1a7: 0x61, + 0x1a8: 0x54, 0x1a9: 0x54, 0x1aa: 0x54, 0x1ab: 0x54, 0x1ac: 0x54, 0x1ad: 0x62, 0x1ae: 0x63, 0x1af: 0x64, + 0x1b3: 0x65, 0x1b5: 0x66, 0x1b7: 0x67, + 0x1b8: 0x68, 0x1b9: 0x69, 0x1ba: 0x6a, 0x1bb: 0x6b, 0x1bc: 0x54, 0x1bd: 0x54, 0x1be: 0x54, 0x1bf: 0x6c, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6d, 0x1c2: 0x6e, 0x1c3: 0x6f, 0x1c7: 0x70, + 0x1c8: 0x71, 0x1c9: 0x72, 0x1ca: 0x73, 0x1cb: 0x74, 0x1cd: 0x75, 0x1cf: 0x76, + // Block 0x8, offset 0x200 + 0x237: 0x54, + // Block 0x9, offset 0x240 + 0x252: 0x77, 0x253: 0x78, + 0x258: 0x79, 0x259: 0x7a, 0x25a: 0x7b, 0x25b: 0x7c, 0x25c: 0x7d, 0x25e: 0x7e, + 0x260: 0x7f, 0x261: 0x80, 0x263: 0x81, 0x264: 0x82, 0x265: 0x83, 0x266: 0x84, 0x267: 0x85, + 0x268: 0x86, 0x269: 0x87, 0x26a: 0x88, 0x26b: 0x89, 0x26f: 0x8a, + // Block 0xa, offset 0x280 + 0x2ac: 0x8b, 0x2ad: 0x8c, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8d, 0x2b5: 0x0e, 0x2b6: 0x0e, 0x2b7: 0x8e, + 0x2b8: 0x8f, 0x2b9: 0x90, 0x2ba: 0x0e, 0x2bb: 0x91, 0x2bc: 0x92, 0x2bd: 0x93, 0x2bf: 0x94, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x95, 0x2c5: 0x54, 0x2c6: 0x96, 0x2c7: 0x97, + 0x2cb: 0x98, 0x2cd: 0x99, + 0x2e0: 0x9a, 0x2e1: 0x9a, 0x2e2: 0x9a, 0x2e3: 0x9a, 0x2e4: 0x9b, 0x2e5: 0x9a, 0x2e6: 0x9a, 0x2e7: 0x9a, + 0x2e8: 0x9c, 0x2e9: 0x9a, 0x2ea: 0x9a, 0x2eb: 0x9d, 0x2ec: 0x9e, 0x2ed: 0x9a, 0x2ee: 0x9a, 0x2ef: 0x9a, + 0x2f0: 0x9a, 0x2f1: 0x9a, 0x2f2: 0x9a, 0x2f3: 0x9a, 0x2f4: 0x9f, 0x2f5: 0x9a, 0x2f6: 0x9a, 0x2f7: 0x9a, + 0x2f8: 0x9a, 0x2f9: 0xa0, 0x2fa: 0x9a, 0x2fb: 0x9a, 0x2fc: 0xa1, 0x2fd: 0xa2, 0x2fe: 0x9a, 0x2ff: 0x9a, + // Block 0xc, offset 0x300 + 0x300: 0xa3, 0x301: 0xa4, 0x302: 0xa5, 0x304: 0xa6, 0x305: 0xa7, 0x306: 0xa8, 0x307: 0xa9, + 0x308: 0xaa, 0x30b: 0xab, 0x30c: 0x26, 0x30d: 0xac, + 0x310: 0xad, 0x311: 0xae, 0x312: 0xaf, 0x313: 0xb0, 0x316: 0xb1, 0x317: 0xb2, + 0x318: 0xb3, 0x319: 0xb4, 0x31a: 0xb5, 0x31c: 0xb6, + 0x320: 0xb7, + 0x328: 0xb8, 0x329: 0xb9, 0x32a: 0xba, + 0x330: 0xbb, 0x332: 0xbc, 0x334: 0xbd, 0x335: 0xbe, 0x336: 0xbf, + 0x33b: 0xc0, + // Block 0xd, offset 0x340 + 0x36b: 0xc1, 0x36c: 0xc2, + 0x37e: 0xc3, + // Block 0xe, offset 0x380 + 0x3b2: 0xc4, + // Block 0xf, offset 0x3c0 + 0x3c5: 0xc5, 0x3c6: 0xc6, + 0x3c8: 0x54, 0x3c9: 0xc7, 0x3cc: 0x54, 0x3cd: 0xc8, + 0x3db: 0xc9, 0x3dc: 0xca, 0x3dd: 0xcb, 0x3de: 0xcc, 0x3df: 0xcd, + 0x3e8: 0xce, 0x3e9: 0xcf, 0x3ea: 0xd0, + // Block 0x10, offset 0x400 + 0x400: 0xd1, + 0x420: 0x9a, 0x421: 0x9a, 0x422: 0x9a, 0x423: 0xd2, 0x424: 0x9a, 0x425: 0xd3, 0x426: 0x9a, 0x427: 0x9a, + 0x428: 0x9a, 0x429: 0x9a, 0x42a: 0x9a, 0x42b: 0x9a, 0x42c: 0x9a, 0x42d: 0x9a, 0x42e: 0x9a, 0x42f: 0x9a, + 0x430: 0x9a, 0x431: 0xa1, 0x432: 0x0e, 0x433: 0x9a, 0x434: 0x9a, 0x435: 0x9a, 0x436: 0x9a, 0x437: 0x9a, + 0x438: 0x0e, 0x439: 0x0e, 0x43a: 0x0e, 0x43b: 0xd4, 0x43c: 0x9a, 0x43d: 0x9a, 0x43e: 0x9a, 0x43f: 0x9a, + // Block 0x11, offset 0x440 + 0x440: 0xd5, 0x441: 0x54, 0x442: 0xd6, 0x443: 0xd7, 0x444: 0xd8, 0x445: 0xd9, + 0x449: 0xda, 0x44c: 0x54, 0x44d: 0x54, 0x44e: 0x54, 0x44f: 0x54, + 0x450: 0x54, 0x451: 0x54, 0x452: 0x54, 0x453: 0x54, 0x454: 0x54, 0x455: 0x54, 0x456: 0x54, 0x457: 0x54, + 0x458: 0x54, 0x459: 0x54, 0x45a: 0x54, 0x45b: 0xdb, 0x45c: 0x54, 0x45d: 0x6b, 0x45e: 0x54, 0x45f: 0xdc, + 0x460: 0xdd, 0x461: 0xde, 0x462: 0xdf, 0x464: 0xe0, 0x465: 0xe1, 0x466: 0xe2, 0x467: 0xe3, + 0x469: 0xe4, + 0x47f: 0xe5, + // Block 0x12, offset 0x480 + 0x4bf: 0xe5, + // Block 0x13, offset 0x4c0 + 0x4d0: 0x09, 0x4d1: 0x0a, 0x4d6: 0x0b, + 0x4db: 0x0c, 0x4dd: 0x0d, 0x4de: 0x0e, 0x4df: 0x0f, + 0x4ef: 0x10, + 0x4ff: 0x10, + // Block 0x14, offset 0x500 + 0x50f: 0x10, + 0x51f: 0x10, + 0x52f: 0x10, + 0x53f: 0x10, + // Block 0x15, offset 0x540 + 0x540: 0xe6, 0x541: 0xe6, 0x542: 0xe6, 0x543: 0xe6, 0x544: 0x05, 0x545: 0x05, 0x546: 0x05, 0x547: 0xe7, + 0x548: 0xe6, 0x549: 0xe6, 0x54a: 0xe6, 0x54b: 0xe6, 0x54c: 0xe6, 0x54d: 0xe6, 0x54e: 0xe6, 0x54f: 0xe6, + 0x550: 0xe6, 0x551: 0xe6, 0x552: 0xe6, 0x553: 0xe6, 0x554: 0xe6, 0x555: 0xe6, 0x556: 0xe6, 0x557: 0xe6, + 0x558: 0xe6, 0x559: 0xe6, 0x55a: 0xe6, 0x55b: 0xe6, 0x55c: 0xe6, 0x55d: 0xe6, 0x55e: 0xe6, 0x55f: 0xe6, + 0x560: 0xe6, 0x561: 0xe6, 0x562: 0xe6, 0x563: 0xe6, 0x564: 0xe6, 0x565: 0xe6, 0x566: 0xe6, 0x567: 0xe6, + 0x568: 0xe6, 0x569: 0xe6, 0x56a: 0xe6, 0x56b: 0xe6, 0x56c: 0xe6, 0x56d: 0xe6, 0x56e: 0xe6, 0x56f: 0xe6, + 0x570: 0xe6, 0x571: 0xe6, 0x572: 0xe6, 0x573: 0xe6, 0x574: 0xe6, 0x575: 0xe6, 0x576: 0xe6, 0x577: 0xe6, + 0x578: 0xe6, 0x579: 0xe6, 0x57a: 0xe6, 0x57b: 0xe6, 0x57c: 0xe6, 0x57d: 0xe6, 0x57e: 0xe6, 0x57f: 0xe6, + // Block 0x16, offset 0x580 + 0x58f: 0x10, + 0x59f: 0x10, + 0x5a0: 0x13, + 0x5af: 0x10, + 0x5bf: 0x10, + // Block 0x17, offset 0x5c0 + 0x5cf: 0x10, +} + +// Total table size 16568 bytes (16KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go b/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go new file mode 100644 index 0000000000..0ca0193ebe --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/tables9.0.0.go @@ -0,0 +1,1781 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// +build !go1.10 + +package bidi + +// UnicodeVersion is the Unicode version from which the tables in this package are derived. +const UnicodeVersion = "9.0.0" + +// xorMasks contains masks to be xor-ed with brackets to get the reverse +// version. +var xorMasks = []int32{ // 8 elements + 0, 1, 6, 7, 3, 15, 29, 63, +} // Size: 56 bytes + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookup(s []byte) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupUnsafe(s []byte) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *bidiTrie) lookupString(s string) (v uint8, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return bidiValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := bidiIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = bidiIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = bidiIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *bidiTrie) lookupStringUnsafe(s string) uint8 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return bidiValues[c0] + } + i := bidiIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = bidiIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// bidiTrie. Total size: 15744 bytes (15.38 KiB). Checksum: b4c3b70954803b86. +type bidiTrie struct{} + +func newBidiTrie(i int) *bidiTrie { + return &bidiTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *bidiTrie) lookupValue(n uint32, b byte) uint8 { + switch { + default: + return uint8(bidiValues[n<<6+uint32(b)]) + } +} + +// bidiValues: 222 blocks, 14208 entries, 14208 bytes +// The third block is the zero block. +var bidiValues = [14208]uint8{ + // Block 0x0, offset 0x0 + 0x00: 0x000b, 0x01: 0x000b, 0x02: 0x000b, 0x03: 0x000b, 0x04: 0x000b, 0x05: 0x000b, + 0x06: 0x000b, 0x07: 0x000b, 0x08: 0x000b, 0x09: 0x0008, 0x0a: 0x0007, 0x0b: 0x0008, + 0x0c: 0x0009, 0x0d: 0x0007, 0x0e: 0x000b, 0x0f: 0x000b, 0x10: 0x000b, 0x11: 0x000b, + 0x12: 0x000b, 0x13: 0x000b, 0x14: 0x000b, 0x15: 0x000b, 0x16: 0x000b, 0x17: 0x000b, + 0x18: 0x000b, 0x19: 0x000b, 0x1a: 0x000b, 0x1b: 0x000b, 0x1c: 0x0007, 0x1d: 0x0007, + 0x1e: 0x0007, 0x1f: 0x0008, 0x20: 0x0009, 0x21: 0x000a, 0x22: 0x000a, 0x23: 0x0004, + 0x24: 0x0004, 0x25: 0x0004, 0x26: 0x000a, 0x27: 0x000a, 0x28: 0x003a, 0x29: 0x002a, + 0x2a: 0x000a, 0x2b: 0x0003, 0x2c: 0x0006, 0x2d: 0x0003, 0x2e: 0x0006, 0x2f: 0x0006, + 0x30: 0x0002, 0x31: 0x0002, 0x32: 0x0002, 0x33: 0x0002, 0x34: 0x0002, 0x35: 0x0002, + 0x36: 0x0002, 0x37: 0x0002, 0x38: 0x0002, 0x39: 0x0002, 0x3a: 0x0006, 0x3b: 0x000a, + 0x3c: 0x000a, 0x3d: 0x000a, 0x3e: 0x000a, 0x3f: 0x000a, + // Block 0x1, offset 0x40 + 0x40: 0x000a, + 0x5b: 0x005a, 0x5c: 0x000a, 0x5d: 0x004a, + 0x5e: 0x000a, 0x5f: 0x000a, 0x60: 0x000a, + 0x7b: 0x005a, + 0x7c: 0x000a, 0x7d: 0x004a, 0x7e: 0x000a, 0x7f: 0x000b, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x000b, 0xc1: 0x000b, 0xc2: 0x000b, 0xc3: 0x000b, 0xc4: 0x000b, 0xc5: 0x0007, + 0xc6: 0x000b, 0xc7: 0x000b, 0xc8: 0x000b, 0xc9: 0x000b, 0xca: 0x000b, 0xcb: 0x000b, + 0xcc: 0x000b, 0xcd: 0x000b, 0xce: 0x000b, 0xcf: 0x000b, 0xd0: 0x000b, 0xd1: 0x000b, + 0xd2: 0x000b, 0xd3: 0x000b, 0xd4: 0x000b, 0xd5: 0x000b, 0xd6: 0x000b, 0xd7: 0x000b, + 0xd8: 0x000b, 0xd9: 0x000b, 0xda: 0x000b, 0xdb: 0x000b, 0xdc: 0x000b, 0xdd: 0x000b, + 0xde: 0x000b, 0xdf: 0x000b, 0xe0: 0x0006, 0xe1: 0x000a, 0xe2: 0x0004, 0xe3: 0x0004, + 0xe4: 0x0004, 0xe5: 0x0004, 0xe6: 0x000a, 0xe7: 0x000a, 0xe8: 0x000a, 0xe9: 0x000a, + 0xeb: 0x000a, 0xec: 0x000a, 0xed: 0x000b, 0xee: 0x000a, 0xef: 0x000a, + 0xf0: 0x0004, 0xf1: 0x0004, 0xf2: 0x0002, 0xf3: 0x0002, 0xf4: 0x000a, + 0xf6: 0x000a, 0xf7: 0x000a, 0xf8: 0x000a, 0xf9: 0x0002, 0xfb: 0x000a, + 0xfc: 0x000a, 0xfd: 0x000a, 0xfe: 0x000a, 0xff: 0x000a, + // Block 0x4, offset 0x100 + 0x117: 0x000a, + 0x137: 0x000a, + // Block 0x5, offset 0x140 + 0x179: 0x000a, 0x17a: 0x000a, + // Block 0x6, offset 0x180 + 0x182: 0x000a, 0x183: 0x000a, 0x184: 0x000a, 0x185: 0x000a, + 0x186: 0x000a, 0x187: 0x000a, 0x188: 0x000a, 0x189: 0x000a, 0x18a: 0x000a, 0x18b: 0x000a, + 0x18c: 0x000a, 0x18d: 0x000a, 0x18e: 0x000a, 0x18f: 0x000a, + 0x192: 0x000a, 0x193: 0x000a, 0x194: 0x000a, 0x195: 0x000a, 0x196: 0x000a, 0x197: 0x000a, + 0x198: 0x000a, 0x199: 0x000a, 0x19a: 0x000a, 0x19b: 0x000a, 0x19c: 0x000a, 0x19d: 0x000a, + 0x19e: 0x000a, 0x19f: 0x000a, + 0x1a5: 0x000a, 0x1a6: 0x000a, 0x1a7: 0x000a, 0x1a8: 0x000a, 0x1a9: 0x000a, + 0x1aa: 0x000a, 0x1ab: 0x000a, 0x1ac: 0x000a, 0x1ad: 0x000a, 0x1af: 0x000a, + 0x1b0: 0x000a, 0x1b1: 0x000a, 0x1b2: 0x000a, 0x1b3: 0x000a, 0x1b4: 0x000a, 0x1b5: 0x000a, + 0x1b6: 0x000a, 0x1b7: 0x000a, 0x1b8: 0x000a, 0x1b9: 0x000a, 0x1ba: 0x000a, 0x1bb: 0x000a, + 0x1bc: 0x000a, 0x1bd: 0x000a, 0x1be: 0x000a, 0x1bf: 0x000a, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x000c, 0x1c1: 0x000c, 0x1c2: 0x000c, 0x1c3: 0x000c, 0x1c4: 0x000c, 0x1c5: 0x000c, + 0x1c6: 0x000c, 0x1c7: 0x000c, 0x1c8: 0x000c, 0x1c9: 0x000c, 0x1ca: 0x000c, 0x1cb: 0x000c, + 0x1cc: 0x000c, 0x1cd: 0x000c, 0x1ce: 0x000c, 0x1cf: 0x000c, 0x1d0: 0x000c, 0x1d1: 0x000c, + 0x1d2: 0x000c, 0x1d3: 0x000c, 0x1d4: 0x000c, 0x1d5: 0x000c, 0x1d6: 0x000c, 0x1d7: 0x000c, + 0x1d8: 0x000c, 0x1d9: 0x000c, 0x1da: 0x000c, 0x1db: 0x000c, 0x1dc: 0x000c, 0x1dd: 0x000c, + 0x1de: 0x000c, 0x1df: 0x000c, 0x1e0: 0x000c, 0x1e1: 0x000c, 0x1e2: 0x000c, 0x1e3: 0x000c, + 0x1e4: 0x000c, 0x1e5: 0x000c, 0x1e6: 0x000c, 0x1e7: 0x000c, 0x1e8: 0x000c, 0x1e9: 0x000c, + 0x1ea: 0x000c, 0x1eb: 0x000c, 0x1ec: 0x000c, 0x1ed: 0x000c, 0x1ee: 0x000c, 0x1ef: 0x000c, + 0x1f0: 0x000c, 0x1f1: 0x000c, 0x1f2: 0x000c, 0x1f3: 0x000c, 0x1f4: 0x000c, 0x1f5: 0x000c, + 0x1f6: 0x000c, 0x1f7: 0x000c, 0x1f8: 0x000c, 0x1f9: 0x000c, 0x1fa: 0x000c, 0x1fb: 0x000c, + 0x1fc: 0x000c, 0x1fd: 0x000c, 0x1fe: 0x000c, 0x1ff: 0x000c, + // Block 0x8, offset 0x200 + 0x200: 0x000c, 0x201: 0x000c, 0x202: 0x000c, 0x203: 0x000c, 0x204: 0x000c, 0x205: 0x000c, + 0x206: 0x000c, 0x207: 0x000c, 0x208: 0x000c, 0x209: 0x000c, 0x20a: 0x000c, 0x20b: 0x000c, + 0x20c: 0x000c, 0x20d: 0x000c, 0x20e: 0x000c, 0x20f: 0x000c, 0x210: 0x000c, 0x211: 0x000c, + 0x212: 0x000c, 0x213: 0x000c, 0x214: 0x000c, 0x215: 0x000c, 0x216: 0x000c, 0x217: 0x000c, + 0x218: 0x000c, 0x219: 0x000c, 0x21a: 0x000c, 0x21b: 0x000c, 0x21c: 0x000c, 0x21d: 0x000c, + 0x21e: 0x000c, 0x21f: 0x000c, 0x220: 0x000c, 0x221: 0x000c, 0x222: 0x000c, 0x223: 0x000c, + 0x224: 0x000c, 0x225: 0x000c, 0x226: 0x000c, 0x227: 0x000c, 0x228: 0x000c, 0x229: 0x000c, + 0x22a: 0x000c, 0x22b: 0x000c, 0x22c: 0x000c, 0x22d: 0x000c, 0x22e: 0x000c, 0x22f: 0x000c, + 0x234: 0x000a, 0x235: 0x000a, + 0x23e: 0x000a, + // Block 0x9, offset 0x240 + 0x244: 0x000a, 0x245: 0x000a, + 0x247: 0x000a, + // Block 0xa, offset 0x280 + 0x2b6: 0x000a, + // Block 0xb, offset 0x2c0 + 0x2c3: 0x000c, 0x2c4: 0x000c, 0x2c5: 0x000c, + 0x2c6: 0x000c, 0x2c7: 0x000c, 0x2c8: 0x000c, 0x2c9: 0x000c, + // Block 0xc, offset 0x300 + 0x30a: 0x000a, + 0x30d: 0x000a, 0x30e: 0x000a, 0x30f: 0x0004, 0x310: 0x0001, 0x311: 0x000c, + 0x312: 0x000c, 0x313: 0x000c, 0x314: 0x000c, 0x315: 0x000c, 0x316: 0x000c, 0x317: 0x000c, + 0x318: 0x000c, 0x319: 0x000c, 0x31a: 0x000c, 0x31b: 0x000c, 0x31c: 0x000c, 0x31d: 0x000c, + 0x31e: 0x000c, 0x31f: 0x000c, 0x320: 0x000c, 0x321: 0x000c, 0x322: 0x000c, 0x323: 0x000c, + 0x324: 0x000c, 0x325: 0x000c, 0x326: 0x000c, 0x327: 0x000c, 0x328: 0x000c, 0x329: 0x000c, + 0x32a: 0x000c, 0x32b: 0x000c, 0x32c: 0x000c, 0x32d: 0x000c, 0x32e: 0x000c, 0x32f: 0x000c, + 0x330: 0x000c, 0x331: 0x000c, 0x332: 0x000c, 0x333: 0x000c, 0x334: 0x000c, 0x335: 0x000c, + 0x336: 0x000c, 0x337: 0x000c, 0x338: 0x000c, 0x339: 0x000c, 0x33a: 0x000c, 0x33b: 0x000c, + 0x33c: 0x000c, 0x33d: 0x000c, 0x33e: 0x0001, 0x33f: 0x000c, + // Block 0xd, offset 0x340 + 0x340: 0x0001, 0x341: 0x000c, 0x342: 0x000c, 0x343: 0x0001, 0x344: 0x000c, 0x345: 0x000c, + 0x346: 0x0001, 0x347: 0x000c, 0x348: 0x0001, 0x349: 0x0001, 0x34a: 0x0001, 0x34b: 0x0001, + 0x34c: 0x0001, 0x34d: 0x0001, 0x34e: 0x0001, 0x34f: 0x0001, 0x350: 0x0001, 0x351: 0x0001, + 0x352: 0x0001, 0x353: 0x0001, 0x354: 0x0001, 0x355: 0x0001, 0x356: 0x0001, 0x357: 0x0001, + 0x358: 0x0001, 0x359: 0x0001, 0x35a: 0x0001, 0x35b: 0x0001, 0x35c: 0x0001, 0x35d: 0x0001, + 0x35e: 0x0001, 0x35f: 0x0001, 0x360: 0x0001, 0x361: 0x0001, 0x362: 0x0001, 0x363: 0x0001, + 0x364: 0x0001, 0x365: 0x0001, 0x366: 0x0001, 0x367: 0x0001, 0x368: 0x0001, 0x369: 0x0001, + 0x36a: 0x0001, 0x36b: 0x0001, 0x36c: 0x0001, 0x36d: 0x0001, 0x36e: 0x0001, 0x36f: 0x0001, + 0x370: 0x0001, 0x371: 0x0001, 0x372: 0x0001, 0x373: 0x0001, 0x374: 0x0001, 0x375: 0x0001, + 0x376: 0x0001, 0x377: 0x0001, 0x378: 0x0001, 0x379: 0x0001, 0x37a: 0x0001, 0x37b: 0x0001, + 0x37c: 0x0001, 0x37d: 0x0001, 0x37e: 0x0001, 0x37f: 0x0001, + // Block 0xe, offset 0x380 + 0x380: 0x0005, 0x381: 0x0005, 0x382: 0x0005, 0x383: 0x0005, 0x384: 0x0005, 0x385: 0x0005, + 0x386: 0x000a, 0x387: 0x000a, 0x388: 0x000d, 0x389: 0x0004, 0x38a: 0x0004, 0x38b: 0x000d, + 0x38c: 0x0006, 0x38d: 0x000d, 0x38e: 0x000a, 0x38f: 0x000a, 0x390: 0x000c, 0x391: 0x000c, + 0x392: 0x000c, 0x393: 0x000c, 0x394: 0x000c, 0x395: 0x000c, 0x396: 0x000c, 0x397: 0x000c, + 0x398: 0x000c, 0x399: 0x000c, 0x39a: 0x000c, 0x39b: 0x000d, 0x39c: 0x000d, 0x39d: 0x000d, + 0x39e: 0x000d, 0x39f: 0x000d, 0x3a0: 0x000d, 0x3a1: 0x000d, 0x3a2: 0x000d, 0x3a3: 0x000d, + 0x3a4: 0x000d, 0x3a5: 0x000d, 0x3a6: 0x000d, 0x3a7: 0x000d, 0x3a8: 0x000d, 0x3a9: 0x000d, + 0x3aa: 0x000d, 0x3ab: 0x000d, 0x3ac: 0x000d, 0x3ad: 0x000d, 0x3ae: 0x000d, 0x3af: 0x000d, + 0x3b0: 0x000d, 0x3b1: 0x000d, 0x3b2: 0x000d, 0x3b3: 0x000d, 0x3b4: 0x000d, 0x3b5: 0x000d, + 0x3b6: 0x000d, 0x3b7: 0x000d, 0x3b8: 0x000d, 0x3b9: 0x000d, 0x3ba: 0x000d, 0x3bb: 0x000d, + 0x3bc: 0x000d, 0x3bd: 0x000d, 0x3be: 0x000d, 0x3bf: 0x000d, + // Block 0xf, offset 0x3c0 + 0x3c0: 0x000d, 0x3c1: 0x000d, 0x3c2: 0x000d, 0x3c3: 0x000d, 0x3c4: 0x000d, 0x3c5: 0x000d, + 0x3c6: 0x000d, 0x3c7: 0x000d, 0x3c8: 0x000d, 0x3c9: 0x000d, 0x3ca: 0x000d, 0x3cb: 0x000c, + 0x3cc: 0x000c, 0x3cd: 0x000c, 0x3ce: 0x000c, 0x3cf: 0x000c, 0x3d0: 0x000c, 0x3d1: 0x000c, + 0x3d2: 0x000c, 0x3d3: 0x000c, 0x3d4: 0x000c, 0x3d5: 0x000c, 0x3d6: 0x000c, 0x3d7: 0x000c, + 0x3d8: 0x000c, 0x3d9: 0x000c, 0x3da: 0x000c, 0x3db: 0x000c, 0x3dc: 0x000c, 0x3dd: 0x000c, + 0x3de: 0x000c, 0x3df: 0x000c, 0x3e0: 0x0005, 0x3e1: 0x0005, 0x3e2: 0x0005, 0x3e3: 0x0005, + 0x3e4: 0x0005, 0x3e5: 0x0005, 0x3e6: 0x0005, 0x3e7: 0x0005, 0x3e8: 0x0005, 0x3e9: 0x0005, + 0x3ea: 0x0004, 0x3eb: 0x0005, 0x3ec: 0x0005, 0x3ed: 0x000d, 0x3ee: 0x000d, 0x3ef: 0x000d, + 0x3f0: 0x000c, 0x3f1: 0x000d, 0x3f2: 0x000d, 0x3f3: 0x000d, 0x3f4: 0x000d, 0x3f5: 0x000d, + 0x3f6: 0x000d, 0x3f7: 0x000d, 0x3f8: 0x000d, 0x3f9: 0x000d, 0x3fa: 0x000d, 0x3fb: 0x000d, + 0x3fc: 0x000d, 0x3fd: 0x000d, 0x3fe: 0x000d, 0x3ff: 0x000d, + // Block 0x10, offset 0x400 + 0x400: 0x000d, 0x401: 0x000d, 0x402: 0x000d, 0x403: 0x000d, 0x404: 0x000d, 0x405: 0x000d, + 0x406: 0x000d, 0x407: 0x000d, 0x408: 0x000d, 0x409: 0x000d, 0x40a: 0x000d, 0x40b: 0x000d, + 0x40c: 0x000d, 0x40d: 0x000d, 0x40e: 0x000d, 0x40f: 0x000d, 0x410: 0x000d, 0x411: 0x000d, + 0x412: 0x000d, 0x413: 0x000d, 0x414: 0x000d, 0x415: 0x000d, 0x416: 0x000d, 0x417: 0x000d, + 0x418: 0x000d, 0x419: 0x000d, 0x41a: 0x000d, 0x41b: 0x000d, 0x41c: 0x000d, 0x41d: 0x000d, + 0x41e: 0x000d, 0x41f: 0x000d, 0x420: 0x000d, 0x421: 0x000d, 0x422: 0x000d, 0x423: 0x000d, + 0x424: 0x000d, 0x425: 0x000d, 0x426: 0x000d, 0x427: 0x000d, 0x428: 0x000d, 0x429: 0x000d, + 0x42a: 0x000d, 0x42b: 0x000d, 0x42c: 0x000d, 0x42d: 0x000d, 0x42e: 0x000d, 0x42f: 0x000d, + 0x430: 0x000d, 0x431: 0x000d, 0x432: 0x000d, 0x433: 0x000d, 0x434: 0x000d, 0x435: 0x000d, + 0x436: 0x000d, 0x437: 0x000d, 0x438: 0x000d, 0x439: 0x000d, 0x43a: 0x000d, 0x43b: 0x000d, + 0x43c: 0x000d, 0x43d: 0x000d, 0x43e: 0x000d, 0x43f: 0x000d, + // Block 0x11, offset 0x440 + 0x440: 0x000d, 0x441: 0x000d, 0x442: 0x000d, 0x443: 0x000d, 0x444: 0x000d, 0x445: 0x000d, + 0x446: 0x000d, 0x447: 0x000d, 0x448: 0x000d, 0x449: 0x000d, 0x44a: 0x000d, 0x44b: 0x000d, + 0x44c: 0x000d, 0x44d: 0x000d, 0x44e: 0x000d, 0x44f: 0x000d, 0x450: 0x000d, 0x451: 0x000d, + 0x452: 0x000d, 0x453: 0x000d, 0x454: 0x000d, 0x455: 0x000d, 0x456: 0x000c, 0x457: 0x000c, + 0x458: 0x000c, 0x459: 0x000c, 0x45a: 0x000c, 0x45b: 0x000c, 0x45c: 0x000c, 0x45d: 0x0005, + 0x45e: 0x000a, 0x45f: 0x000c, 0x460: 0x000c, 0x461: 0x000c, 0x462: 0x000c, 0x463: 0x000c, + 0x464: 0x000c, 0x465: 0x000d, 0x466: 0x000d, 0x467: 0x000c, 0x468: 0x000c, 0x469: 0x000a, + 0x46a: 0x000c, 0x46b: 0x000c, 0x46c: 0x000c, 0x46d: 0x000c, 0x46e: 0x000d, 0x46f: 0x000d, + 0x470: 0x0002, 0x471: 0x0002, 0x472: 0x0002, 0x473: 0x0002, 0x474: 0x0002, 0x475: 0x0002, + 0x476: 0x0002, 0x477: 0x0002, 0x478: 0x0002, 0x479: 0x0002, 0x47a: 0x000d, 0x47b: 0x000d, + 0x47c: 0x000d, 0x47d: 0x000d, 0x47e: 0x000d, 0x47f: 0x000d, + // Block 0x12, offset 0x480 + 0x480: 0x000d, 0x481: 0x000d, 0x482: 0x000d, 0x483: 0x000d, 0x484: 0x000d, 0x485: 0x000d, + 0x486: 0x000d, 0x487: 0x000d, 0x488: 0x000d, 0x489: 0x000d, 0x48a: 0x000d, 0x48b: 0x000d, + 0x48c: 0x000d, 0x48d: 0x000d, 0x48e: 0x000d, 0x48f: 0x000d, 0x490: 0x000d, 0x491: 0x000c, + 0x492: 0x000d, 0x493: 0x000d, 0x494: 0x000d, 0x495: 0x000d, 0x496: 0x000d, 0x497: 0x000d, + 0x498: 0x000d, 0x499: 0x000d, 0x49a: 0x000d, 0x49b: 0x000d, 0x49c: 0x000d, 0x49d: 0x000d, + 0x49e: 0x000d, 0x49f: 0x000d, 0x4a0: 0x000d, 0x4a1: 0x000d, 0x4a2: 0x000d, 0x4a3: 0x000d, + 0x4a4: 0x000d, 0x4a5: 0x000d, 0x4a6: 0x000d, 0x4a7: 0x000d, 0x4a8: 0x000d, 0x4a9: 0x000d, + 0x4aa: 0x000d, 0x4ab: 0x000d, 0x4ac: 0x000d, 0x4ad: 0x000d, 0x4ae: 0x000d, 0x4af: 0x000d, + 0x4b0: 0x000c, 0x4b1: 0x000c, 0x4b2: 0x000c, 0x4b3: 0x000c, 0x4b4: 0x000c, 0x4b5: 0x000c, + 0x4b6: 0x000c, 0x4b7: 0x000c, 0x4b8: 0x000c, 0x4b9: 0x000c, 0x4ba: 0x000c, 0x4bb: 0x000c, + 0x4bc: 0x000c, 0x4bd: 0x000c, 0x4be: 0x000c, 0x4bf: 0x000c, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x000c, 0x4c1: 0x000c, 0x4c2: 0x000c, 0x4c3: 0x000c, 0x4c4: 0x000c, 0x4c5: 0x000c, + 0x4c6: 0x000c, 0x4c7: 0x000c, 0x4c8: 0x000c, 0x4c9: 0x000c, 0x4ca: 0x000c, 0x4cb: 0x000d, + 0x4cc: 0x000d, 0x4cd: 0x000d, 0x4ce: 0x000d, 0x4cf: 0x000d, 0x4d0: 0x000d, 0x4d1: 0x000d, + 0x4d2: 0x000d, 0x4d3: 0x000d, 0x4d4: 0x000d, 0x4d5: 0x000d, 0x4d6: 0x000d, 0x4d7: 0x000d, + 0x4d8: 0x000d, 0x4d9: 0x000d, 0x4da: 0x000d, 0x4db: 0x000d, 0x4dc: 0x000d, 0x4dd: 0x000d, + 0x4de: 0x000d, 0x4df: 0x000d, 0x4e0: 0x000d, 0x4e1: 0x000d, 0x4e2: 0x000d, 0x4e3: 0x000d, + 0x4e4: 0x000d, 0x4e5: 0x000d, 0x4e6: 0x000d, 0x4e7: 0x000d, 0x4e8: 0x000d, 0x4e9: 0x000d, + 0x4ea: 0x000d, 0x4eb: 0x000d, 0x4ec: 0x000d, 0x4ed: 0x000d, 0x4ee: 0x000d, 0x4ef: 0x000d, + 0x4f0: 0x000d, 0x4f1: 0x000d, 0x4f2: 0x000d, 0x4f3: 0x000d, 0x4f4: 0x000d, 0x4f5: 0x000d, + 0x4f6: 0x000d, 0x4f7: 0x000d, 0x4f8: 0x000d, 0x4f9: 0x000d, 0x4fa: 0x000d, 0x4fb: 0x000d, + 0x4fc: 0x000d, 0x4fd: 0x000d, 0x4fe: 0x000d, 0x4ff: 0x000d, + // Block 0x14, offset 0x500 + 0x500: 0x000d, 0x501: 0x000d, 0x502: 0x000d, 0x503: 0x000d, 0x504: 0x000d, 0x505: 0x000d, + 0x506: 0x000d, 0x507: 0x000d, 0x508: 0x000d, 0x509: 0x000d, 0x50a: 0x000d, 0x50b: 0x000d, + 0x50c: 0x000d, 0x50d: 0x000d, 0x50e: 0x000d, 0x50f: 0x000d, 0x510: 0x000d, 0x511: 0x000d, + 0x512: 0x000d, 0x513: 0x000d, 0x514: 0x000d, 0x515: 0x000d, 0x516: 0x000d, 0x517: 0x000d, + 0x518: 0x000d, 0x519: 0x000d, 0x51a: 0x000d, 0x51b: 0x000d, 0x51c: 0x000d, 0x51d: 0x000d, + 0x51e: 0x000d, 0x51f: 0x000d, 0x520: 0x000d, 0x521: 0x000d, 0x522: 0x000d, 0x523: 0x000d, + 0x524: 0x000d, 0x525: 0x000d, 0x526: 0x000c, 0x527: 0x000c, 0x528: 0x000c, 0x529: 0x000c, + 0x52a: 0x000c, 0x52b: 0x000c, 0x52c: 0x000c, 0x52d: 0x000c, 0x52e: 0x000c, 0x52f: 0x000c, + 0x530: 0x000c, 0x531: 0x000d, 0x532: 0x000d, 0x533: 0x000d, 0x534: 0x000d, 0x535: 0x000d, + 0x536: 0x000d, 0x537: 0x000d, 0x538: 0x000d, 0x539: 0x000d, 0x53a: 0x000d, 0x53b: 0x000d, + 0x53c: 0x000d, 0x53d: 0x000d, 0x53e: 0x000d, 0x53f: 0x000d, + // Block 0x15, offset 0x540 + 0x540: 0x0001, 0x541: 0x0001, 0x542: 0x0001, 0x543: 0x0001, 0x544: 0x0001, 0x545: 0x0001, + 0x546: 0x0001, 0x547: 0x0001, 0x548: 0x0001, 0x549: 0x0001, 0x54a: 0x0001, 0x54b: 0x0001, + 0x54c: 0x0001, 0x54d: 0x0001, 0x54e: 0x0001, 0x54f: 0x0001, 0x550: 0x0001, 0x551: 0x0001, + 0x552: 0x0001, 0x553: 0x0001, 0x554: 0x0001, 0x555: 0x0001, 0x556: 0x0001, 0x557: 0x0001, + 0x558: 0x0001, 0x559: 0x0001, 0x55a: 0x0001, 0x55b: 0x0001, 0x55c: 0x0001, 0x55d: 0x0001, + 0x55e: 0x0001, 0x55f: 0x0001, 0x560: 0x0001, 0x561: 0x0001, 0x562: 0x0001, 0x563: 0x0001, + 0x564: 0x0001, 0x565: 0x0001, 0x566: 0x0001, 0x567: 0x0001, 0x568: 0x0001, 0x569: 0x0001, + 0x56a: 0x0001, 0x56b: 0x000c, 0x56c: 0x000c, 0x56d: 0x000c, 0x56e: 0x000c, 0x56f: 0x000c, + 0x570: 0x000c, 0x571: 0x000c, 0x572: 0x000c, 0x573: 0x000c, 0x574: 0x0001, 0x575: 0x0001, + 0x576: 0x000a, 0x577: 0x000a, 0x578: 0x000a, 0x579: 0x000a, 0x57a: 0x0001, 0x57b: 0x0001, + 0x57c: 0x0001, 0x57d: 0x0001, 0x57e: 0x0001, 0x57f: 0x0001, + // Block 0x16, offset 0x580 + 0x580: 0x0001, 0x581: 0x0001, 0x582: 0x0001, 0x583: 0x0001, 0x584: 0x0001, 0x585: 0x0001, + 0x586: 0x0001, 0x587: 0x0001, 0x588: 0x0001, 0x589: 0x0001, 0x58a: 0x0001, 0x58b: 0x0001, + 0x58c: 0x0001, 0x58d: 0x0001, 0x58e: 0x0001, 0x58f: 0x0001, 0x590: 0x0001, 0x591: 0x0001, + 0x592: 0x0001, 0x593: 0x0001, 0x594: 0x0001, 0x595: 0x0001, 0x596: 0x000c, 0x597: 0x000c, + 0x598: 0x000c, 0x599: 0x000c, 0x59a: 0x0001, 0x59b: 0x000c, 0x59c: 0x000c, 0x59d: 0x000c, + 0x59e: 0x000c, 0x59f: 0x000c, 0x5a0: 0x000c, 0x5a1: 0x000c, 0x5a2: 0x000c, 0x5a3: 0x000c, + 0x5a4: 0x0001, 0x5a5: 0x000c, 0x5a6: 0x000c, 0x5a7: 0x000c, 0x5a8: 0x0001, 0x5a9: 0x000c, + 0x5aa: 0x000c, 0x5ab: 0x000c, 0x5ac: 0x000c, 0x5ad: 0x000c, 0x5ae: 0x0001, 0x5af: 0x0001, + 0x5b0: 0x0001, 0x5b1: 0x0001, 0x5b2: 0x0001, 0x5b3: 0x0001, 0x5b4: 0x0001, 0x5b5: 0x0001, + 0x5b6: 0x0001, 0x5b7: 0x0001, 0x5b8: 0x0001, 0x5b9: 0x0001, 0x5ba: 0x0001, 0x5bb: 0x0001, + 0x5bc: 0x0001, 0x5bd: 0x0001, 0x5be: 0x0001, 0x5bf: 0x0001, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x0001, 0x5c1: 0x0001, 0x5c2: 0x0001, 0x5c3: 0x0001, 0x5c4: 0x0001, 0x5c5: 0x0001, + 0x5c6: 0x0001, 0x5c7: 0x0001, 0x5c8: 0x0001, 0x5c9: 0x0001, 0x5ca: 0x0001, 0x5cb: 0x0001, + 0x5cc: 0x0001, 0x5cd: 0x0001, 0x5ce: 0x0001, 0x5cf: 0x0001, 0x5d0: 0x0001, 0x5d1: 0x0001, + 0x5d2: 0x0001, 0x5d3: 0x0001, 0x5d4: 0x0001, 0x5d5: 0x0001, 0x5d6: 0x0001, 0x5d7: 0x0001, + 0x5d8: 0x0001, 0x5d9: 0x000c, 0x5da: 0x000c, 0x5db: 0x000c, 0x5dc: 0x0001, 0x5dd: 0x0001, + 0x5de: 0x0001, 0x5df: 0x0001, 0x5e0: 0x0001, 0x5e1: 0x0001, 0x5e2: 0x0001, 0x5e3: 0x0001, + 0x5e4: 0x0001, 0x5e5: 0x0001, 0x5e6: 0x0001, 0x5e7: 0x0001, 0x5e8: 0x0001, 0x5e9: 0x0001, + 0x5ea: 0x0001, 0x5eb: 0x0001, 0x5ec: 0x0001, 0x5ed: 0x0001, 0x5ee: 0x0001, 0x5ef: 0x0001, + 0x5f0: 0x0001, 0x5f1: 0x0001, 0x5f2: 0x0001, 0x5f3: 0x0001, 0x5f4: 0x0001, 0x5f5: 0x0001, + 0x5f6: 0x0001, 0x5f7: 0x0001, 0x5f8: 0x0001, 0x5f9: 0x0001, 0x5fa: 0x0001, 0x5fb: 0x0001, + 0x5fc: 0x0001, 0x5fd: 0x0001, 0x5fe: 0x0001, 0x5ff: 0x0001, + // Block 0x18, offset 0x600 + 0x600: 0x0001, 0x601: 0x0001, 0x602: 0x0001, 0x603: 0x0001, 0x604: 0x0001, 0x605: 0x0001, + 0x606: 0x0001, 0x607: 0x0001, 0x608: 0x0001, 0x609: 0x0001, 0x60a: 0x0001, 0x60b: 0x0001, + 0x60c: 0x0001, 0x60d: 0x0001, 0x60e: 0x0001, 0x60f: 0x0001, 0x610: 0x0001, 0x611: 0x0001, + 0x612: 0x0001, 0x613: 0x0001, 0x614: 0x0001, 0x615: 0x0001, 0x616: 0x0001, 0x617: 0x0001, + 0x618: 0x0001, 0x619: 0x0001, 0x61a: 0x0001, 0x61b: 0x0001, 0x61c: 0x0001, 0x61d: 0x0001, + 0x61e: 0x0001, 0x61f: 0x0001, 0x620: 0x000d, 0x621: 0x000d, 0x622: 0x000d, 0x623: 0x000d, + 0x624: 0x000d, 0x625: 0x000d, 0x626: 0x000d, 0x627: 0x000d, 0x628: 0x000d, 0x629: 0x000d, + 0x62a: 0x000d, 0x62b: 0x000d, 0x62c: 0x000d, 0x62d: 0x000d, 0x62e: 0x000d, 0x62f: 0x000d, + 0x630: 0x000d, 0x631: 0x000d, 0x632: 0x000d, 0x633: 0x000d, 0x634: 0x000d, 0x635: 0x000d, + 0x636: 0x000d, 0x637: 0x000d, 0x638: 0x000d, 0x639: 0x000d, 0x63a: 0x000d, 0x63b: 0x000d, + 0x63c: 0x000d, 0x63d: 0x000d, 0x63e: 0x000d, 0x63f: 0x000d, + // Block 0x19, offset 0x640 + 0x640: 0x000d, 0x641: 0x000d, 0x642: 0x000d, 0x643: 0x000d, 0x644: 0x000d, 0x645: 0x000d, + 0x646: 0x000d, 0x647: 0x000d, 0x648: 0x000d, 0x649: 0x000d, 0x64a: 0x000d, 0x64b: 0x000d, + 0x64c: 0x000d, 0x64d: 0x000d, 0x64e: 0x000d, 0x64f: 0x000d, 0x650: 0x000d, 0x651: 0x000d, + 0x652: 0x000d, 0x653: 0x000d, 0x654: 0x000c, 0x655: 0x000c, 0x656: 0x000c, 0x657: 0x000c, + 0x658: 0x000c, 0x659: 0x000c, 0x65a: 0x000c, 0x65b: 0x000c, 0x65c: 0x000c, 0x65d: 0x000c, + 0x65e: 0x000c, 0x65f: 0x000c, 0x660: 0x000c, 0x661: 0x000c, 0x662: 0x0005, 0x663: 0x000c, + 0x664: 0x000c, 0x665: 0x000c, 0x666: 0x000c, 0x667: 0x000c, 0x668: 0x000c, 0x669: 0x000c, + 0x66a: 0x000c, 0x66b: 0x000c, 0x66c: 0x000c, 0x66d: 0x000c, 0x66e: 0x000c, 0x66f: 0x000c, + 0x670: 0x000c, 0x671: 0x000c, 0x672: 0x000c, 0x673: 0x000c, 0x674: 0x000c, 0x675: 0x000c, + 0x676: 0x000c, 0x677: 0x000c, 0x678: 0x000c, 0x679: 0x000c, 0x67a: 0x000c, 0x67b: 0x000c, + 0x67c: 0x000c, 0x67d: 0x000c, 0x67e: 0x000c, 0x67f: 0x000c, + // Block 0x1a, offset 0x680 + 0x680: 0x000c, 0x681: 0x000c, 0x682: 0x000c, + 0x6ba: 0x000c, + 0x6bc: 0x000c, + // Block 0x1b, offset 0x6c0 + 0x6c1: 0x000c, 0x6c2: 0x000c, 0x6c3: 0x000c, 0x6c4: 0x000c, 0x6c5: 0x000c, + 0x6c6: 0x000c, 0x6c7: 0x000c, 0x6c8: 0x000c, + 0x6cd: 0x000c, 0x6d1: 0x000c, + 0x6d2: 0x000c, 0x6d3: 0x000c, 0x6d4: 0x000c, 0x6d5: 0x000c, 0x6d6: 0x000c, 0x6d7: 0x000c, + 0x6e2: 0x000c, 0x6e3: 0x000c, + // Block 0x1c, offset 0x700 + 0x701: 0x000c, + 0x73c: 0x000c, + // Block 0x1d, offset 0x740 + 0x741: 0x000c, 0x742: 0x000c, 0x743: 0x000c, 0x744: 0x000c, + 0x74d: 0x000c, + 0x762: 0x000c, 0x763: 0x000c, + 0x772: 0x0004, 0x773: 0x0004, + 0x77b: 0x0004, + // Block 0x1e, offset 0x780 + 0x781: 0x000c, 0x782: 0x000c, + 0x7bc: 0x000c, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x000c, 0x7c2: 0x000c, + 0x7c7: 0x000c, 0x7c8: 0x000c, 0x7cb: 0x000c, + 0x7cc: 0x000c, 0x7cd: 0x000c, 0x7d1: 0x000c, + 0x7f0: 0x000c, 0x7f1: 0x000c, 0x7f5: 0x000c, + // Block 0x20, offset 0x800 + 0x801: 0x000c, 0x802: 0x000c, 0x803: 0x000c, 0x804: 0x000c, 0x805: 0x000c, + 0x807: 0x000c, 0x808: 0x000c, + 0x80d: 0x000c, + 0x822: 0x000c, 0x823: 0x000c, + 0x831: 0x0004, + // Block 0x21, offset 0x840 + 0x841: 0x000c, + 0x87c: 0x000c, 0x87f: 0x000c, + // Block 0x22, offset 0x880 + 0x881: 0x000c, 0x882: 0x000c, 0x883: 0x000c, 0x884: 0x000c, + 0x88d: 0x000c, + 0x896: 0x000c, + 0x8a2: 0x000c, 0x8a3: 0x000c, + // Block 0x23, offset 0x8c0 + 0x8c2: 0x000c, + // Block 0x24, offset 0x900 + 0x900: 0x000c, + 0x90d: 0x000c, + 0x933: 0x000a, 0x934: 0x000a, 0x935: 0x000a, + 0x936: 0x000a, 0x937: 0x000a, 0x938: 0x000a, 0x939: 0x0004, 0x93a: 0x000a, + // Block 0x25, offset 0x940 + 0x940: 0x000c, + 0x97e: 0x000c, 0x97f: 0x000c, + // Block 0x26, offset 0x980 + 0x980: 0x000c, + 0x986: 0x000c, 0x987: 0x000c, 0x988: 0x000c, 0x98a: 0x000c, 0x98b: 0x000c, + 0x98c: 0x000c, 0x98d: 0x000c, + 0x995: 0x000c, 0x996: 0x000c, + 0x9a2: 0x000c, 0x9a3: 0x000c, + 0x9b8: 0x000a, 0x9b9: 0x000a, 0x9ba: 0x000a, 0x9bb: 0x000a, + 0x9bc: 0x000a, 0x9bd: 0x000a, 0x9be: 0x000a, + // Block 0x27, offset 0x9c0 + 0x9cc: 0x000c, 0x9cd: 0x000c, + 0x9e2: 0x000c, 0x9e3: 0x000c, + // Block 0x28, offset 0xa00 + 0xa01: 0x000c, + // Block 0x29, offset 0xa40 + 0xa41: 0x000c, 0xa42: 0x000c, 0xa43: 0x000c, 0xa44: 0x000c, + 0xa4d: 0x000c, + 0xa62: 0x000c, 0xa63: 0x000c, + // Block 0x2a, offset 0xa80 + 0xa8a: 0x000c, + 0xa92: 0x000c, 0xa93: 0x000c, 0xa94: 0x000c, 0xa96: 0x000c, + // Block 0x2b, offset 0xac0 + 0xaf1: 0x000c, 0xaf4: 0x000c, 0xaf5: 0x000c, + 0xaf6: 0x000c, 0xaf7: 0x000c, 0xaf8: 0x000c, 0xaf9: 0x000c, 0xafa: 0x000c, + 0xaff: 0x0004, + // Block 0x2c, offset 0xb00 + 0xb07: 0x000c, 0xb08: 0x000c, 0xb09: 0x000c, 0xb0a: 0x000c, 0xb0b: 0x000c, + 0xb0c: 0x000c, 0xb0d: 0x000c, 0xb0e: 0x000c, + // Block 0x2d, offset 0xb40 + 0xb71: 0x000c, 0xb74: 0x000c, 0xb75: 0x000c, + 0xb76: 0x000c, 0xb77: 0x000c, 0xb78: 0x000c, 0xb79: 0x000c, 0xb7b: 0x000c, + 0xb7c: 0x000c, + // Block 0x2e, offset 0xb80 + 0xb88: 0x000c, 0xb89: 0x000c, 0xb8a: 0x000c, 0xb8b: 0x000c, + 0xb8c: 0x000c, 0xb8d: 0x000c, + // Block 0x2f, offset 0xbc0 + 0xbd8: 0x000c, 0xbd9: 0x000c, + 0xbf5: 0x000c, + 0xbf7: 0x000c, 0xbf9: 0x000c, 0xbfa: 0x003a, 0xbfb: 0x002a, + 0xbfc: 0x003a, 0xbfd: 0x002a, + // Block 0x30, offset 0xc00 + 0xc31: 0x000c, 0xc32: 0x000c, 0xc33: 0x000c, 0xc34: 0x000c, 0xc35: 0x000c, + 0xc36: 0x000c, 0xc37: 0x000c, 0xc38: 0x000c, 0xc39: 0x000c, 0xc3a: 0x000c, 0xc3b: 0x000c, + 0xc3c: 0x000c, 0xc3d: 0x000c, 0xc3e: 0x000c, + // Block 0x31, offset 0xc40 + 0xc40: 0x000c, 0xc41: 0x000c, 0xc42: 0x000c, 0xc43: 0x000c, 0xc44: 0x000c, + 0xc46: 0x000c, 0xc47: 0x000c, + 0xc4d: 0x000c, 0xc4e: 0x000c, 0xc4f: 0x000c, 0xc50: 0x000c, 0xc51: 0x000c, + 0xc52: 0x000c, 0xc53: 0x000c, 0xc54: 0x000c, 0xc55: 0x000c, 0xc56: 0x000c, 0xc57: 0x000c, + 0xc59: 0x000c, 0xc5a: 0x000c, 0xc5b: 0x000c, 0xc5c: 0x000c, 0xc5d: 0x000c, + 0xc5e: 0x000c, 0xc5f: 0x000c, 0xc60: 0x000c, 0xc61: 0x000c, 0xc62: 0x000c, 0xc63: 0x000c, + 0xc64: 0x000c, 0xc65: 0x000c, 0xc66: 0x000c, 0xc67: 0x000c, 0xc68: 0x000c, 0xc69: 0x000c, + 0xc6a: 0x000c, 0xc6b: 0x000c, 0xc6c: 0x000c, 0xc6d: 0x000c, 0xc6e: 0x000c, 0xc6f: 0x000c, + 0xc70: 0x000c, 0xc71: 0x000c, 0xc72: 0x000c, 0xc73: 0x000c, 0xc74: 0x000c, 0xc75: 0x000c, + 0xc76: 0x000c, 0xc77: 0x000c, 0xc78: 0x000c, 0xc79: 0x000c, 0xc7a: 0x000c, 0xc7b: 0x000c, + 0xc7c: 0x000c, + // Block 0x32, offset 0xc80 + 0xc86: 0x000c, + // Block 0x33, offset 0xcc0 + 0xced: 0x000c, 0xcee: 0x000c, 0xcef: 0x000c, + 0xcf0: 0x000c, 0xcf2: 0x000c, 0xcf3: 0x000c, 0xcf4: 0x000c, 0xcf5: 0x000c, + 0xcf6: 0x000c, 0xcf7: 0x000c, 0xcf9: 0x000c, 0xcfa: 0x000c, + 0xcfd: 0x000c, 0xcfe: 0x000c, + // Block 0x34, offset 0xd00 + 0xd18: 0x000c, 0xd19: 0x000c, + 0xd1e: 0x000c, 0xd1f: 0x000c, 0xd20: 0x000c, + 0xd31: 0x000c, 0xd32: 0x000c, 0xd33: 0x000c, 0xd34: 0x000c, + // Block 0x35, offset 0xd40 + 0xd42: 0x000c, 0xd45: 0x000c, + 0xd46: 0x000c, + 0xd4d: 0x000c, + 0xd5d: 0x000c, + // Block 0x36, offset 0xd80 + 0xd9d: 0x000c, + 0xd9e: 0x000c, 0xd9f: 0x000c, + // Block 0x37, offset 0xdc0 + 0xdd0: 0x000a, 0xdd1: 0x000a, + 0xdd2: 0x000a, 0xdd3: 0x000a, 0xdd4: 0x000a, 0xdd5: 0x000a, 0xdd6: 0x000a, 0xdd7: 0x000a, + 0xdd8: 0x000a, 0xdd9: 0x000a, + // Block 0x38, offset 0xe00 + 0xe00: 0x000a, + // Block 0x39, offset 0xe40 + 0xe40: 0x0009, + 0xe5b: 0x007a, 0xe5c: 0x006a, + // Block 0x3a, offset 0xe80 + 0xe92: 0x000c, 0xe93: 0x000c, 0xe94: 0x000c, + 0xeb2: 0x000c, 0xeb3: 0x000c, 0xeb4: 0x000c, + // Block 0x3b, offset 0xec0 + 0xed2: 0x000c, 0xed3: 0x000c, + 0xef2: 0x000c, 0xef3: 0x000c, + // Block 0x3c, offset 0xf00 + 0xf34: 0x000c, 0xf35: 0x000c, + 0xf37: 0x000c, 0xf38: 0x000c, 0xf39: 0x000c, 0xf3a: 0x000c, 0xf3b: 0x000c, + 0xf3c: 0x000c, 0xf3d: 0x000c, + // Block 0x3d, offset 0xf40 + 0xf46: 0x000c, 0xf49: 0x000c, 0xf4a: 0x000c, 0xf4b: 0x000c, + 0xf4c: 0x000c, 0xf4d: 0x000c, 0xf4e: 0x000c, 0xf4f: 0x000c, 0xf50: 0x000c, 0xf51: 0x000c, + 0xf52: 0x000c, 0xf53: 0x000c, + 0xf5b: 0x0004, 0xf5d: 0x000c, + 0xf70: 0x000a, 0xf71: 0x000a, 0xf72: 0x000a, 0xf73: 0x000a, 0xf74: 0x000a, 0xf75: 0x000a, + 0xf76: 0x000a, 0xf77: 0x000a, 0xf78: 0x000a, 0xf79: 0x000a, + // Block 0x3e, offset 0xf80 + 0xf80: 0x000a, 0xf81: 0x000a, 0xf82: 0x000a, 0xf83: 0x000a, 0xf84: 0x000a, 0xf85: 0x000a, + 0xf86: 0x000a, 0xf87: 0x000a, 0xf88: 0x000a, 0xf89: 0x000a, 0xf8a: 0x000a, 0xf8b: 0x000c, + 0xf8c: 0x000c, 0xf8d: 0x000c, 0xf8e: 0x000b, + // Block 0x3f, offset 0xfc0 + 0xfc5: 0x000c, + 0xfc6: 0x000c, + 0xfe9: 0x000c, + // Block 0x40, offset 0x1000 + 0x1020: 0x000c, 0x1021: 0x000c, 0x1022: 0x000c, + 0x1027: 0x000c, 0x1028: 0x000c, + 0x1032: 0x000c, + 0x1039: 0x000c, 0x103a: 0x000c, 0x103b: 0x000c, + // Block 0x41, offset 0x1040 + 0x1040: 0x000a, 0x1044: 0x000a, 0x1045: 0x000a, + // Block 0x42, offset 0x1080 + 0x109e: 0x000a, 0x109f: 0x000a, 0x10a0: 0x000a, 0x10a1: 0x000a, 0x10a2: 0x000a, 0x10a3: 0x000a, + 0x10a4: 0x000a, 0x10a5: 0x000a, 0x10a6: 0x000a, 0x10a7: 0x000a, 0x10a8: 0x000a, 0x10a9: 0x000a, + 0x10aa: 0x000a, 0x10ab: 0x000a, 0x10ac: 0x000a, 0x10ad: 0x000a, 0x10ae: 0x000a, 0x10af: 0x000a, + 0x10b0: 0x000a, 0x10b1: 0x000a, 0x10b2: 0x000a, 0x10b3: 0x000a, 0x10b4: 0x000a, 0x10b5: 0x000a, + 0x10b6: 0x000a, 0x10b7: 0x000a, 0x10b8: 0x000a, 0x10b9: 0x000a, 0x10ba: 0x000a, 0x10bb: 0x000a, + 0x10bc: 0x000a, 0x10bd: 0x000a, 0x10be: 0x000a, 0x10bf: 0x000a, + // Block 0x43, offset 0x10c0 + 0x10d7: 0x000c, + 0x10d8: 0x000c, 0x10db: 0x000c, + // Block 0x44, offset 0x1100 + 0x1116: 0x000c, + 0x1118: 0x000c, 0x1119: 0x000c, 0x111a: 0x000c, 0x111b: 0x000c, 0x111c: 0x000c, 0x111d: 0x000c, + 0x111e: 0x000c, 0x1120: 0x000c, 0x1122: 0x000c, + 0x1125: 0x000c, 0x1126: 0x000c, 0x1127: 0x000c, 0x1128: 0x000c, 0x1129: 0x000c, + 0x112a: 0x000c, 0x112b: 0x000c, 0x112c: 0x000c, + 0x1133: 0x000c, 0x1134: 0x000c, 0x1135: 0x000c, + 0x1136: 0x000c, 0x1137: 0x000c, 0x1138: 0x000c, 0x1139: 0x000c, 0x113a: 0x000c, 0x113b: 0x000c, + 0x113c: 0x000c, 0x113f: 0x000c, + // Block 0x45, offset 0x1140 + 0x1170: 0x000c, 0x1171: 0x000c, 0x1172: 0x000c, 0x1173: 0x000c, 0x1174: 0x000c, 0x1175: 0x000c, + 0x1176: 0x000c, 0x1177: 0x000c, 0x1178: 0x000c, 0x1179: 0x000c, 0x117a: 0x000c, 0x117b: 0x000c, + 0x117c: 0x000c, 0x117d: 0x000c, 0x117e: 0x000c, + // Block 0x46, offset 0x1180 + 0x1180: 0x000c, 0x1181: 0x000c, 0x1182: 0x000c, 0x1183: 0x000c, + 0x11b4: 0x000c, + 0x11b6: 0x000c, 0x11b7: 0x000c, 0x11b8: 0x000c, 0x11b9: 0x000c, 0x11ba: 0x000c, + 0x11bc: 0x000c, + // Block 0x47, offset 0x11c0 + 0x11c2: 0x000c, + 0x11eb: 0x000c, 0x11ec: 0x000c, 0x11ed: 0x000c, 0x11ee: 0x000c, 0x11ef: 0x000c, + 0x11f0: 0x000c, 0x11f1: 0x000c, 0x11f2: 0x000c, 0x11f3: 0x000c, + // Block 0x48, offset 0x1200 + 0x1200: 0x000c, 0x1201: 0x000c, + 0x1222: 0x000c, 0x1223: 0x000c, + 0x1224: 0x000c, 0x1225: 0x000c, 0x1228: 0x000c, 0x1229: 0x000c, + 0x122b: 0x000c, 0x122c: 0x000c, 0x122d: 0x000c, + // Block 0x49, offset 0x1240 + 0x1266: 0x000c, 0x1268: 0x000c, 0x1269: 0x000c, + 0x126d: 0x000c, 0x126f: 0x000c, + 0x1270: 0x000c, 0x1271: 0x000c, + // Block 0x4a, offset 0x1280 + 0x12ac: 0x000c, 0x12ad: 0x000c, 0x12ae: 0x000c, 0x12af: 0x000c, + 0x12b0: 0x000c, 0x12b1: 0x000c, 0x12b2: 0x000c, 0x12b3: 0x000c, + 0x12b6: 0x000c, 0x12b7: 0x000c, + // Block 0x4b, offset 0x12c0 + 0x12d0: 0x000c, 0x12d1: 0x000c, + 0x12d2: 0x000c, 0x12d4: 0x000c, 0x12d5: 0x000c, 0x12d6: 0x000c, 0x12d7: 0x000c, + 0x12d8: 0x000c, 0x12d9: 0x000c, 0x12da: 0x000c, 0x12db: 0x000c, 0x12dc: 0x000c, 0x12dd: 0x000c, + 0x12de: 0x000c, 0x12df: 0x000c, 0x12e0: 0x000c, 0x12e2: 0x000c, 0x12e3: 0x000c, + 0x12e4: 0x000c, 0x12e5: 0x000c, 0x12e6: 0x000c, 0x12e7: 0x000c, 0x12e8: 0x000c, + 0x12ed: 0x000c, + 0x12f4: 0x000c, + 0x12f8: 0x000c, 0x12f9: 0x000c, + // Block 0x4c, offset 0x1300 + 0x1300: 0x000c, 0x1301: 0x000c, 0x1302: 0x000c, 0x1303: 0x000c, 0x1304: 0x000c, 0x1305: 0x000c, + 0x1306: 0x000c, 0x1307: 0x000c, 0x1308: 0x000c, 0x1309: 0x000c, 0x130a: 0x000c, 0x130b: 0x000c, + 0x130c: 0x000c, 0x130d: 0x000c, 0x130e: 0x000c, 0x130f: 0x000c, 0x1310: 0x000c, 0x1311: 0x000c, + 0x1312: 0x000c, 0x1313: 0x000c, 0x1314: 0x000c, 0x1315: 0x000c, 0x1316: 0x000c, 0x1317: 0x000c, + 0x1318: 0x000c, 0x1319: 0x000c, 0x131a: 0x000c, 0x131b: 0x000c, 0x131c: 0x000c, 0x131d: 0x000c, + 0x131e: 0x000c, 0x131f: 0x000c, 0x1320: 0x000c, 0x1321: 0x000c, 0x1322: 0x000c, 0x1323: 0x000c, + 0x1324: 0x000c, 0x1325: 0x000c, 0x1326: 0x000c, 0x1327: 0x000c, 0x1328: 0x000c, 0x1329: 0x000c, + 0x132a: 0x000c, 0x132b: 0x000c, 0x132c: 0x000c, 0x132d: 0x000c, 0x132e: 0x000c, 0x132f: 0x000c, + 0x1330: 0x000c, 0x1331: 0x000c, 0x1332: 0x000c, 0x1333: 0x000c, 0x1334: 0x000c, 0x1335: 0x000c, + 0x133b: 0x000c, + 0x133c: 0x000c, 0x133d: 0x000c, 0x133e: 0x000c, 0x133f: 0x000c, + // Block 0x4d, offset 0x1340 + 0x137d: 0x000a, 0x137f: 0x000a, + // Block 0x4e, offset 0x1380 + 0x1380: 0x000a, 0x1381: 0x000a, + 0x138d: 0x000a, 0x138e: 0x000a, 0x138f: 0x000a, + 0x139d: 0x000a, + 0x139e: 0x000a, 0x139f: 0x000a, + 0x13ad: 0x000a, 0x13ae: 0x000a, 0x13af: 0x000a, + 0x13bd: 0x000a, 0x13be: 0x000a, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x0009, 0x13c1: 0x0009, 0x13c2: 0x0009, 0x13c3: 0x0009, 0x13c4: 0x0009, 0x13c5: 0x0009, + 0x13c6: 0x0009, 0x13c7: 0x0009, 0x13c8: 0x0009, 0x13c9: 0x0009, 0x13ca: 0x0009, 0x13cb: 0x000b, + 0x13cc: 0x000b, 0x13cd: 0x000b, 0x13cf: 0x0001, 0x13d0: 0x000a, 0x13d1: 0x000a, + 0x13d2: 0x000a, 0x13d3: 0x000a, 0x13d4: 0x000a, 0x13d5: 0x000a, 0x13d6: 0x000a, 0x13d7: 0x000a, + 0x13d8: 0x000a, 0x13d9: 0x000a, 0x13da: 0x000a, 0x13db: 0x000a, 0x13dc: 0x000a, 0x13dd: 0x000a, + 0x13de: 0x000a, 0x13df: 0x000a, 0x13e0: 0x000a, 0x13e1: 0x000a, 0x13e2: 0x000a, 0x13e3: 0x000a, + 0x13e4: 0x000a, 0x13e5: 0x000a, 0x13e6: 0x000a, 0x13e7: 0x000a, 0x13e8: 0x0009, 0x13e9: 0x0007, + 0x13ea: 0x000e, 0x13eb: 0x000e, 0x13ec: 0x000e, 0x13ed: 0x000e, 0x13ee: 0x000e, 0x13ef: 0x0006, + 0x13f0: 0x0004, 0x13f1: 0x0004, 0x13f2: 0x0004, 0x13f3: 0x0004, 0x13f4: 0x0004, 0x13f5: 0x000a, + 0x13f6: 0x000a, 0x13f7: 0x000a, 0x13f8: 0x000a, 0x13f9: 0x000a, 0x13fa: 0x000a, 0x13fb: 0x000a, + 0x13fc: 0x000a, 0x13fd: 0x000a, 0x13fe: 0x000a, 0x13ff: 0x000a, + // Block 0x50, offset 0x1400 + 0x1400: 0x000a, 0x1401: 0x000a, 0x1402: 0x000a, 0x1403: 0x000a, 0x1404: 0x0006, 0x1405: 0x009a, + 0x1406: 0x008a, 0x1407: 0x000a, 0x1408: 0x000a, 0x1409: 0x000a, 0x140a: 0x000a, 0x140b: 0x000a, + 0x140c: 0x000a, 0x140d: 0x000a, 0x140e: 0x000a, 0x140f: 0x000a, 0x1410: 0x000a, 0x1411: 0x000a, + 0x1412: 0x000a, 0x1413: 0x000a, 0x1414: 0x000a, 0x1415: 0x000a, 0x1416: 0x000a, 0x1417: 0x000a, + 0x1418: 0x000a, 0x1419: 0x000a, 0x141a: 0x000a, 0x141b: 0x000a, 0x141c: 0x000a, 0x141d: 0x000a, + 0x141e: 0x000a, 0x141f: 0x0009, 0x1420: 0x000b, 0x1421: 0x000b, 0x1422: 0x000b, 0x1423: 0x000b, + 0x1424: 0x000b, 0x1425: 0x000b, 0x1426: 0x000e, 0x1427: 0x000e, 0x1428: 0x000e, 0x1429: 0x000e, + 0x142a: 0x000b, 0x142b: 0x000b, 0x142c: 0x000b, 0x142d: 0x000b, 0x142e: 0x000b, 0x142f: 0x000b, + 0x1430: 0x0002, 0x1434: 0x0002, 0x1435: 0x0002, + 0x1436: 0x0002, 0x1437: 0x0002, 0x1438: 0x0002, 0x1439: 0x0002, 0x143a: 0x0003, 0x143b: 0x0003, + 0x143c: 0x000a, 0x143d: 0x009a, 0x143e: 0x008a, + // Block 0x51, offset 0x1440 + 0x1440: 0x0002, 0x1441: 0x0002, 0x1442: 0x0002, 0x1443: 0x0002, 0x1444: 0x0002, 0x1445: 0x0002, + 0x1446: 0x0002, 0x1447: 0x0002, 0x1448: 0x0002, 0x1449: 0x0002, 0x144a: 0x0003, 0x144b: 0x0003, + 0x144c: 0x000a, 0x144d: 0x009a, 0x144e: 0x008a, + 0x1460: 0x0004, 0x1461: 0x0004, 0x1462: 0x0004, 0x1463: 0x0004, + 0x1464: 0x0004, 0x1465: 0x0004, 0x1466: 0x0004, 0x1467: 0x0004, 0x1468: 0x0004, 0x1469: 0x0004, + 0x146a: 0x0004, 0x146b: 0x0004, 0x146c: 0x0004, 0x146d: 0x0004, 0x146e: 0x0004, 0x146f: 0x0004, + 0x1470: 0x0004, 0x1471: 0x0004, 0x1472: 0x0004, 0x1473: 0x0004, 0x1474: 0x0004, 0x1475: 0x0004, + 0x1476: 0x0004, 0x1477: 0x0004, 0x1478: 0x0004, 0x1479: 0x0004, 0x147a: 0x0004, 0x147b: 0x0004, + 0x147c: 0x0004, 0x147d: 0x0004, 0x147e: 0x0004, 0x147f: 0x0004, + // Block 0x52, offset 0x1480 + 0x1480: 0x0004, 0x1481: 0x0004, 0x1482: 0x0004, 0x1483: 0x0004, 0x1484: 0x0004, 0x1485: 0x0004, + 0x1486: 0x0004, 0x1487: 0x0004, 0x1488: 0x0004, 0x1489: 0x0004, 0x148a: 0x0004, 0x148b: 0x0004, + 0x148c: 0x0004, 0x148d: 0x0004, 0x148e: 0x0004, 0x148f: 0x0004, 0x1490: 0x000c, 0x1491: 0x000c, + 0x1492: 0x000c, 0x1493: 0x000c, 0x1494: 0x000c, 0x1495: 0x000c, 0x1496: 0x000c, 0x1497: 0x000c, + 0x1498: 0x000c, 0x1499: 0x000c, 0x149a: 0x000c, 0x149b: 0x000c, 0x149c: 0x000c, 0x149d: 0x000c, + 0x149e: 0x000c, 0x149f: 0x000c, 0x14a0: 0x000c, 0x14a1: 0x000c, 0x14a2: 0x000c, 0x14a3: 0x000c, + 0x14a4: 0x000c, 0x14a5: 0x000c, 0x14a6: 0x000c, 0x14a7: 0x000c, 0x14a8: 0x000c, 0x14a9: 0x000c, + 0x14aa: 0x000c, 0x14ab: 0x000c, 0x14ac: 0x000c, 0x14ad: 0x000c, 0x14ae: 0x000c, 0x14af: 0x000c, + 0x14b0: 0x000c, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x000a, 0x14c1: 0x000a, 0x14c3: 0x000a, 0x14c4: 0x000a, 0x14c5: 0x000a, + 0x14c6: 0x000a, 0x14c8: 0x000a, 0x14c9: 0x000a, + 0x14d4: 0x000a, 0x14d6: 0x000a, 0x14d7: 0x000a, + 0x14d8: 0x000a, + 0x14de: 0x000a, 0x14df: 0x000a, 0x14e0: 0x000a, 0x14e1: 0x000a, 0x14e2: 0x000a, 0x14e3: 0x000a, + 0x14e5: 0x000a, 0x14e7: 0x000a, 0x14e9: 0x000a, + 0x14ee: 0x0004, + 0x14fa: 0x000a, 0x14fb: 0x000a, + // Block 0x54, offset 0x1500 + 0x1500: 0x000a, 0x1501: 0x000a, 0x1502: 0x000a, 0x1503: 0x000a, 0x1504: 0x000a, + 0x150a: 0x000a, 0x150b: 0x000a, + 0x150c: 0x000a, 0x150d: 0x000a, 0x1510: 0x000a, 0x1511: 0x000a, + 0x1512: 0x000a, 0x1513: 0x000a, 0x1514: 0x000a, 0x1515: 0x000a, 0x1516: 0x000a, 0x1517: 0x000a, + 0x1518: 0x000a, 0x1519: 0x000a, 0x151a: 0x000a, 0x151b: 0x000a, 0x151c: 0x000a, 0x151d: 0x000a, + 0x151e: 0x000a, 0x151f: 0x000a, + // Block 0x55, offset 0x1540 + 0x1549: 0x000a, 0x154a: 0x000a, 0x154b: 0x000a, + 0x1550: 0x000a, 0x1551: 0x000a, + 0x1552: 0x000a, 0x1553: 0x000a, 0x1554: 0x000a, 0x1555: 0x000a, 0x1556: 0x000a, 0x1557: 0x000a, + 0x1558: 0x000a, 0x1559: 0x000a, 0x155a: 0x000a, 0x155b: 0x000a, 0x155c: 0x000a, 0x155d: 0x000a, + 0x155e: 0x000a, 0x155f: 0x000a, 0x1560: 0x000a, 0x1561: 0x000a, 0x1562: 0x000a, 0x1563: 0x000a, + 0x1564: 0x000a, 0x1565: 0x000a, 0x1566: 0x000a, 0x1567: 0x000a, 0x1568: 0x000a, 0x1569: 0x000a, + 0x156a: 0x000a, 0x156b: 0x000a, 0x156c: 0x000a, 0x156d: 0x000a, 0x156e: 0x000a, 0x156f: 0x000a, + 0x1570: 0x000a, 0x1571: 0x000a, 0x1572: 0x000a, 0x1573: 0x000a, 0x1574: 0x000a, 0x1575: 0x000a, + 0x1576: 0x000a, 0x1577: 0x000a, 0x1578: 0x000a, 0x1579: 0x000a, 0x157a: 0x000a, 0x157b: 0x000a, + 0x157c: 0x000a, 0x157d: 0x000a, 0x157e: 0x000a, 0x157f: 0x000a, + // Block 0x56, offset 0x1580 + 0x1580: 0x000a, 0x1581: 0x000a, 0x1582: 0x000a, 0x1583: 0x000a, 0x1584: 0x000a, 0x1585: 0x000a, + 0x1586: 0x000a, 0x1587: 0x000a, 0x1588: 0x000a, 0x1589: 0x000a, 0x158a: 0x000a, 0x158b: 0x000a, + 0x158c: 0x000a, 0x158d: 0x000a, 0x158e: 0x000a, 0x158f: 0x000a, 0x1590: 0x000a, 0x1591: 0x000a, + 0x1592: 0x000a, 0x1593: 0x000a, 0x1594: 0x000a, 0x1595: 0x000a, 0x1596: 0x000a, 0x1597: 0x000a, + 0x1598: 0x000a, 0x1599: 0x000a, 0x159a: 0x000a, 0x159b: 0x000a, 0x159c: 0x000a, 0x159d: 0x000a, + 0x159e: 0x000a, 0x159f: 0x000a, 0x15a0: 0x000a, 0x15a1: 0x000a, 0x15a2: 0x000a, 0x15a3: 0x000a, + 0x15a4: 0x000a, 0x15a5: 0x000a, 0x15a6: 0x000a, 0x15a7: 0x000a, 0x15a8: 0x000a, 0x15a9: 0x000a, + 0x15aa: 0x000a, 0x15ab: 0x000a, 0x15ac: 0x000a, 0x15ad: 0x000a, 0x15ae: 0x000a, 0x15af: 0x000a, + 0x15b0: 0x000a, 0x15b1: 0x000a, 0x15b2: 0x000a, 0x15b3: 0x000a, 0x15b4: 0x000a, 0x15b5: 0x000a, + 0x15b6: 0x000a, 0x15b7: 0x000a, 0x15b8: 0x000a, 0x15b9: 0x000a, 0x15ba: 0x000a, 0x15bb: 0x000a, + 0x15bc: 0x000a, 0x15bd: 0x000a, 0x15be: 0x000a, 0x15bf: 0x000a, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x000a, 0x15c1: 0x000a, 0x15c2: 0x000a, 0x15c3: 0x000a, 0x15c4: 0x000a, 0x15c5: 0x000a, + 0x15c6: 0x000a, 0x15c7: 0x000a, 0x15c8: 0x000a, 0x15c9: 0x000a, 0x15ca: 0x000a, 0x15cb: 0x000a, + 0x15cc: 0x000a, 0x15cd: 0x000a, 0x15ce: 0x000a, 0x15cf: 0x000a, 0x15d0: 0x000a, 0x15d1: 0x000a, + 0x15d2: 0x0003, 0x15d3: 0x0004, 0x15d4: 0x000a, 0x15d5: 0x000a, 0x15d6: 0x000a, 0x15d7: 0x000a, + 0x15d8: 0x000a, 0x15d9: 0x000a, 0x15da: 0x000a, 0x15db: 0x000a, 0x15dc: 0x000a, 0x15dd: 0x000a, + 0x15de: 0x000a, 0x15df: 0x000a, 0x15e0: 0x000a, 0x15e1: 0x000a, 0x15e2: 0x000a, 0x15e3: 0x000a, + 0x15e4: 0x000a, 0x15e5: 0x000a, 0x15e6: 0x000a, 0x15e7: 0x000a, 0x15e8: 0x000a, 0x15e9: 0x000a, + 0x15ea: 0x000a, 0x15eb: 0x000a, 0x15ec: 0x000a, 0x15ed: 0x000a, 0x15ee: 0x000a, 0x15ef: 0x000a, + 0x15f0: 0x000a, 0x15f1: 0x000a, 0x15f2: 0x000a, 0x15f3: 0x000a, 0x15f4: 0x000a, 0x15f5: 0x000a, + 0x15f6: 0x000a, 0x15f7: 0x000a, 0x15f8: 0x000a, 0x15f9: 0x000a, 0x15fa: 0x000a, 0x15fb: 0x000a, + 0x15fc: 0x000a, 0x15fd: 0x000a, 0x15fe: 0x000a, 0x15ff: 0x000a, + // Block 0x58, offset 0x1600 + 0x1600: 0x000a, 0x1601: 0x000a, 0x1602: 0x000a, 0x1603: 0x000a, 0x1604: 0x000a, 0x1605: 0x000a, + 0x1606: 0x000a, 0x1607: 0x000a, 0x1608: 0x003a, 0x1609: 0x002a, 0x160a: 0x003a, 0x160b: 0x002a, + 0x160c: 0x000a, 0x160d: 0x000a, 0x160e: 0x000a, 0x160f: 0x000a, 0x1610: 0x000a, 0x1611: 0x000a, + 0x1612: 0x000a, 0x1613: 0x000a, 0x1614: 0x000a, 0x1615: 0x000a, 0x1616: 0x000a, 0x1617: 0x000a, + 0x1618: 0x000a, 0x1619: 0x000a, 0x161a: 0x000a, 0x161b: 0x000a, 0x161c: 0x000a, 0x161d: 0x000a, + 0x161e: 0x000a, 0x161f: 0x000a, 0x1620: 0x000a, 0x1621: 0x000a, 0x1622: 0x000a, 0x1623: 0x000a, + 0x1624: 0x000a, 0x1625: 0x000a, 0x1626: 0x000a, 0x1627: 0x000a, 0x1628: 0x000a, 0x1629: 0x009a, + 0x162a: 0x008a, 0x162b: 0x000a, 0x162c: 0x000a, 0x162d: 0x000a, 0x162e: 0x000a, 0x162f: 0x000a, + 0x1630: 0x000a, 0x1631: 0x000a, 0x1632: 0x000a, 0x1633: 0x000a, 0x1634: 0x000a, 0x1635: 0x000a, + // Block 0x59, offset 0x1640 + 0x167b: 0x000a, + 0x167c: 0x000a, 0x167d: 0x000a, 0x167e: 0x000a, 0x167f: 0x000a, + // Block 0x5a, offset 0x1680 + 0x1680: 0x000a, 0x1681: 0x000a, 0x1682: 0x000a, 0x1683: 0x000a, 0x1684: 0x000a, 0x1685: 0x000a, + 0x1686: 0x000a, 0x1687: 0x000a, 0x1688: 0x000a, 0x1689: 0x000a, 0x168a: 0x000a, 0x168b: 0x000a, + 0x168c: 0x000a, 0x168d: 0x000a, 0x168e: 0x000a, 0x168f: 0x000a, 0x1690: 0x000a, 0x1691: 0x000a, + 0x1692: 0x000a, 0x1693: 0x000a, 0x1694: 0x000a, 0x1696: 0x000a, 0x1697: 0x000a, + 0x1698: 0x000a, 0x1699: 0x000a, 0x169a: 0x000a, 0x169b: 0x000a, 0x169c: 0x000a, 0x169d: 0x000a, + 0x169e: 0x000a, 0x169f: 0x000a, 0x16a0: 0x000a, 0x16a1: 0x000a, 0x16a2: 0x000a, 0x16a3: 0x000a, + 0x16a4: 0x000a, 0x16a5: 0x000a, 0x16a6: 0x000a, 0x16a7: 0x000a, 0x16a8: 0x000a, 0x16a9: 0x000a, + 0x16aa: 0x000a, 0x16ab: 0x000a, 0x16ac: 0x000a, 0x16ad: 0x000a, 0x16ae: 0x000a, 0x16af: 0x000a, + 0x16b0: 0x000a, 0x16b1: 0x000a, 0x16b2: 0x000a, 0x16b3: 0x000a, 0x16b4: 0x000a, 0x16b5: 0x000a, + 0x16b6: 0x000a, 0x16b7: 0x000a, 0x16b8: 0x000a, 0x16b9: 0x000a, 0x16ba: 0x000a, 0x16bb: 0x000a, + 0x16bc: 0x000a, 0x16bd: 0x000a, 0x16be: 0x000a, 0x16bf: 0x000a, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x000a, 0x16c1: 0x000a, 0x16c2: 0x000a, 0x16c3: 0x000a, 0x16c4: 0x000a, 0x16c5: 0x000a, + 0x16c6: 0x000a, 0x16c7: 0x000a, 0x16c8: 0x000a, 0x16c9: 0x000a, 0x16ca: 0x000a, 0x16cb: 0x000a, + 0x16cc: 0x000a, 0x16cd: 0x000a, 0x16ce: 0x000a, 0x16cf: 0x000a, 0x16d0: 0x000a, 0x16d1: 0x000a, + 0x16d2: 0x000a, 0x16d3: 0x000a, 0x16d4: 0x000a, 0x16d5: 0x000a, 0x16d6: 0x000a, 0x16d7: 0x000a, + 0x16d8: 0x000a, 0x16d9: 0x000a, 0x16da: 0x000a, 0x16db: 0x000a, 0x16dc: 0x000a, 0x16dd: 0x000a, + 0x16de: 0x000a, 0x16df: 0x000a, 0x16e0: 0x000a, 0x16e1: 0x000a, 0x16e2: 0x000a, 0x16e3: 0x000a, + 0x16e4: 0x000a, 0x16e5: 0x000a, 0x16e6: 0x000a, 0x16e7: 0x000a, 0x16e8: 0x000a, 0x16e9: 0x000a, + 0x16ea: 0x000a, 0x16eb: 0x000a, 0x16ec: 0x000a, 0x16ed: 0x000a, 0x16ee: 0x000a, 0x16ef: 0x000a, + 0x16f0: 0x000a, 0x16f1: 0x000a, 0x16f2: 0x000a, 0x16f3: 0x000a, 0x16f4: 0x000a, 0x16f5: 0x000a, + 0x16f6: 0x000a, 0x16f7: 0x000a, 0x16f8: 0x000a, 0x16f9: 0x000a, 0x16fa: 0x000a, 0x16fb: 0x000a, + 0x16fc: 0x000a, 0x16fd: 0x000a, 0x16fe: 0x000a, + // Block 0x5c, offset 0x1700 + 0x1700: 0x000a, 0x1701: 0x000a, 0x1702: 0x000a, 0x1703: 0x000a, 0x1704: 0x000a, 0x1705: 0x000a, + 0x1706: 0x000a, 0x1707: 0x000a, 0x1708: 0x000a, 0x1709: 0x000a, 0x170a: 0x000a, 0x170b: 0x000a, + 0x170c: 0x000a, 0x170d: 0x000a, 0x170e: 0x000a, 0x170f: 0x000a, 0x1710: 0x000a, 0x1711: 0x000a, + 0x1712: 0x000a, 0x1713: 0x000a, 0x1714: 0x000a, 0x1715: 0x000a, 0x1716: 0x000a, 0x1717: 0x000a, + 0x1718: 0x000a, 0x1719: 0x000a, 0x171a: 0x000a, 0x171b: 0x000a, 0x171c: 0x000a, 0x171d: 0x000a, + 0x171e: 0x000a, 0x171f: 0x000a, 0x1720: 0x000a, 0x1721: 0x000a, 0x1722: 0x000a, 0x1723: 0x000a, + 0x1724: 0x000a, 0x1725: 0x000a, 0x1726: 0x000a, + // Block 0x5d, offset 0x1740 + 0x1740: 0x000a, 0x1741: 0x000a, 0x1742: 0x000a, 0x1743: 0x000a, 0x1744: 0x000a, 0x1745: 0x000a, + 0x1746: 0x000a, 0x1747: 0x000a, 0x1748: 0x000a, 0x1749: 0x000a, 0x174a: 0x000a, + 0x1760: 0x000a, 0x1761: 0x000a, 0x1762: 0x000a, 0x1763: 0x000a, + 0x1764: 0x000a, 0x1765: 0x000a, 0x1766: 0x000a, 0x1767: 0x000a, 0x1768: 0x000a, 0x1769: 0x000a, + 0x176a: 0x000a, 0x176b: 0x000a, 0x176c: 0x000a, 0x176d: 0x000a, 0x176e: 0x000a, 0x176f: 0x000a, + 0x1770: 0x000a, 0x1771: 0x000a, 0x1772: 0x000a, 0x1773: 0x000a, 0x1774: 0x000a, 0x1775: 0x000a, + 0x1776: 0x000a, 0x1777: 0x000a, 0x1778: 0x000a, 0x1779: 0x000a, 0x177a: 0x000a, 0x177b: 0x000a, + 0x177c: 0x000a, 0x177d: 0x000a, 0x177e: 0x000a, 0x177f: 0x000a, + // Block 0x5e, offset 0x1780 + 0x1780: 0x000a, 0x1781: 0x000a, 0x1782: 0x000a, 0x1783: 0x000a, 0x1784: 0x000a, 0x1785: 0x000a, + 0x1786: 0x000a, 0x1787: 0x000a, 0x1788: 0x0002, 0x1789: 0x0002, 0x178a: 0x0002, 0x178b: 0x0002, + 0x178c: 0x0002, 0x178d: 0x0002, 0x178e: 0x0002, 0x178f: 0x0002, 0x1790: 0x0002, 0x1791: 0x0002, + 0x1792: 0x0002, 0x1793: 0x0002, 0x1794: 0x0002, 0x1795: 0x0002, 0x1796: 0x0002, 0x1797: 0x0002, + 0x1798: 0x0002, 0x1799: 0x0002, 0x179a: 0x0002, 0x179b: 0x0002, + // Block 0x5f, offset 0x17c0 + 0x17ea: 0x000a, 0x17eb: 0x000a, 0x17ec: 0x000a, 0x17ed: 0x000a, 0x17ee: 0x000a, 0x17ef: 0x000a, + 0x17f0: 0x000a, 0x17f1: 0x000a, 0x17f2: 0x000a, 0x17f3: 0x000a, 0x17f4: 0x000a, 0x17f5: 0x000a, + 0x17f6: 0x000a, 0x17f7: 0x000a, 0x17f8: 0x000a, 0x17f9: 0x000a, 0x17fa: 0x000a, 0x17fb: 0x000a, + 0x17fc: 0x000a, 0x17fd: 0x000a, 0x17fe: 0x000a, 0x17ff: 0x000a, + // Block 0x60, offset 0x1800 + 0x1800: 0x000a, 0x1801: 0x000a, 0x1802: 0x000a, 0x1803: 0x000a, 0x1804: 0x000a, 0x1805: 0x000a, + 0x1806: 0x000a, 0x1807: 0x000a, 0x1808: 0x000a, 0x1809: 0x000a, 0x180a: 0x000a, 0x180b: 0x000a, + 0x180c: 0x000a, 0x180d: 0x000a, 0x180e: 0x000a, 0x180f: 0x000a, 0x1810: 0x000a, 0x1811: 0x000a, + 0x1812: 0x000a, 0x1813: 0x000a, 0x1814: 0x000a, 0x1815: 0x000a, 0x1816: 0x000a, 0x1817: 0x000a, + 0x1818: 0x000a, 0x1819: 0x000a, 0x181a: 0x000a, 0x181b: 0x000a, 0x181c: 0x000a, 0x181d: 0x000a, + 0x181e: 0x000a, 0x181f: 0x000a, 0x1820: 0x000a, 0x1821: 0x000a, 0x1822: 0x000a, 0x1823: 0x000a, + 0x1824: 0x000a, 0x1825: 0x000a, 0x1826: 0x000a, 0x1827: 0x000a, 0x1828: 0x000a, 0x1829: 0x000a, + 0x182a: 0x000a, 0x182b: 0x000a, 0x182d: 0x000a, 0x182e: 0x000a, 0x182f: 0x000a, + 0x1830: 0x000a, 0x1831: 0x000a, 0x1832: 0x000a, 0x1833: 0x000a, 0x1834: 0x000a, 0x1835: 0x000a, + 0x1836: 0x000a, 0x1837: 0x000a, 0x1838: 0x000a, 0x1839: 0x000a, 0x183a: 0x000a, 0x183b: 0x000a, + 0x183c: 0x000a, 0x183d: 0x000a, 0x183e: 0x000a, 0x183f: 0x000a, + // Block 0x61, offset 0x1840 + 0x1840: 0x000a, 0x1841: 0x000a, 0x1842: 0x000a, 0x1843: 0x000a, 0x1844: 0x000a, 0x1845: 0x000a, + 0x1846: 0x000a, 0x1847: 0x000a, 0x1848: 0x000a, 0x1849: 0x000a, 0x184a: 0x000a, 0x184b: 0x000a, + 0x184c: 0x000a, 0x184d: 0x000a, 0x184e: 0x000a, 0x184f: 0x000a, 0x1850: 0x000a, 0x1851: 0x000a, + 0x1852: 0x000a, 0x1853: 0x000a, 0x1854: 0x000a, 0x1855: 0x000a, 0x1856: 0x000a, 0x1857: 0x000a, + 0x1858: 0x000a, 0x1859: 0x000a, 0x185a: 0x000a, 0x185b: 0x000a, 0x185c: 0x000a, 0x185d: 0x000a, + 0x185e: 0x000a, 0x185f: 0x000a, 0x1860: 0x000a, 0x1861: 0x000a, 0x1862: 0x000a, 0x1863: 0x000a, + 0x1864: 0x000a, 0x1865: 0x000a, 0x1866: 0x000a, 0x1867: 0x000a, 0x1868: 0x003a, 0x1869: 0x002a, + 0x186a: 0x003a, 0x186b: 0x002a, 0x186c: 0x003a, 0x186d: 0x002a, 0x186e: 0x003a, 0x186f: 0x002a, + 0x1870: 0x003a, 0x1871: 0x002a, 0x1872: 0x003a, 0x1873: 0x002a, 0x1874: 0x003a, 0x1875: 0x002a, + 0x1876: 0x000a, 0x1877: 0x000a, 0x1878: 0x000a, 0x1879: 0x000a, 0x187a: 0x000a, 0x187b: 0x000a, + 0x187c: 0x000a, 0x187d: 0x000a, 0x187e: 0x000a, 0x187f: 0x000a, + // Block 0x62, offset 0x1880 + 0x1880: 0x000a, 0x1881: 0x000a, 0x1882: 0x000a, 0x1883: 0x000a, 0x1884: 0x000a, 0x1885: 0x009a, + 0x1886: 0x008a, 0x1887: 0x000a, 0x1888: 0x000a, 0x1889: 0x000a, 0x188a: 0x000a, 0x188b: 0x000a, + 0x188c: 0x000a, 0x188d: 0x000a, 0x188e: 0x000a, 0x188f: 0x000a, 0x1890: 0x000a, 0x1891: 0x000a, + 0x1892: 0x000a, 0x1893: 0x000a, 0x1894: 0x000a, 0x1895: 0x000a, 0x1896: 0x000a, 0x1897: 0x000a, + 0x1898: 0x000a, 0x1899: 0x000a, 0x189a: 0x000a, 0x189b: 0x000a, 0x189c: 0x000a, 0x189d: 0x000a, + 0x189e: 0x000a, 0x189f: 0x000a, 0x18a0: 0x000a, 0x18a1: 0x000a, 0x18a2: 0x000a, 0x18a3: 0x000a, + 0x18a4: 0x000a, 0x18a5: 0x000a, 0x18a6: 0x003a, 0x18a7: 0x002a, 0x18a8: 0x003a, 0x18a9: 0x002a, + 0x18aa: 0x003a, 0x18ab: 0x002a, 0x18ac: 0x003a, 0x18ad: 0x002a, 0x18ae: 0x003a, 0x18af: 0x002a, + 0x18b0: 0x000a, 0x18b1: 0x000a, 0x18b2: 0x000a, 0x18b3: 0x000a, 0x18b4: 0x000a, 0x18b5: 0x000a, + 0x18b6: 0x000a, 0x18b7: 0x000a, 0x18b8: 0x000a, 0x18b9: 0x000a, 0x18ba: 0x000a, 0x18bb: 0x000a, + 0x18bc: 0x000a, 0x18bd: 0x000a, 0x18be: 0x000a, 0x18bf: 0x000a, + // Block 0x63, offset 0x18c0 + 0x18c0: 0x000a, 0x18c1: 0x000a, 0x18c2: 0x000a, 0x18c3: 0x007a, 0x18c4: 0x006a, 0x18c5: 0x009a, + 0x18c6: 0x008a, 0x18c7: 0x00ba, 0x18c8: 0x00aa, 0x18c9: 0x009a, 0x18ca: 0x008a, 0x18cb: 0x007a, + 0x18cc: 0x006a, 0x18cd: 0x00da, 0x18ce: 0x002a, 0x18cf: 0x003a, 0x18d0: 0x00ca, 0x18d1: 0x009a, + 0x18d2: 0x008a, 0x18d3: 0x007a, 0x18d4: 0x006a, 0x18d5: 0x009a, 0x18d6: 0x008a, 0x18d7: 0x00ba, + 0x18d8: 0x00aa, 0x18d9: 0x000a, 0x18da: 0x000a, 0x18db: 0x000a, 0x18dc: 0x000a, 0x18dd: 0x000a, + 0x18de: 0x000a, 0x18df: 0x000a, 0x18e0: 0x000a, 0x18e1: 0x000a, 0x18e2: 0x000a, 0x18e3: 0x000a, + 0x18e4: 0x000a, 0x18e5: 0x000a, 0x18e6: 0x000a, 0x18e7: 0x000a, 0x18e8: 0x000a, 0x18e9: 0x000a, + 0x18ea: 0x000a, 0x18eb: 0x000a, 0x18ec: 0x000a, 0x18ed: 0x000a, 0x18ee: 0x000a, 0x18ef: 0x000a, + 0x18f0: 0x000a, 0x18f1: 0x000a, 0x18f2: 0x000a, 0x18f3: 0x000a, 0x18f4: 0x000a, 0x18f5: 0x000a, + 0x18f6: 0x000a, 0x18f7: 0x000a, 0x18f8: 0x000a, 0x18f9: 0x000a, 0x18fa: 0x000a, 0x18fb: 0x000a, + 0x18fc: 0x000a, 0x18fd: 0x000a, 0x18fe: 0x000a, 0x18ff: 0x000a, + // Block 0x64, offset 0x1900 + 0x1900: 0x000a, 0x1901: 0x000a, 0x1902: 0x000a, 0x1903: 0x000a, 0x1904: 0x000a, 0x1905: 0x000a, + 0x1906: 0x000a, 0x1907: 0x000a, 0x1908: 0x000a, 0x1909: 0x000a, 0x190a: 0x000a, 0x190b: 0x000a, + 0x190c: 0x000a, 0x190d: 0x000a, 0x190e: 0x000a, 0x190f: 0x000a, 0x1910: 0x000a, 0x1911: 0x000a, + 0x1912: 0x000a, 0x1913: 0x000a, 0x1914: 0x000a, 0x1915: 0x000a, 0x1916: 0x000a, 0x1917: 0x000a, + 0x1918: 0x003a, 0x1919: 0x002a, 0x191a: 0x003a, 0x191b: 0x002a, 0x191c: 0x000a, 0x191d: 0x000a, + 0x191e: 0x000a, 0x191f: 0x000a, 0x1920: 0x000a, 0x1921: 0x000a, 0x1922: 0x000a, 0x1923: 0x000a, + 0x1924: 0x000a, 0x1925: 0x000a, 0x1926: 0x000a, 0x1927: 0x000a, 0x1928: 0x000a, 0x1929: 0x000a, + 0x192a: 0x000a, 0x192b: 0x000a, 0x192c: 0x000a, 0x192d: 0x000a, 0x192e: 0x000a, 0x192f: 0x000a, + 0x1930: 0x000a, 0x1931: 0x000a, 0x1932: 0x000a, 0x1933: 0x000a, 0x1934: 0x000a, 0x1935: 0x000a, + 0x1936: 0x000a, 0x1937: 0x000a, 0x1938: 0x000a, 0x1939: 0x000a, 0x193a: 0x000a, 0x193b: 0x000a, + 0x193c: 0x003a, 0x193d: 0x002a, 0x193e: 0x000a, 0x193f: 0x000a, + // Block 0x65, offset 0x1940 + 0x1940: 0x000a, 0x1941: 0x000a, 0x1942: 0x000a, 0x1943: 0x000a, 0x1944: 0x000a, 0x1945: 0x000a, + 0x1946: 0x000a, 0x1947: 0x000a, 0x1948: 0x000a, 0x1949: 0x000a, 0x194a: 0x000a, 0x194b: 0x000a, + 0x194c: 0x000a, 0x194d: 0x000a, 0x194e: 0x000a, 0x194f: 0x000a, 0x1950: 0x000a, 0x1951: 0x000a, + 0x1952: 0x000a, 0x1953: 0x000a, 0x1954: 0x000a, 0x1955: 0x000a, 0x1956: 0x000a, 0x1957: 0x000a, + 0x1958: 0x000a, 0x1959: 0x000a, 0x195a: 0x000a, 0x195b: 0x000a, 0x195c: 0x000a, 0x195d: 0x000a, + 0x195e: 0x000a, 0x195f: 0x000a, 0x1960: 0x000a, 0x1961: 0x000a, 0x1962: 0x000a, 0x1963: 0x000a, + 0x1964: 0x000a, 0x1965: 0x000a, 0x1966: 0x000a, 0x1967: 0x000a, 0x1968: 0x000a, 0x1969: 0x000a, + 0x196a: 0x000a, 0x196b: 0x000a, 0x196c: 0x000a, 0x196d: 0x000a, 0x196e: 0x000a, 0x196f: 0x000a, + 0x1970: 0x000a, 0x1971: 0x000a, 0x1972: 0x000a, 0x1973: 0x000a, + 0x1976: 0x000a, 0x1977: 0x000a, 0x1978: 0x000a, 0x1979: 0x000a, 0x197a: 0x000a, 0x197b: 0x000a, + 0x197c: 0x000a, 0x197d: 0x000a, 0x197e: 0x000a, 0x197f: 0x000a, + // Block 0x66, offset 0x1980 + 0x1980: 0x000a, 0x1981: 0x000a, 0x1982: 0x000a, 0x1983: 0x000a, 0x1984: 0x000a, 0x1985: 0x000a, + 0x1986: 0x000a, 0x1987: 0x000a, 0x1988: 0x000a, 0x1989: 0x000a, 0x198a: 0x000a, 0x198b: 0x000a, + 0x198c: 0x000a, 0x198d: 0x000a, 0x198e: 0x000a, 0x198f: 0x000a, 0x1990: 0x000a, 0x1991: 0x000a, + 0x1992: 0x000a, 0x1993: 0x000a, 0x1994: 0x000a, 0x1995: 0x000a, + 0x1998: 0x000a, 0x1999: 0x000a, 0x199a: 0x000a, 0x199b: 0x000a, 0x199c: 0x000a, 0x199d: 0x000a, + 0x199e: 0x000a, 0x199f: 0x000a, 0x19a0: 0x000a, 0x19a1: 0x000a, 0x19a2: 0x000a, 0x19a3: 0x000a, + 0x19a4: 0x000a, 0x19a5: 0x000a, 0x19a6: 0x000a, 0x19a7: 0x000a, 0x19a8: 0x000a, 0x19a9: 0x000a, + 0x19aa: 0x000a, 0x19ab: 0x000a, 0x19ac: 0x000a, 0x19ad: 0x000a, 0x19ae: 0x000a, 0x19af: 0x000a, + 0x19b0: 0x000a, 0x19b1: 0x000a, 0x19b2: 0x000a, 0x19b3: 0x000a, 0x19b4: 0x000a, 0x19b5: 0x000a, + 0x19b6: 0x000a, 0x19b7: 0x000a, 0x19b8: 0x000a, 0x19b9: 0x000a, + 0x19bd: 0x000a, 0x19be: 0x000a, 0x19bf: 0x000a, + // Block 0x67, offset 0x19c0 + 0x19c0: 0x000a, 0x19c1: 0x000a, 0x19c2: 0x000a, 0x19c3: 0x000a, 0x19c4: 0x000a, 0x19c5: 0x000a, + 0x19c6: 0x000a, 0x19c7: 0x000a, 0x19c8: 0x000a, 0x19ca: 0x000a, 0x19cb: 0x000a, + 0x19cc: 0x000a, 0x19cd: 0x000a, 0x19ce: 0x000a, 0x19cf: 0x000a, 0x19d0: 0x000a, 0x19d1: 0x000a, + 0x19ec: 0x000a, 0x19ed: 0x000a, 0x19ee: 0x000a, 0x19ef: 0x000a, + // Block 0x68, offset 0x1a00 + 0x1a25: 0x000a, 0x1a26: 0x000a, 0x1a27: 0x000a, 0x1a28: 0x000a, 0x1a29: 0x000a, + 0x1a2a: 0x000a, 0x1a2f: 0x000c, + 0x1a30: 0x000c, 0x1a31: 0x000c, + 0x1a39: 0x000a, 0x1a3a: 0x000a, 0x1a3b: 0x000a, + 0x1a3c: 0x000a, 0x1a3d: 0x000a, 0x1a3e: 0x000a, 0x1a3f: 0x000a, + // Block 0x69, offset 0x1a40 + 0x1a7f: 0x000c, + // Block 0x6a, offset 0x1a80 + 0x1aa0: 0x000c, 0x1aa1: 0x000c, 0x1aa2: 0x000c, 0x1aa3: 0x000c, + 0x1aa4: 0x000c, 0x1aa5: 0x000c, 0x1aa6: 0x000c, 0x1aa7: 0x000c, 0x1aa8: 0x000c, 0x1aa9: 0x000c, + 0x1aaa: 0x000c, 0x1aab: 0x000c, 0x1aac: 0x000c, 0x1aad: 0x000c, 0x1aae: 0x000c, 0x1aaf: 0x000c, + 0x1ab0: 0x000c, 0x1ab1: 0x000c, 0x1ab2: 0x000c, 0x1ab3: 0x000c, 0x1ab4: 0x000c, 0x1ab5: 0x000c, + 0x1ab6: 0x000c, 0x1ab7: 0x000c, 0x1ab8: 0x000c, 0x1ab9: 0x000c, 0x1aba: 0x000c, 0x1abb: 0x000c, + 0x1abc: 0x000c, 0x1abd: 0x000c, 0x1abe: 0x000c, 0x1abf: 0x000c, + // Block 0x6b, offset 0x1ac0 + 0x1ac0: 0x000a, 0x1ac1: 0x000a, 0x1ac2: 0x000a, 0x1ac3: 0x000a, 0x1ac4: 0x000a, 0x1ac5: 0x000a, + 0x1ac6: 0x000a, 0x1ac7: 0x000a, 0x1ac8: 0x000a, 0x1ac9: 0x000a, 0x1aca: 0x000a, 0x1acb: 0x000a, + 0x1acc: 0x000a, 0x1acd: 0x000a, 0x1ace: 0x000a, 0x1acf: 0x000a, 0x1ad0: 0x000a, 0x1ad1: 0x000a, + 0x1ad2: 0x000a, 0x1ad3: 0x000a, 0x1ad4: 0x000a, 0x1ad5: 0x000a, 0x1ad6: 0x000a, 0x1ad7: 0x000a, + 0x1ad8: 0x000a, 0x1ad9: 0x000a, 0x1ada: 0x000a, 0x1adb: 0x000a, 0x1adc: 0x000a, 0x1add: 0x000a, + 0x1ade: 0x000a, 0x1adf: 0x000a, 0x1ae0: 0x000a, 0x1ae1: 0x000a, 0x1ae2: 0x003a, 0x1ae3: 0x002a, + 0x1ae4: 0x003a, 0x1ae5: 0x002a, 0x1ae6: 0x003a, 0x1ae7: 0x002a, 0x1ae8: 0x003a, 0x1ae9: 0x002a, + 0x1aea: 0x000a, 0x1aeb: 0x000a, 0x1aec: 0x000a, 0x1aed: 0x000a, 0x1aee: 0x000a, 0x1aef: 0x000a, + 0x1af0: 0x000a, 0x1af1: 0x000a, 0x1af2: 0x000a, 0x1af3: 0x000a, 0x1af4: 0x000a, 0x1af5: 0x000a, + 0x1af6: 0x000a, 0x1af7: 0x000a, 0x1af8: 0x000a, 0x1af9: 0x000a, 0x1afa: 0x000a, 0x1afb: 0x000a, + 0x1afc: 0x000a, 0x1afd: 0x000a, 0x1afe: 0x000a, 0x1aff: 0x000a, + // Block 0x6c, offset 0x1b00 + 0x1b00: 0x000a, 0x1b01: 0x000a, 0x1b02: 0x000a, 0x1b03: 0x000a, 0x1b04: 0x000a, + // Block 0x6d, offset 0x1b40 + 0x1b40: 0x000a, 0x1b41: 0x000a, 0x1b42: 0x000a, 0x1b43: 0x000a, 0x1b44: 0x000a, 0x1b45: 0x000a, + 0x1b46: 0x000a, 0x1b47: 0x000a, 0x1b48: 0x000a, 0x1b49: 0x000a, 0x1b4a: 0x000a, 0x1b4b: 0x000a, + 0x1b4c: 0x000a, 0x1b4d: 0x000a, 0x1b4e: 0x000a, 0x1b4f: 0x000a, 0x1b50: 0x000a, 0x1b51: 0x000a, + 0x1b52: 0x000a, 0x1b53: 0x000a, 0x1b54: 0x000a, 0x1b55: 0x000a, 0x1b56: 0x000a, 0x1b57: 0x000a, + 0x1b58: 0x000a, 0x1b59: 0x000a, 0x1b5b: 0x000a, 0x1b5c: 0x000a, 0x1b5d: 0x000a, + 0x1b5e: 0x000a, 0x1b5f: 0x000a, 0x1b60: 0x000a, 0x1b61: 0x000a, 0x1b62: 0x000a, 0x1b63: 0x000a, + 0x1b64: 0x000a, 0x1b65: 0x000a, 0x1b66: 0x000a, 0x1b67: 0x000a, 0x1b68: 0x000a, 0x1b69: 0x000a, + 0x1b6a: 0x000a, 0x1b6b: 0x000a, 0x1b6c: 0x000a, 0x1b6d: 0x000a, 0x1b6e: 0x000a, 0x1b6f: 0x000a, + 0x1b70: 0x000a, 0x1b71: 0x000a, 0x1b72: 0x000a, 0x1b73: 0x000a, 0x1b74: 0x000a, 0x1b75: 0x000a, + 0x1b76: 0x000a, 0x1b77: 0x000a, 0x1b78: 0x000a, 0x1b79: 0x000a, 0x1b7a: 0x000a, 0x1b7b: 0x000a, + 0x1b7c: 0x000a, 0x1b7d: 0x000a, 0x1b7e: 0x000a, 0x1b7f: 0x000a, + // Block 0x6e, offset 0x1b80 + 0x1b80: 0x000a, 0x1b81: 0x000a, 0x1b82: 0x000a, 0x1b83: 0x000a, 0x1b84: 0x000a, 0x1b85: 0x000a, + 0x1b86: 0x000a, 0x1b87: 0x000a, 0x1b88: 0x000a, 0x1b89: 0x000a, 0x1b8a: 0x000a, 0x1b8b: 0x000a, + 0x1b8c: 0x000a, 0x1b8d: 0x000a, 0x1b8e: 0x000a, 0x1b8f: 0x000a, 0x1b90: 0x000a, 0x1b91: 0x000a, + 0x1b92: 0x000a, 0x1b93: 0x000a, 0x1b94: 0x000a, 0x1b95: 0x000a, 0x1b96: 0x000a, 0x1b97: 0x000a, + 0x1b98: 0x000a, 0x1b99: 0x000a, 0x1b9a: 0x000a, 0x1b9b: 0x000a, 0x1b9c: 0x000a, 0x1b9d: 0x000a, + 0x1b9e: 0x000a, 0x1b9f: 0x000a, 0x1ba0: 0x000a, 0x1ba1: 0x000a, 0x1ba2: 0x000a, 0x1ba3: 0x000a, + 0x1ba4: 0x000a, 0x1ba5: 0x000a, 0x1ba6: 0x000a, 0x1ba7: 0x000a, 0x1ba8: 0x000a, 0x1ba9: 0x000a, + 0x1baa: 0x000a, 0x1bab: 0x000a, 0x1bac: 0x000a, 0x1bad: 0x000a, 0x1bae: 0x000a, 0x1baf: 0x000a, + 0x1bb0: 0x000a, 0x1bb1: 0x000a, 0x1bb2: 0x000a, 0x1bb3: 0x000a, + // Block 0x6f, offset 0x1bc0 + 0x1bc0: 0x000a, 0x1bc1: 0x000a, 0x1bc2: 0x000a, 0x1bc3: 0x000a, 0x1bc4: 0x000a, 0x1bc5: 0x000a, + 0x1bc6: 0x000a, 0x1bc7: 0x000a, 0x1bc8: 0x000a, 0x1bc9: 0x000a, 0x1bca: 0x000a, 0x1bcb: 0x000a, + 0x1bcc: 0x000a, 0x1bcd: 0x000a, 0x1bce: 0x000a, 0x1bcf: 0x000a, 0x1bd0: 0x000a, 0x1bd1: 0x000a, + 0x1bd2: 0x000a, 0x1bd3: 0x000a, 0x1bd4: 0x000a, 0x1bd5: 0x000a, + 0x1bf0: 0x000a, 0x1bf1: 0x000a, 0x1bf2: 0x000a, 0x1bf3: 0x000a, 0x1bf4: 0x000a, 0x1bf5: 0x000a, + 0x1bf6: 0x000a, 0x1bf7: 0x000a, 0x1bf8: 0x000a, 0x1bf9: 0x000a, 0x1bfa: 0x000a, 0x1bfb: 0x000a, + // Block 0x70, offset 0x1c00 + 0x1c00: 0x0009, 0x1c01: 0x000a, 0x1c02: 0x000a, 0x1c03: 0x000a, 0x1c04: 0x000a, + 0x1c08: 0x003a, 0x1c09: 0x002a, 0x1c0a: 0x003a, 0x1c0b: 0x002a, + 0x1c0c: 0x003a, 0x1c0d: 0x002a, 0x1c0e: 0x003a, 0x1c0f: 0x002a, 0x1c10: 0x003a, 0x1c11: 0x002a, + 0x1c12: 0x000a, 0x1c13: 0x000a, 0x1c14: 0x003a, 0x1c15: 0x002a, 0x1c16: 0x003a, 0x1c17: 0x002a, + 0x1c18: 0x003a, 0x1c19: 0x002a, 0x1c1a: 0x003a, 0x1c1b: 0x002a, 0x1c1c: 0x000a, 0x1c1d: 0x000a, + 0x1c1e: 0x000a, 0x1c1f: 0x000a, 0x1c20: 0x000a, + 0x1c2a: 0x000c, 0x1c2b: 0x000c, 0x1c2c: 0x000c, 0x1c2d: 0x000c, + 0x1c30: 0x000a, + 0x1c36: 0x000a, 0x1c37: 0x000a, + 0x1c3d: 0x000a, 0x1c3e: 0x000a, 0x1c3f: 0x000a, + // Block 0x71, offset 0x1c40 + 0x1c59: 0x000c, 0x1c5a: 0x000c, 0x1c5b: 0x000a, 0x1c5c: 0x000a, + 0x1c60: 0x000a, + // Block 0x72, offset 0x1c80 + 0x1cbb: 0x000a, + // Block 0x73, offset 0x1cc0 + 0x1cc0: 0x000a, 0x1cc1: 0x000a, 0x1cc2: 0x000a, 0x1cc3: 0x000a, 0x1cc4: 0x000a, 0x1cc5: 0x000a, + 0x1cc6: 0x000a, 0x1cc7: 0x000a, 0x1cc8: 0x000a, 0x1cc9: 0x000a, 0x1cca: 0x000a, 0x1ccb: 0x000a, + 0x1ccc: 0x000a, 0x1ccd: 0x000a, 0x1cce: 0x000a, 0x1ccf: 0x000a, 0x1cd0: 0x000a, 0x1cd1: 0x000a, + 0x1cd2: 0x000a, 0x1cd3: 0x000a, 0x1cd4: 0x000a, 0x1cd5: 0x000a, 0x1cd6: 0x000a, 0x1cd7: 0x000a, + 0x1cd8: 0x000a, 0x1cd9: 0x000a, 0x1cda: 0x000a, 0x1cdb: 0x000a, 0x1cdc: 0x000a, 0x1cdd: 0x000a, + 0x1cde: 0x000a, 0x1cdf: 0x000a, 0x1ce0: 0x000a, 0x1ce1: 0x000a, 0x1ce2: 0x000a, 0x1ce3: 0x000a, + // Block 0x74, offset 0x1d00 + 0x1d1d: 0x000a, + 0x1d1e: 0x000a, + // Block 0x75, offset 0x1d40 + 0x1d50: 0x000a, 0x1d51: 0x000a, + 0x1d52: 0x000a, 0x1d53: 0x000a, 0x1d54: 0x000a, 0x1d55: 0x000a, 0x1d56: 0x000a, 0x1d57: 0x000a, + 0x1d58: 0x000a, 0x1d59: 0x000a, 0x1d5a: 0x000a, 0x1d5b: 0x000a, 0x1d5c: 0x000a, 0x1d5d: 0x000a, + 0x1d5e: 0x000a, 0x1d5f: 0x000a, + 0x1d7c: 0x000a, 0x1d7d: 0x000a, 0x1d7e: 0x000a, + // Block 0x76, offset 0x1d80 + 0x1db1: 0x000a, 0x1db2: 0x000a, 0x1db3: 0x000a, 0x1db4: 0x000a, 0x1db5: 0x000a, + 0x1db6: 0x000a, 0x1db7: 0x000a, 0x1db8: 0x000a, 0x1db9: 0x000a, 0x1dba: 0x000a, 0x1dbb: 0x000a, + 0x1dbc: 0x000a, 0x1dbd: 0x000a, 0x1dbe: 0x000a, 0x1dbf: 0x000a, + // Block 0x77, offset 0x1dc0 + 0x1dcc: 0x000a, 0x1dcd: 0x000a, 0x1dce: 0x000a, 0x1dcf: 0x000a, + // Block 0x78, offset 0x1e00 + 0x1e37: 0x000a, 0x1e38: 0x000a, 0x1e39: 0x000a, 0x1e3a: 0x000a, + // Block 0x79, offset 0x1e40 + 0x1e5e: 0x000a, 0x1e5f: 0x000a, + 0x1e7f: 0x000a, + // Block 0x7a, offset 0x1e80 + 0x1e90: 0x000a, 0x1e91: 0x000a, + 0x1e92: 0x000a, 0x1e93: 0x000a, 0x1e94: 0x000a, 0x1e95: 0x000a, 0x1e96: 0x000a, 0x1e97: 0x000a, + 0x1e98: 0x000a, 0x1e99: 0x000a, 0x1e9a: 0x000a, 0x1e9b: 0x000a, 0x1e9c: 0x000a, 0x1e9d: 0x000a, + 0x1e9e: 0x000a, 0x1e9f: 0x000a, 0x1ea0: 0x000a, 0x1ea1: 0x000a, 0x1ea2: 0x000a, 0x1ea3: 0x000a, + 0x1ea4: 0x000a, 0x1ea5: 0x000a, 0x1ea6: 0x000a, 0x1ea7: 0x000a, 0x1ea8: 0x000a, 0x1ea9: 0x000a, + 0x1eaa: 0x000a, 0x1eab: 0x000a, 0x1eac: 0x000a, 0x1ead: 0x000a, 0x1eae: 0x000a, 0x1eaf: 0x000a, + 0x1eb0: 0x000a, 0x1eb1: 0x000a, 0x1eb2: 0x000a, 0x1eb3: 0x000a, 0x1eb4: 0x000a, 0x1eb5: 0x000a, + 0x1eb6: 0x000a, 0x1eb7: 0x000a, 0x1eb8: 0x000a, 0x1eb9: 0x000a, 0x1eba: 0x000a, 0x1ebb: 0x000a, + 0x1ebc: 0x000a, 0x1ebd: 0x000a, 0x1ebe: 0x000a, 0x1ebf: 0x000a, + // Block 0x7b, offset 0x1ec0 + 0x1ec0: 0x000a, 0x1ec1: 0x000a, 0x1ec2: 0x000a, 0x1ec3: 0x000a, 0x1ec4: 0x000a, 0x1ec5: 0x000a, + 0x1ec6: 0x000a, + // Block 0x7c, offset 0x1f00 + 0x1f0d: 0x000a, 0x1f0e: 0x000a, 0x1f0f: 0x000a, + // Block 0x7d, offset 0x1f40 + 0x1f6f: 0x000c, + 0x1f70: 0x000c, 0x1f71: 0x000c, 0x1f72: 0x000c, 0x1f73: 0x000a, 0x1f74: 0x000c, 0x1f75: 0x000c, + 0x1f76: 0x000c, 0x1f77: 0x000c, 0x1f78: 0x000c, 0x1f79: 0x000c, 0x1f7a: 0x000c, 0x1f7b: 0x000c, + 0x1f7c: 0x000c, 0x1f7d: 0x000c, 0x1f7e: 0x000a, 0x1f7f: 0x000a, + // Block 0x7e, offset 0x1f80 + 0x1f9e: 0x000c, 0x1f9f: 0x000c, + // Block 0x7f, offset 0x1fc0 + 0x1ff0: 0x000c, 0x1ff1: 0x000c, + // Block 0x80, offset 0x2000 + 0x2000: 0x000a, 0x2001: 0x000a, 0x2002: 0x000a, 0x2003: 0x000a, 0x2004: 0x000a, 0x2005: 0x000a, + 0x2006: 0x000a, 0x2007: 0x000a, 0x2008: 0x000a, 0x2009: 0x000a, 0x200a: 0x000a, 0x200b: 0x000a, + 0x200c: 0x000a, 0x200d: 0x000a, 0x200e: 0x000a, 0x200f: 0x000a, 0x2010: 0x000a, 0x2011: 0x000a, + 0x2012: 0x000a, 0x2013: 0x000a, 0x2014: 0x000a, 0x2015: 0x000a, 0x2016: 0x000a, 0x2017: 0x000a, + 0x2018: 0x000a, 0x2019: 0x000a, 0x201a: 0x000a, 0x201b: 0x000a, 0x201c: 0x000a, 0x201d: 0x000a, + 0x201e: 0x000a, 0x201f: 0x000a, 0x2020: 0x000a, 0x2021: 0x000a, + // Block 0x81, offset 0x2040 + 0x2048: 0x000a, + // Block 0x82, offset 0x2080 + 0x2082: 0x000c, + 0x2086: 0x000c, 0x208b: 0x000c, + 0x20a5: 0x000c, 0x20a6: 0x000c, 0x20a8: 0x000a, 0x20a9: 0x000a, + 0x20aa: 0x000a, 0x20ab: 0x000a, + 0x20b8: 0x0004, 0x20b9: 0x0004, + // Block 0x83, offset 0x20c0 + 0x20f4: 0x000a, 0x20f5: 0x000a, + 0x20f6: 0x000a, 0x20f7: 0x000a, + // Block 0x84, offset 0x2100 + 0x2104: 0x000c, 0x2105: 0x000c, + 0x2120: 0x000c, 0x2121: 0x000c, 0x2122: 0x000c, 0x2123: 0x000c, + 0x2124: 0x000c, 0x2125: 0x000c, 0x2126: 0x000c, 0x2127: 0x000c, 0x2128: 0x000c, 0x2129: 0x000c, + 0x212a: 0x000c, 0x212b: 0x000c, 0x212c: 0x000c, 0x212d: 0x000c, 0x212e: 0x000c, 0x212f: 0x000c, + 0x2130: 0x000c, 0x2131: 0x000c, + // Block 0x85, offset 0x2140 + 0x2166: 0x000c, 0x2167: 0x000c, 0x2168: 0x000c, 0x2169: 0x000c, + 0x216a: 0x000c, 0x216b: 0x000c, 0x216c: 0x000c, 0x216d: 0x000c, + // Block 0x86, offset 0x2180 + 0x2187: 0x000c, 0x2188: 0x000c, 0x2189: 0x000c, 0x218a: 0x000c, 0x218b: 0x000c, + 0x218c: 0x000c, 0x218d: 0x000c, 0x218e: 0x000c, 0x218f: 0x000c, 0x2190: 0x000c, 0x2191: 0x000c, + // Block 0x87, offset 0x21c0 + 0x21c0: 0x000c, 0x21c1: 0x000c, 0x21c2: 0x000c, + 0x21f3: 0x000c, + 0x21f6: 0x000c, 0x21f7: 0x000c, 0x21f8: 0x000c, 0x21f9: 0x000c, + 0x21fc: 0x000c, + // Block 0x88, offset 0x2200 + 0x2225: 0x000c, + // Block 0x89, offset 0x2240 + 0x2269: 0x000c, + 0x226a: 0x000c, 0x226b: 0x000c, 0x226c: 0x000c, 0x226d: 0x000c, 0x226e: 0x000c, + 0x2271: 0x000c, 0x2272: 0x000c, 0x2275: 0x000c, + 0x2276: 0x000c, + // Block 0x8a, offset 0x2280 + 0x2283: 0x000c, + 0x228c: 0x000c, + 0x22bc: 0x000c, + // Block 0x8b, offset 0x22c0 + 0x22f0: 0x000c, 0x22f2: 0x000c, 0x22f3: 0x000c, 0x22f4: 0x000c, + 0x22f7: 0x000c, 0x22f8: 0x000c, + 0x22fe: 0x000c, 0x22ff: 0x000c, + // Block 0x8c, offset 0x2300 + 0x2301: 0x000c, + 0x232c: 0x000c, 0x232d: 0x000c, + 0x2336: 0x000c, + // Block 0x8d, offset 0x2340 + 0x2365: 0x000c, 0x2368: 0x000c, + 0x236d: 0x000c, + // Block 0x8e, offset 0x2380 + 0x239d: 0x0001, + 0x239e: 0x000c, 0x239f: 0x0001, 0x23a0: 0x0001, 0x23a1: 0x0001, 0x23a2: 0x0001, 0x23a3: 0x0001, + 0x23a4: 0x0001, 0x23a5: 0x0001, 0x23a6: 0x0001, 0x23a7: 0x0001, 0x23a8: 0x0001, 0x23a9: 0x0003, + 0x23aa: 0x0001, 0x23ab: 0x0001, 0x23ac: 0x0001, 0x23ad: 0x0001, 0x23ae: 0x0001, 0x23af: 0x0001, + 0x23b0: 0x0001, 0x23b1: 0x0001, 0x23b2: 0x0001, 0x23b3: 0x0001, 0x23b4: 0x0001, 0x23b5: 0x0001, + 0x23b6: 0x0001, 0x23b7: 0x0001, 0x23b8: 0x0001, 0x23b9: 0x0001, 0x23ba: 0x0001, 0x23bb: 0x0001, + 0x23bc: 0x0001, 0x23bd: 0x0001, 0x23be: 0x0001, 0x23bf: 0x0001, + // Block 0x8f, offset 0x23c0 + 0x23c0: 0x0001, 0x23c1: 0x0001, 0x23c2: 0x0001, 0x23c3: 0x0001, 0x23c4: 0x0001, 0x23c5: 0x0001, + 0x23c6: 0x0001, 0x23c7: 0x0001, 0x23c8: 0x0001, 0x23c9: 0x0001, 0x23ca: 0x0001, 0x23cb: 0x0001, + 0x23cc: 0x0001, 0x23cd: 0x0001, 0x23ce: 0x0001, 0x23cf: 0x0001, 0x23d0: 0x000d, 0x23d1: 0x000d, + 0x23d2: 0x000d, 0x23d3: 0x000d, 0x23d4: 0x000d, 0x23d5: 0x000d, 0x23d6: 0x000d, 0x23d7: 0x000d, + 0x23d8: 0x000d, 0x23d9: 0x000d, 0x23da: 0x000d, 0x23db: 0x000d, 0x23dc: 0x000d, 0x23dd: 0x000d, + 0x23de: 0x000d, 0x23df: 0x000d, 0x23e0: 0x000d, 0x23e1: 0x000d, 0x23e2: 0x000d, 0x23e3: 0x000d, + 0x23e4: 0x000d, 0x23e5: 0x000d, 0x23e6: 0x000d, 0x23e7: 0x000d, 0x23e8: 0x000d, 0x23e9: 0x000d, + 0x23ea: 0x000d, 0x23eb: 0x000d, 0x23ec: 0x000d, 0x23ed: 0x000d, 0x23ee: 0x000d, 0x23ef: 0x000d, + 0x23f0: 0x000d, 0x23f1: 0x000d, 0x23f2: 0x000d, 0x23f3: 0x000d, 0x23f4: 0x000d, 0x23f5: 0x000d, + 0x23f6: 0x000d, 0x23f7: 0x000d, 0x23f8: 0x000d, 0x23f9: 0x000d, 0x23fa: 0x000d, 0x23fb: 0x000d, + 0x23fc: 0x000d, 0x23fd: 0x000d, 0x23fe: 0x000d, 0x23ff: 0x000d, + // Block 0x90, offset 0x2400 + 0x2400: 0x000d, 0x2401: 0x000d, 0x2402: 0x000d, 0x2403: 0x000d, 0x2404: 0x000d, 0x2405: 0x000d, + 0x2406: 0x000d, 0x2407: 0x000d, 0x2408: 0x000d, 0x2409: 0x000d, 0x240a: 0x000d, 0x240b: 0x000d, + 0x240c: 0x000d, 0x240d: 0x000d, 0x240e: 0x000d, 0x240f: 0x000d, 0x2410: 0x000d, 0x2411: 0x000d, + 0x2412: 0x000d, 0x2413: 0x000d, 0x2414: 0x000d, 0x2415: 0x000d, 0x2416: 0x000d, 0x2417: 0x000d, + 0x2418: 0x000d, 0x2419: 0x000d, 0x241a: 0x000d, 0x241b: 0x000d, 0x241c: 0x000d, 0x241d: 0x000d, + 0x241e: 0x000d, 0x241f: 0x000d, 0x2420: 0x000d, 0x2421: 0x000d, 0x2422: 0x000d, 0x2423: 0x000d, + 0x2424: 0x000d, 0x2425: 0x000d, 0x2426: 0x000d, 0x2427: 0x000d, 0x2428: 0x000d, 0x2429: 0x000d, + 0x242a: 0x000d, 0x242b: 0x000d, 0x242c: 0x000d, 0x242d: 0x000d, 0x242e: 0x000d, 0x242f: 0x000d, + 0x2430: 0x000d, 0x2431: 0x000d, 0x2432: 0x000d, 0x2433: 0x000d, 0x2434: 0x000d, 0x2435: 0x000d, + 0x2436: 0x000d, 0x2437: 0x000d, 0x2438: 0x000d, 0x2439: 0x000d, 0x243a: 0x000d, 0x243b: 0x000d, + 0x243c: 0x000d, 0x243d: 0x000d, 0x243e: 0x000a, 0x243f: 0x000a, + // Block 0x91, offset 0x2440 + 0x2440: 0x000d, 0x2441: 0x000d, 0x2442: 0x000d, 0x2443: 0x000d, 0x2444: 0x000d, 0x2445: 0x000d, + 0x2446: 0x000d, 0x2447: 0x000d, 0x2448: 0x000d, 0x2449: 0x000d, 0x244a: 0x000d, 0x244b: 0x000d, + 0x244c: 0x000d, 0x244d: 0x000d, 0x244e: 0x000d, 0x244f: 0x000d, 0x2450: 0x000b, 0x2451: 0x000b, + 0x2452: 0x000b, 0x2453: 0x000b, 0x2454: 0x000b, 0x2455: 0x000b, 0x2456: 0x000b, 0x2457: 0x000b, + 0x2458: 0x000b, 0x2459: 0x000b, 0x245a: 0x000b, 0x245b: 0x000b, 0x245c: 0x000b, 0x245d: 0x000b, + 0x245e: 0x000b, 0x245f: 0x000b, 0x2460: 0x000b, 0x2461: 0x000b, 0x2462: 0x000b, 0x2463: 0x000b, + 0x2464: 0x000b, 0x2465: 0x000b, 0x2466: 0x000b, 0x2467: 0x000b, 0x2468: 0x000b, 0x2469: 0x000b, + 0x246a: 0x000b, 0x246b: 0x000b, 0x246c: 0x000b, 0x246d: 0x000b, 0x246e: 0x000b, 0x246f: 0x000b, + 0x2470: 0x000d, 0x2471: 0x000d, 0x2472: 0x000d, 0x2473: 0x000d, 0x2474: 0x000d, 0x2475: 0x000d, + 0x2476: 0x000d, 0x2477: 0x000d, 0x2478: 0x000d, 0x2479: 0x000d, 0x247a: 0x000d, 0x247b: 0x000d, + 0x247c: 0x000d, 0x247d: 0x000a, 0x247e: 0x000d, 0x247f: 0x000d, + // Block 0x92, offset 0x2480 + 0x2480: 0x000c, 0x2481: 0x000c, 0x2482: 0x000c, 0x2483: 0x000c, 0x2484: 0x000c, 0x2485: 0x000c, + 0x2486: 0x000c, 0x2487: 0x000c, 0x2488: 0x000c, 0x2489: 0x000c, 0x248a: 0x000c, 0x248b: 0x000c, + 0x248c: 0x000c, 0x248d: 0x000c, 0x248e: 0x000c, 0x248f: 0x000c, 0x2490: 0x000a, 0x2491: 0x000a, + 0x2492: 0x000a, 0x2493: 0x000a, 0x2494: 0x000a, 0x2495: 0x000a, 0x2496: 0x000a, 0x2497: 0x000a, + 0x2498: 0x000a, 0x2499: 0x000a, + 0x24a0: 0x000c, 0x24a1: 0x000c, 0x24a2: 0x000c, 0x24a3: 0x000c, + 0x24a4: 0x000c, 0x24a5: 0x000c, 0x24a6: 0x000c, 0x24a7: 0x000c, 0x24a8: 0x000c, 0x24a9: 0x000c, + 0x24aa: 0x000c, 0x24ab: 0x000c, 0x24ac: 0x000c, 0x24ad: 0x000c, 0x24ae: 0x000c, 0x24af: 0x000c, + 0x24b0: 0x000a, 0x24b1: 0x000a, 0x24b2: 0x000a, 0x24b3: 0x000a, 0x24b4: 0x000a, 0x24b5: 0x000a, + 0x24b6: 0x000a, 0x24b7: 0x000a, 0x24b8: 0x000a, 0x24b9: 0x000a, 0x24ba: 0x000a, 0x24bb: 0x000a, + 0x24bc: 0x000a, 0x24bd: 0x000a, 0x24be: 0x000a, 0x24bf: 0x000a, + // Block 0x93, offset 0x24c0 + 0x24c0: 0x000a, 0x24c1: 0x000a, 0x24c2: 0x000a, 0x24c3: 0x000a, 0x24c4: 0x000a, 0x24c5: 0x000a, + 0x24c6: 0x000a, 0x24c7: 0x000a, 0x24c8: 0x000a, 0x24c9: 0x000a, 0x24ca: 0x000a, 0x24cb: 0x000a, + 0x24cc: 0x000a, 0x24cd: 0x000a, 0x24ce: 0x000a, 0x24cf: 0x000a, 0x24d0: 0x0006, 0x24d1: 0x000a, + 0x24d2: 0x0006, 0x24d4: 0x000a, 0x24d5: 0x0006, 0x24d6: 0x000a, 0x24d7: 0x000a, + 0x24d8: 0x000a, 0x24d9: 0x009a, 0x24da: 0x008a, 0x24db: 0x007a, 0x24dc: 0x006a, 0x24dd: 0x009a, + 0x24de: 0x008a, 0x24df: 0x0004, 0x24e0: 0x000a, 0x24e1: 0x000a, 0x24e2: 0x0003, 0x24e3: 0x0003, + 0x24e4: 0x000a, 0x24e5: 0x000a, 0x24e6: 0x000a, 0x24e8: 0x000a, 0x24e9: 0x0004, + 0x24ea: 0x0004, 0x24eb: 0x000a, + 0x24f0: 0x000d, 0x24f1: 0x000d, 0x24f2: 0x000d, 0x24f3: 0x000d, 0x24f4: 0x000d, 0x24f5: 0x000d, + 0x24f6: 0x000d, 0x24f7: 0x000d, 0x24f8: 0x000d, 0x24f9: 0x000d, 0x24fa: 0x000d, 0x24fb: 0x000d, + 0x24fc: 0x000d, 0x24fd: 0x000d, 0x24fe: 0x000d, 0x24ff: 0x000d, + // Block 0x94, offset 0x2500 + 0x2500: 0x000d, 0x2501: 0x000d, 0x2502: 0x000d, 0x2503: 0x000d, 0x2504: 0x000d, 0x2505: 0x000d, + 0x2506: 0x000d, 0x2507: 0x000d, 0x2508: 0x000d, 0x2509: 0x000d, 0x250a: 0x000d, 0x250b: 0x000d, + 0x250c: 0x000d, 0x250d: 0x000d, 0x250e: 0x000d, 0x250f: 0x000d, 0x2510: 0x000d, 0x2511: 0x000d, + 0x2512: 0x000d, 0x2513: 0x000d, 0x2514: 0x000d, 0x2515: 0x000d, 0x2516: 0x000d, 0x2517: 0x000d, + 0x2518: 0x000d, 0x2519: 0x000d, 0x251a: 0x000d, 0x251b: 0x000d, 0x251c: 0x000d, 0x251d: 0x000d, + 0x251e: 0x000d, 0x251f: 0x000d, 0x2520: 0x000d, 0x2521: 0x000d, 0x2522: 0x000d, 0x2523: 0x000d, + 0x2524: 0x000d, 0x2525: 0x000d, 0x2526: 0x000d, 0x2527: 0x000d, 0x2528: 0x000d, 0x2529: 0x000d, + 0x252a: 0x000d, 0x252b: 0x000d, 0x252c: 0x000d, 0x252d: 0x000d, 0x252e: 0x000d, 0x252f: 0x000d, + 0x2530: 0x000d, 0x2531: 0x000d, 0x2532: 0x000d, 0x2533: 0x000d, 0x2534: 0x000d, 0x2535: 0x000d, + 0x2536: 0x000d, 0x2537: 0x000d, 0x2538: 0x000d, 0x2539: 0x000d, 0x253a: 0x000d, 0x253b: 0x000d, + 0x253c: 0x000d, 0x253d: 0x000d, 0x253e: 0x000d, 0x253f: 0x000b, + // Block 0x95, offset 0x2540 + 0x2541: 0x000a, 0x2542: 0x000a, 0x2543: 0x0004, 0x2544: 0x0004, 0x2545: 0x0004, + 0x2546: 0x000a, 0x2547: 0x000a, 0x2548: 0x003a, 0x2549: 0x002a, 0x254a: 0x000a, 0x254b: 0x0003, + 0x254c: 0x0006, 0x254d: 0x0003, 0x254e: 0x0006, 0x254f: 0x0006, 0x2550: 0x0002, 0x2551: 0x0002, + 0x2552: 0x0002, 0x2553: 0x0002, 0x2554: 0x0002, 0x2555: 0x0002, 0x2556: 0x0002, 0x2557: 0x0002, + 0x2558: 0x0002, 0x2559: 0x0002, 0x255a: 0x0006, 0x255b: 0x000a, 0x255c: 0x000a, 0x255d: 0x000a, + 0x255e: 0x000a, 0x255f: 0x000a, 0x2560: 0x000a, + 0x257b: 0x005a, + 0x257c: 0x000a, 0x257d: 0x004a, 0x257e: 0x000a, 0x257f: 0x000a, + // Block 0x96, offset 0x2580 + 0x2580: 0x000a, + 0x259b: 0x005a, 0x259c: 0x000a, 0x259d: 0x004a, + 0x259e: 0x000a, 0x259f: 0x00fa, 0x25a0: 0x00ea, 0x25a1: 0x000a, 0x25a2: 0x003a, 0x25a3: 0x002a, + 0x25a4: 0x000a, 0x25a5: 0x000a, + // Block 0x97, offset 0x25c0 + 0x25e0: 0x0004, 0x25e1: 0x0004, 0x25e2: 0x000a, 0x25e3: 0x000a, + 0x25e4: 0x000a, 0x25e5: 0x0004, 0x25e6: 0x0004, 0x25e8: 0x000a, 0x25e9: 0x000a, + 0x25ea: 0x000a, 0x25eb: 0x000a, 0x25ec: 0x000a, 0x25ed: 0x000a, 0x25ee: 0x000a, + 0x25f0: 0x000b, 0x25f1: 0x000b, 0x25f2: 0x000b, 0x25f3: 0x000b, 0x25f4: 0x000b, 0x25f5: 0x000b, + 0x25f6: 0x000b, 0x25f7: 0x000b, 0x25f8: 0x000b, 0x25f9: 0x000a, 0x25fa: 0x000a, 0x25fb: 0x000a, + 0x25fc: 0x000a, 0x25fd: 0x000a, 0x25fe: 0x000b, 0x25ff: 0x000b, + // Block 0x98, offset 0x2600 + 0x2601: 0x000a, + // Block 0x99, offset 0x2640 + 0x2640: 0x000a, 0x2641: 0x000a, 0x2642: 0x000a, 0x2643: 0x000a, 0x2644: 0x000a, 0x2645: 0x000a, + 0x2646: 0x000a, 0x2647: 0x000a, 0x2648: 0x000a, 0x2649: 0x000a, 0x264a: 0x000a, 0x264b: 0x000a, + 0x264c: 0x000a, 0x2650: 0x000a, 0x2651: 0x000a, + 0x2652: 0x000a, 0x2653: 0x000a, 0x2654: 0x000a, 0x2655: 0x000a, 0x2656: 0x000a, 0x2657: 0x000a, + 0x2658: 0x000a, 0x2659: 0x000a, 0x265a: 0x000a, 0x265b: 0x000a, + 0x2660: 0x000a, + // Block 0x9a, offset 0x2680 + 0x26bd: 0x000c, + // Block 0x9b, offset 0x26c0 + 0x26e0: 0x000c, 0x26e1: 0x0002, 0x26e2: 0x0002, 0x26e3: 0x0002, + 0x26e4: 0x0002, 0x26e5: 0x0002, 0x26e6: 0x0002, 0x26e7: 0x0002, 0x26e8: 0x0002, 0x26e9: 0x0002, + 0x26ea: 0x0002, 0x26eb: 0x0002, 0x26ec: 0x0002, 0x26ed: 0x0002, 0x26ee: 0x0002, 0x26ef: 0x0002, + 0x26f0: 0x0002, 0x26f1: 0x0002, 0x26f2: 0x0002, 0x26f3: 0x0002, 0x26f4: 0x0002, 0x26f5: 0x0002, + 0x26f6: 0x0002, 0x26f7: 0x0002, 0x26f8: 0x0002, 0x26f9: 0x0002, 0x26fa: 0x0002, 0x26fb: 0x0002, + // Block 0x9c, offset 0x2700 + 0x2736: 0x000c, 0x2737: 0x000c, 0x2738: 0x000c, 0x2739: 0x000c, 0x273a: 0x000c, + // Block 0x9d, offset 0x2740 + 0x2740: 0x0001, 0x2741: 0x0001, 0x2742: 0x0001, 0x2743: 0x0001, 0x2744: 0x0001, 0x2745: 0x0001, + 0x2746: 0x0001, 0x2747: 0x0001, 0x2748: 0x0001, 0x2749: 0x0001, 0x274a: 0x0001, 0x274b: 0x0001, + 0x274c: 0x0001, 0x274d: 0x0001, 0x274e: 0x0001, 0x274f: 0x0001, 0x2750: 0x0001, 0x2751: 0x0001, + 0x2752: 0x0001, 0x2753: 0x0001, 0x2754: 0x0001, 0x2755: 0x0001, 0x2756: 0x0001, 0x2757: 0x0001, + 0x2758: 0x0001, 0x2759: 0x0001, 0x275a: 0x0001, 0x275b: 0x0001, 0x275c: 0x0001, 0x275d: 0x0001, + 0x275e: 0x0001, 0x275f: 0x0001, 0x2760: 0x0001, 0x2761: 0x0001, 0x2762: 0x0001, 0x2763: 0x0001, + 0x2764: 0x0001, 0x2765: 0x0001, 0x2766: 0x0001, 0x2767: 0x0001, 0x2768: 0x0001, 0x2769: 0x0001, + 0x276a: 0x0001, 0x276b: 0x0001, 0x276c: 0x0001, 0x276d: 0x0001, 0x276e: 0x0001, 0x276f: 0x0001, + 0x2770: 0x0001, 0x2771: 0x0001, 0x2772: 0x0001, 0x2773: 0x0001, 0x2774: 0x0001, 0x2775: 0x0001, + 0x2776: 0x0001, 0x2777: 0x0001, 0x2778: 0x0001, 0x2779: 0x0001, 0x277a: 0x0001, 0x277b: 0x0001, + 0x277c: 0x0001, 0x277d: 0x0001, 0x277e: 0x0001, 0x277f: 0x0001, + // Block 0x9e, offset 0x2780 + 0x2780: 0x0001, 0x2781: 0x0001, 0x2782: 0x0001, 0x2783: 0x0001, 0x2784: 0x0001, 0x2785: 0x0001, + 0x2786: 0x0001, 0x2787: 0x0001, 0x2788: 0x0001, 0x2789: 0x0001, 0x278a: 0x0001, 0x278b: 0x0001, + 0x278c: 0x0001, 0x278d: 0x0001, 0x278e: 0x0001, 0x278f: 0x0001, 0x2790: 0x0001, 0x2791: 0x0001, + 0x2792: 0x0001, 0x2793: 0x0001, 0x2794: 0x0001, 0x2795: 0x0001, 0x2796: 0x0001, 0x2797: 0x0001, + 0x2798: 0x0001, 0x2799: 0x0001, 0x279a: 0x0001, 0x279b: 0x0001, 0x279c: 0x0001, 0x279d: 0x0001, + 0x279e: 0x0001, 0x279f: 0x000a, 0x27a0: 0x0001, 0x27a1: 0x0001, 0x27a2: 0x0001, 0x27a3: 0x0001, + 0x27a4: 0x0001, 0x27a5: 0x0001, 0x27a6: 0x0001, 0x27a7: 0x0001, 0x27a8: 0x0001, 0x27a9: 0x0001, + 0x27aa: 0x0001, 0x27ab: 0x0001, 0x27ac: 0x0001, 0x27ad: 0x0001, 0x27ae: 0x0001, 0x27af: 0x0001, + 0x27b0: 0x0001, 0x27b1: 0x0001, 0x27b2: 0x0001, 0x27b3: 0x0001, 0x27b4: 0x0001, 0x27b5: 0x0001, + 0x27b6: 0x0001, 0x27b7: 0x0001, 0x27b8: 0x0001, 0x27b9: 0x0001, 0x27ba: 0x0001, 0x27bb: 0x0001, + 0x27bc: 0x0001, 0x27bd: 0x0001, 0x27be: 0x0001, 0x27bf: 0x0001, + // Block 0x9f, offset 0x27c0 + 0x27c0: 0x0001, 0x27c1: 0x000c, 0x27c2: 0x000c, 0x27c3: 0x000c, 0x27c4: 0x0001, 0x27c5: 0x000c, + 0x27c6: 0x000c, 0x27c7: 0x0001, 0x27c8: 0x0001, 0x27c9: 0x0001, 0x27ca: 0x0001, 0x27cb: 0x0001, + 0x27cc: 0x000c, 0x27cd: 0x000c, 0x27ce: 0x000c, 0x27cf: 0x000c, 0x27d0: 0x0001, 0x27d1: 0x0001, + 0x27d2: 0x0001, 0x27d3: 0x0001, 0x27d4: 0x0001, 0x27d5: 0x0001, 0x27d6: 0x0001, 0x27d7: 0x0001, + 0x27d8: 0x0001, 0x27d9: 0x0001, 0x27da: 0x0001, 0x27db: 0x0001, 0x27dc: 0x0001, 0x27dd: 0x0001, + 0x27de: 0x0001, 0x27df: 0x0001, 0x27e0: 0x0001, 0x27e1: 0x0001, 0x27e2: 0x0001, 0x27e3: 0x0001, + 0x27e4: 0x0001, 0x27e5: 0x0001, 0x27e6: 0x0001, 0x27e7: 0x0001, 0x27e8: 0x0001, 0x27e9: 0x0001, + 0x27ea: 0x0001, 0x27eb: 0x0001, 0x27ec: 0x0001, 0x27ed: 0x0001, 0x27ee: 0x0001, 0x27ef: 0x0001, + 0x27f0: 0x0001, 0x27f1: 0x0001, 0x27f2: 0x0001, 0x27f3: 0x0001, 0x27f4: 0x0001, 0x27f5: 0x0001, + 0x27f6: 0x0001, 0x27f7: 0x0001, 0x27f8: 0x000c, 0x27f9: 0x000c, 0x27fa: 0x000c, 0x27fb: 0x0001, + 0x27fc: 0x0001, 0x27fd: 0x0001, 0x27fe: 0x0001, 0x27ff: 0x000c, + // Block 0xa0, offset 0x2800 + 0x2800: 0x0001, 0x2801: 0x0001, 0x2802: 0x0001, 0x2803: 0x0001, 0x2804: 0x0001, 0x2805: 0x0001, + 0x2806: 0x0001, 0x2807: 0x0001, 0x2808: 0x0001, 0x2809: 0x0001, 0x280a: 0x0001, 0x280b: 0x0001, + 0x280c: 0x0001, 0x280d: 0x0001, 0x280e: 0x0001, 0x280f: 0x0001, 0x2810: 0x0001, 0x2811: 0x0001, + 0x2812: 0x0001, 0x2813: 0x0001, 0x2814: 0x0001, 0x2815: 0x0001, 0x2816: 0x0001, 0x2817: 0x0001, + 0x2818: 0x0001, 0x2819: 0x0001, 0x281a: 0x0001, 0x281b: 0x0001, 0x281c: 0x0001, 0x281d: 0x0001, + 0x281e: 0x0001, 0x281f: 0x0001, 0x2820: 0x0001, 0x2821: 0x0001, 0x2822: 0x0001, 0x2823: 0x0001, + 0x2824: 0x0001, 0x2825: 0x000c, 0x2826: 0x000c, 0x2827: 0x0001, 0x2828: 0x0001, 0x2829: 0x0001, + 0x282a: 0x0001, 0x282b: 0x0001, 0x282c: 0x0001, 0x282d: 0x0001, 0x282e: 0x0001, 0x282f: 0x0001, + 0x2830: 0x0001, 0x2831: 0x0001, 0x2832: 0x0001, 0x2833: 0x0001, 0x2834: 0x0001, 0x2835: 0x0001, + 0x2836: 0x0001, 0x2837: 0x0001, 0x2838: 0x0001, 0x2839: 0x0001, 0x283a: 0x0001, 0x283b: 0x0001, + 0x283c: 0x0001, 0x283d: 0x0001, 0x283e: 0x0001, 0x283f: 0x0001, + // Block 0xa1, offset 0x2840 + 0x2840: 0x0001, 0x2841: 0x0001, 0x2842: 0x0001, 0x2843: 0x0001, 0x2844: 0x0001, 0x2845: 0x0001, + 0x2846: 0x0001, 0x2847: 0x0001, 0x2848: 0x0001, 0x2849: 0x0001, 0x284a: 0x0001, 0x284b: 0x0001, + 0x284c: 0x0001, 0x284d: 0x0001, 0x284e: 0x0001, 0x284f: 0x0001, 0x2850: 0x0001, 0x2851: 0x0001, + 0x2852: 0x0001, 0x2853: 0x0001, 0x2854: 0x0001, 0x2855: 0x0001, 0x2856: 0x0001, 0x2857: 0x0001, + 0x2858: 0x0001, 0x2859: 0x0001, 0x285a: 0x0001, 0x285b: 0x0001, 0x285c: 0x0001, 0x285d: 0x0001, + 0x285e: 0x0001, 0x285f: 0x0001, 0x2860: 0x0001, 0x2861: 0x0001, 0x2862: 0x0001, 0x2863: 0x0001, + 0x2864: 0x0001, 0x2865: 0x0001, 0x2866: 0x0001, 0x2867: 0x0001, 0x2868: 0x0001, 0x2869: 0x0001, + 0x286a: 0x0001, 0x286b: 0x0001, 0x286c: 0x0001, 0x286d: 0x0001, 0x286e: 0x0001, 0x286f: 0x0001, + 0x2870: 0x0001, 0x2871: 0x0001, 0x2872: 0x0001, 0x2873: 0x0001, 0x2874: 0x0001, 0x2875: 0x0001, + 0x2876: 0x0001, 0x2877: 0x0001, 0x2878: 0x0001, 0x2879: 0x000a, 0x287a: 0x000a, 0x287b: 0x000a, + 0x287c: 0x000a, 0x287d: 0x000a, 0x287e: 0x000a, 0x287f: 0x000a, + // Block 0xa2, offset 0x2880 + 0x2880: 0x0001, 0x2881: 0x0001, 0x2882: 0x0001, 0x2883: 0x0001, 0x2884: 0x0001, 0x2885: 0x0001, + 0x2886: 0x0001, 0x2887: 0x0001, 0x2888: 0x0001, 0x2889: 0x0001, 0x288a: 0x0001, 0x288b: 0x0001, + 0x288c: 0x0001, 0x288d: 0x0001, 0x288e: 0x0001, 0x288f: 0x0001, 0x2890: 0x0001, 0x2891: 0x0001, + 0x2892: 0x0001, 0x2893: 0x0001, 0x2894: 0x0001, 0x2895: 0x0001, 0x2896: 0x0001, 0x2897: 0x0001, + 0x2898: 0x0001, 0x2899: 0x0001, 0x289a: 0x0001, 0x289b: 0x0001, 0x289c: 0x0001, 0x289d: 0x0001, + 0x289e: 0x0001, 0x289f: 0x0001, 0x28a0: 0x0005, 0x28a1: 0x0005, 0x28a2: 0x0005, 0x28a3: 0x0005, + 0x28a4: 0x0005, 0x28a5: 0x0005, 0x28a6: 0x0005, 0x28a7: 0x0005, 0x28a8: 0x0005, 0x28a9: 0x0005, + 0x28aa: 0x0005, 0x28ab: 0x0005, 0x28ac: 0x0005, 0x28ad: 0x0005, 0x28ae: 0x0005, 0x28af: 0x0005, + 0x28b0: 0x0005, 0x28b1: 0x0005, 0x28b2: 0x0005, 0x28b3: 0x0005, 0x28b4: 0x0005, 0x28b5: 0x0005, + 0x28b6: 0x0005, 0x28b7: 0x0005, 0x28b8: 0x0005, 0x28b9: 0x0005, 0x28ba: 0x0005, 0x28bb: 0x0005, + 0x28bc: 0x0005, 0x28bd: 0x0005, 0x28be: 0x0005, 0x28bf: 0x0001, + // Block 0xa3, offset 0x28c0 + 0x28c1: 0x000c, + 0x28f8: 0x000c, 0x28f9: 0x000c, 0x28fa: 0x000c, 0x28fb: 0x000c, + 0x28fc: 0x000c, 0x28fd: 0x000c, 0x28fe: 0x000c, 0x28ff: 0x000c, + // Block 0xa4, offset 0x2900 + 0x2900: 0x000c, 0x2901: 0x000c, 0x2902: 0x000c, 0x2903: 0x000c, 0x2904: 0x000c, 0x2905: 0x000c, + 0x2906: 0x000c, + 0x2912: 0x000a, 0x2913: 0x000a, 0x2914: 0x000a, 0x2915: 0x000a, 0x2916: 0x000a, 0x2917: 0x000a, + 0x2918: 0x000a, 0x2919: 0x000a, 0x291a: 0x000a, 0x291b: 0x000a, 0x291c: 0x000a, 0x291d: 0x000a, + 0x291e: 0x000a, 0x291f: 0x000a, 0x2920: 0x000a, 0x2921: 0x000a, 0x2922: 0x000a, 0x2923: 0x000a, + 0x2924: 0x000a, 0x2925: 0x000a, + 0x293f: 0x000c, + // Block 0xa5, offset 0x2940 + 0x2940: 0x000c, 0x2941: 0x000c, + 0x2973: 0x000c, 0x2974: 0x000c, 0x2975: 0x000c, + 0x2976: 0x000c, 0x2979: 0x000c, 0x297a: 0x000c, + // Block 0xa6, offset 0x2980 + 0x2980: 0x000c, 0x2981: 0x000c, 0x2982: 0x000c, + 0x29a7: 0x000c, 0x29a8: 0x000c, 0x29a9: 0x000c, + 0x29aa: 0x000c, 0x29ab: 0x000c, 0x29ad: 0x000c, 0x29ae: 0x000c, 0x29af: 0x000c, + 0x29b0: 0x000c, 0x29b1: 0x000c, 0x29b2: 0x000c, 0x29b3: 0x000c, 0x29b4: 0x000c, + // Block 0xa7, offset 0x29c0 + 0x29f3: 0x000c, + // Block 0xa8, offset 0x2a00 + 0x2a00: 0x000c, 0x2a01: 0x000c, + 0x2a36: 0x000c, 0x2a37: 0x000c, 0x2a38: 0x000c, 0x2a39: 0x000c, 0x2a3a: 0x000c, 0x2a3b: 0x000c, + 0x2a3c: 0x000c, 0x2a3d: 0x000c, 0x2a3e: 0x000c, + // Block 0xa9, offset 0x2a40 + 0x2a4a: 0x000c, 0x2a4b: 0x000c, + 0x2a4c: 0x000c, + // Block 0xaa, offset 0x2a80 + 0x2aaf: 0x000c, + 0x2ab0: 0x000c, 0x2ab1: 0x000c, 0x2ab4: 0x000c, + 0x2ab6: 0x000c, 0x2ab7: 0x000c, + 0x2abe: 0x000c, + // Block 0xab, offset 0x2ac0 + 0x2adf: 0x000c, 0x2ae3: 0x000c, + 0x2ae4: 0x000c, 0x2ae5: 0x000c, 0x2ae6: 0x000c, 0x2ae7: 0x000c, 0x2ae8: 0x000c, 0x2ae9: 0x000c, + 0x2aea: 0x000c, + // Block 0xac, offset 0x2b00 + 0x2b00: 0x000c, 0x2b01: 0x000c, + 0x2b3c: 0x000c, + // Block 0xad, offset 0x2b40 + 0x2b40: 0x000c, + 0x2b66: 0x000c, 0x2b67: 0x000c, 0x2b68: 0x000c, 0x2b69: 0x000c, + 0x2b6a: 0x000c, 0x2b6b: 0x000c, 0x2b6c: 0x000c, + 0x2b70: 0x000c, 0x2b71: 0x000c, 0x2b72: 0x000c, 0x2b73: 0x000c, 0x2b74: 0x000c, + // Block 0xae, offset 0x2b80 + 0x2bb8: 0x000c, 0x2bb9: 0x000c, 0x2bba: 0x000c, 0x2bbb: 0x000c, + 0x2bbc: 0x000c, 0x2bbd: 0x000c, 0x2bbe: 0x000c, 0x2bbf: 0x000c, + // Block 0xaf, offset 0x2bc0 + 0x2bc2: 0x000c, 0x2bc3: 0x000c, 0x2bc4: 0x000c, + 0x2bc6: 0x000c, + // Block 0xb0, offset 0x2c00 + 0x2c33: 0x000c, 0x2c34: 0x000c, 0x2c35: 0x000c, + 0x2c36: 0x000c, 0x2c37: 0x000c, 0x2c38: 0x000c, 0x2c3a: 0x000c, + 0x2c3f: 0x000c, + // Block 0xb1, offset 0x2c40 + 0x2c40: 0x000c, 0x2c42: 0x000c, 0x2c43: 0x000c, + // Block 0xb2, offset 0x2c80 + 0x2cb2: 0x000c, 0x2cb3: 0x000c, 0x2cb4: 0x000c, 0x2cb5: 0x000c, + 0x2cbc: 0x000c, 0x2cbd: 0x000c, 0x2cbf: 0x000c, + // Block 0xb3, offset 0x2cc0 + 0x2cc0: 0x000c, + 0x2cdc: 0x000c, 0x2cdd: 0x000c, + // Block 0xb4, offset 0x2d00 + 0x2d33: 0x000c, 0x2d34: 0x000c, 0x2d35: 0x000c, + 0x2d36: 0x000c, 0x2d37: 0x000c, 0x2d38: 0x000c, 0x2d39: 0x000c, 0x2d3a: 0x000c, + 0x2d3d: 0x000c, 0x2d3f: 0x000c, + // Block 0xb5, offset 0x2d40 + 0x2d40: 0x000c, + 0x2d60: 0x000a, 0x2d61: 0x000a, 0x2d62: 0x000a, 0x2d63: 0x000a, + 0x2d64: 0x000a, 0x2d65: 0x000a, 0x2d66: 0x000a, 0x2d67: 0x000a, 0x2d68: 0x000a, 0x2d69: 0x000a, + 0x2d6a: 0x000a, 0x2d6b: 0x000a, 0x2d6c: 0x000a, + // Block 0xb6, offset 0x2d80 + 0x2dab: 0x000c, 0x2dad: 0x000c, + 0x2db0: 0x000c, 0x2db1: 0x000c, 0x2db2: 0x000c, 0x2db3: 0x000c, 0x2db4: 0x000c, 0x2db5: 0x000c, + 0x2db7: 0x000c, + // Block 0xb7, offset 0x2dc0 + 0x2ddd: 0x000c, + 0x2dde: 0x000c, 0x2ddf: 0x000c, 0x2de2: 0x000c, 0x2de3: 0x000c, + 0x2de4: 0x000c, 0x2de5: 0x000c, 0x2de7: 0x000c, 0x2de8: 0x000c, 0x2de9: 0x000c, + 0x2dea: 0x000c, 0x2deb: 0x000c, + // Block 0xb8, offset 0x2e00 + 0x2e30: 0x000c, 0x2e31: 0x000c, 0x2e32: 0x000c, 0x2e33: 0x000c, 0x2e34: 0x000c, 0x2e35: 0x000c, + 0x2e36: 0x000c, 0x2e38: 0x000c, 0x2e39: 0x000c, 0x2e3a: 0x000c, 0x2e3b: 0x000c, + 0x2e3c: 0x000c, 0x2e3d: 0x000c, + // Block 0xb9, offset 0x2e40 + 0x2e52: 0x000c, 0x2e53: 0x000c, 0x2e54: 0x000c, 0x2e55: 0x000c, 0x2e56: 0x000c, 0x2e57: 0x000c, + 0x2e58: 0x000c, 0x2e59: 0x000c, 0x2e5a: 0x000c, 0x2e5b: 0x000c, 0x2e5c: 0x000c, 0x2e5d: 0x000c, + 0x2e5e: 0x000c, 0x2e5f: 0x000c, 0x2e60: 0x000c, 0x2e61: 0x000c, 0x2e62: 0x000c, 0x2e63: 0x000c, + 0x2e64: 0x000c, 0x2e65: 0x000c, 0x2e66: 0x000c, 0x2e67: 0x000c, + 0x2e6a: 0x000c, 0x2e6b: 0x000c, 0x2e6c: 0x000c, 0x2e6d: 0x000c, 0x2e6e: 0x000c, 0x2e6f: 0x000c, + 0x2e70: 0x000c, 0x2e72: 0x000c, 0x2e73: 0x000c, 0x2e75: 0x000c, + 0x2e76: 0x000c, + // Block 0xba, offset 0x2e80 + 0x2eb0: 0x000c, 0x2eb1: 0x000c, 0x2eb2: 0x000c, 0x2eb3: 0x000c, 0x2eb4: 0x000c, + // Block 0xbb, offset 0x2ec0 + 0x2ef0: 0x000c, 0x2ef1: 0x000c, 0x2ef2: 0x000c, 0x2ef3: 0x000c, 0x2ef4: 0x000c, 0x2ef5: 0x000c, + 0x2ef6: 0x000c, + // Block 0xbc, offset 0x2f00 + 0x2f0f: 0x000c, 0x2f10: 0x000c, 0x2f11: 0x000c, + 0x2f12: 0x000c, + // Block 0xbd, offset 0x2f40 + 0x2f5d: 0x000c, + 0x2f5e: 0x000c, 0x2f60: 0x000b, 0x2f61: 0x000b, 0x2f62: 0x000b, 0x2f63: 0x000b, + // Block 0xbe, offset 0x2f80 + 0x2fa7: 0x000c, 0x2fa8: 0x000c, 0x2fa9: 0x000c, + 0x2fb3: 0x000b, 0x2fb4: 0x000b, 0x2fb5: 0x000b, + 0x2fb6: 0x000b, 0x2fb7: 0x000b, 0x2fb8: 0x000b, 0x2fb9: 0x000b, 0x2fba: 0x000b, 0x2fbb: 0x000c, + 0x2fbc: 0x000c, 0x2fbd: 0x000c, 0x2fbe: 0x000c, 0x2fbf: 0x000c, + // Block 0xbf, offset 0x2fc0 + 0x2fc0: 0x000c, 0x2fc1: 0x000c, 0x2fc2: 0x000c, 0x2fc5: 0x000c, + 0x2fc6: 0x000c, 0x2fc7: 0x000c, 0x2fc8: 0x000c, 0x2fc9: 0x000c, 0x2fca: 0x000c, 0x2fcb: 0x000c, + 0x2fea: 0x000c, 0x2feb: 0x000c, 0x2fec: 0x000c, 0x2fed: 0x000c, + // Block 0xc0, offset 0x3000 + 0x3000: 0x000a, 0x3001: 0x000a, 0x3002: 0x000c, 0x3003: 0x000c, 0x3004: 0x000c, 0x3005: 0x000a, + // Block 0xc1, offset 0x3040 + 0x3040: 0x000a, 0x3041: 0x000a, 0x3042: 0x000a, 0x3043: 0x000a, 0x3044: 0x000a, 0x3045: 0x000a, + 0x3046: 0x000a, 0x3047: 0x000a, 0x3048: 0x000a, 0x3049: 0x000a, 0x304a: 0x000a, 0x304b: 0x000a, + 0x304c: 0x000a, 0x304d: 0x000a, 0x304e: 0x000a, 0x304f: 0x000a, 0x3050: 0x000a, 0x3051: 0x000a, + 0x3052: 0x000a, 0x3053: 0x000a, 0x3054: 0x000a, 0x3055: 0x000a, 0x3056: 0x000a, + // Block 0xc2, offset 0x3080 + 0x309b: 0x000a, + // Block 0xc3, offset 0x30c0 + 0x30d5: 0x000a, + // Block 0xc4, offset 0x3100 + 0x310f: 0x000a, + // Block 0xc5, offset 0x3140 + 0x3149: 0x000a, + // Block 0xc6, offset 0x3180 + 0x3183: 0x000a, + 0x318e: 0x0002, 0x318f: 0x0002, 0x3190: 0x0002, 0x3191: 0x0002, + 0x3192: 0x0002, 0x3193: 0x0002, 0x3194: 0x0002, 0x3195: 0x0002, 0x3196: 0x0002, 0x3197: 0x0002, + 0x3198: 0x0002, 0x3199: 0x0002, 0x319a: 0x0002, 0x319b: 0x0002, 0x319c: 0x0002, 0x319d: 0x0002, + 0x319e: 0x0002, 0x319f: 0x0002, 0x31a0: 0x0002, 0x31a1: 0x0002, 0x31a2: 0x0002, 0x31a3: 0x0002, + 0x31a4: 0x0002, 0x31a5: 0x0002, 0x31a6: 0x0002, 0x31a7: 0x0002, 0x31a8: 0x0002, 0x31a9: 0x0002, + 0x31aa: 0x0002, 0x31ab: 0x0002, 0x31ac: 0x0002, 0x31ad: 0x0002, 0x31ae: 0x0002, 0x31af: 0x0002, + 0x31b0: 0x0002, 0x31b1: 0x0002, 0x31b2: 0x0002, 0x31b3: 0x0002, 0x31b4: 0x0002, 0x31b5: 0x0002, + 0x31b6: 0x0002, 0x31b7: 0x0002, 0x31b8: 0x0002, 0x31b9: 0x0002, 0x31ba: 0x0002, 0x31bb: 0x0002, + 0x31bc: 0x0002, 0x31bd: 0x0002, 0x31be: 0x0002, 0x31bf: 0x0002, + // Block 0xc7, offset 0x31c0 + 0x31c0: 0x000c, 0x31c1: 0x000c, 0x31c2: 0x000c, 0x31c3: 0x000c, 0x31c4: 0x000c, 0x31c5: 0x000c, + 0x31c6: 0x000c, 0x31c7: 0x000c, 0x31c8: 0x000c, 0x31c9: 0x000c, 0x31ca: 0x000c, 0x31cb: 0x000c, + 0x31cc: 0x000c, 0x31cd: 0x000c, 0x31ce: 0x000c, 0x31cf: 0x000c, 0x31d0: 0x000c, 0x31d1: 0x000c, + 0x31d2: 0x000c, 0x31d3: 0x000c, 0x31d4: 0x000c, 0x31d5: 0x000c, 0x31d6: 0x000c, 0x31d7: 0x000c, + 0x31d8: 0x000c, 0x31d9: 0x000c, 0x31da: 0x000c, 0x31db: 0x000c, 0x31dc: 0x000c, 0x31dd: 0x000c, + 0x31de: 0x000c, 0x31df: 0x000c, 0x31e0: 0x000c, 0x31e1: 0x000c, 0x31e2: 0x000c, 0x31e3: 0x000c, + 0x31e4: 0x000c, 0x31e5: 0x000c, 0x31e6: 0x000c, 0x31e7: 0x000c, 0x31e8: 0x000c, 0x31e9: 0x000c, + 0x31ea: 0x000c, 0x31eb: 0x000c, 0x31ec: 0x000c, 0x31ed: 0x000c, 0x31ee: 0x000c, 0x31ef: 0x000c, + 0x31f0: 0x000c, 0x31f1: 0x000c, 0x31f2: 0x000c, 0x31f3: 0x000c, 0x31f4: 0x000c, 0x31f5: 0x000c, + 0x31f6: 0x000c, 0x31fb: 0x000c, + 0x31fc: 0x000c, 0x31fd: 0x000c, 0x31fe: 0x000c, 0x31ff: 0x000c, + // Block 0xc8, offset 0x3200 + 0x3200: 0x000c, 0x3201: 0x000c, 0x3202: 0x000c, 0x3203: 0x000c, 0x3204: 0x000c, 0x3205: 0x000c, + 0x3206: 0x000c, 0x3207: 0x000c, 0x3208: 0x000c, 0x3209: 0x000c, 0x320a: 0x000c, 0x320b: 0x000c, + 0x320c: 0x000c, 0x320d: 0x000c, 0x320e: 0x000c, 0x320f: 0x000c, 0x3210: 0x000c, 0x3211: 0x000c, + 0x3212: 0x000c, 0x3213: 0x000c, 0x3214: 0x000c, 0x3215: 0x000c, 0x3216: 0x000c, 0x3217: 0x000c, + 0x3218: 0x000c, 0x3219: 0x000c, 0x321a: 0x000c, 0x321b: 0x000c, 0x321c: 0x000c, 0x321d: 0x000c, + 0x321e: 0x000c, 0x321f: 0x000c, 0x3220: 0x000c, 0x3221: 0x000c, 0x3222: 0x000c, 0x3223: 0x000c, + 0x3224: 0x000c, 0x3225: 0x000c, 0x3226: 0x000c, 0x3227: 0x000c, 0x3228: 0x000c, 0x3229: 0x000c, + 0x322a: 0x000c, 0x322b: 0x000c, 0x322c: 0x000c, + 0x3235: 0x000c, + // Block 0xc9, offset 0x3240 + 0x3244: 0x000c, + 0x325b: 0x000c, 0x325c: 0x000c, 0x325d: 0x000c, + 0x325e: 0x000c, 0x325f: 0x000c, 0x3261: 0x000c, 0x3262: 0x000c, 0x3263: 0x000c, + 0x3264: 0x000c, 0x3265: 0x000c, 0x3266: 0x000c, 0x3267: 0x000c, 0x3268: 0x000c, 0x3269: 0x000c, + 0x326a: 0x000c, 0x326b: 0x000c, 0x326c: 0x000c, 0x326d: 0x000c, 0x326e: 0x000c, 0x326f: 0x000c, + // Block 0xca, offset 0x3280 + 0x3280: 0x000c, 0x3281: 0x000c, 0x3282: 0x000c, 0x3283: 0x000c, 0x3284: 0x000c, 0x3285: 0x000c, + 0x3286: 0x000c, 0x3288: 0x000c, 0x3289: 0x000c, 0x328a: 0x000c, 0x328b: 0x000c, + 0x328c: 0x000c, 0x328d: 0x000c, 0x328e: 0x000c, 0x328f: 0x000c, 0x3290: 0x000c, 0x3291: 0x000c, + 0x3292: 0x000c, 0x3293: 0x000c, 0x3294: 0x000c, 0x3295: 0x000c, 0x3296: 0x000c, 0x3297: 0x000c, + 0x3298: 0x000c, 0x329b: 0x000c, 0x329c: 0x000c, 0x329d: 0x000c, + 0x329e: 0x000c, 0x329f: 0x000c, 0x32a0: 0x000c, 0x32a1: 0x000c, 0x32a3: 0x000c, + 0x32a4: 0x000c, 0x32a6: 0x000c, 0x32a7: 0x000c, 0x32a8: 0x000c, 0x32a9: 0x000c, + 0x32aa: 0x000c, + // Block 0xcb, offset 0x32c0 + 0x32c0: 0x0001, 0x32c1: 0x0001, 0x32c2: 0x0001, 0x32c3: 0x0001, 0x32c4: 0x0001, 0x32c5: 0x0001, + 0x32c6: 0x0001, 0x32c7: 0x0001, 0x32c8: 0x0001, 0x32c9: 0x0001, 0x32ca: 0x0001, 0x32cb: 0x0001, + 0x32cc: 0x0001, 0x32cd: 0x0001, 0x32ce: 0x0001, 0x32cf: 0x0001, 0x32d0: 0x000c, 0x32d1: 0x000c, + 0x32d2: 0x000c, 0x32d3: 0x000c, 0x32d4: 0x000c, 0x32d5: 0x000c, 0x32d6: 0x000c, 0x32d7: 0x0001, + 0x32d8: 0x0001, 0x32d9: 0x0001, 0x32da: 0x0001, 0x32db: 0x0001, 0x32dc: 0x0001, 0x32dd: 0x0001, + 0x32de: 0x0001, 0x32df: 0x0001, 0x32e0: 0x0001, 0x32e1: 0x0001, 0x32e2: 0x0001, 0x32e3: 0x0001, + 0x32e4: 0x0001, 0x32e5: 0x0001, 0x32e6: 0x0001, 0x32e7: 0x0001, 0x32e8: 0x0001, 0x32e9: 0x0001, + 0x32ea: 0x0001, 0x32eb: 0x0001, 0x32ec: 0x0001, 0x32ed: 0x0001, 0x32ee: 0x0001, 0x32ef: 0x0001, + 0x32f0: 0x0001, 0x32f1: 0x0001, 0x32f2: 0x0001, 0x32f3: 0x0001, 0x32f4: 0x0001, 0x32f5: 0x0001, + 0x32f6: 0x0001, 0x32f7: 0x0001, 0x32f8: 0x0001, 0x32f9: 0x0001, 0x32fa: 0x0001, 0x32fb: 0x0001, + 0x32fc: 0x0001, 0x32fd: 0x0001, 0x32fe: 0x0001, 0x32ff: 0x0001, + // Block 0xcc, offset 0x3300 + 0x3300: 0x0001, 0x3301: 0x0001, 0x3302: 0x0001, 0x3303: 0x0001, 0x3304: 0x000c, 0x3305: 0x000c, + 0x3306: 0x000c, 0x3307: 0x000c, 0x3308: 0x000c, 0x3309: 0x000c, 0x330a: 0x000c, 0x330b: 0x0001, + 0x330c: 0x0001, 0x330d: 0x0001, 0x330e: 0x0001, 0x330f: 0x0001, 0x3310: 0x0001, 0x3311: 0x0001, + 0x3312: 0x0001, 0x3313: 0x0001, 0x3314: 0x0001, 0x3315: 0x0001, 0x3316: 0x0001, 0x3317: 0x0001, + 0x3318: 0x0001, 0x3319: 0x0001, 0x331a: 0x0001, 0x331b: 0x0001, 0x331c: 0x0001, 0x331d: 0x0001, + 0x331e: 0x0001, 0x331f: 0x0001, 0x3320: 0x0001, 0x3321: 0x0001, 0x3322: 0x0001, 0x3323: 0x0001, + 0x3324: 0x0001, 0x3325: 0x0001, 0x3326: 0x0001, 0x3327: 0x0001, 0x3328: 0x0001, 0x3329: 0x0001, + 0x332a: 0x0001, 0x332b: 0x0001, 0x332c: 0x0001, 0x332d: 0x0001, 0x332e: 0x0001, 0x332f: 0x0001, + 0x3330: 0x0001, 0x3331: 0x0001, 0x3332: 0x0001, 0x3333: 0x0001, 0x3334: 0x0001, 0x3335: 0x0001, + 0x3336: 0x0001, 0x3337: 0x0001, 0x3338: 0x0001, 0x3339: 0x0001, 0x333a: 0x0001, 0x333b: 0x0001, + 0x333c: 0x0001, 0x333d: 0x0001, 0x333e: 0x0001, 0x333f: 0x0001, + // Block 0xcd, offset 0x3340 + 0x3340: 0x000d, 0x3341: 0x000d, 0x3342: 0x000d, 0x3343: 0x000d, 0x3344: 0x000d, 0x3345: 0x000d, + 0x3346: 0x000d, 0x3347: 0x000d, 0x3348: 0x000d, 0x3349: 0x000d, 0x334a: 0x000d, 0x334b: 0x000d, + 0x334c: 0x000d, 0x334d: 0x000d, 0x334e: 0x000d, 0x334f: 0x000d, 0x3350: 0x000d, 0x3351: 0x000d, + 0x3352: 0x000d, 0x3353: 0x000d, 0x3354: 0x000d, 0x3355: 0x000d, 0x3356: 0x000d, 0x3357: 0x000d, + 0x3358: 0x000d, 0x3359: 0x000d, 0x335a: 0x000d, 0x335b: 0x000d, 0x335c: 0x000d, 0x335d: 0x000d, + 0x335e: 0x000d, 0x335f: 0x000d, 0x3360: 0x000d, 0x3361: 0x000d, 0x3362: 0x000d, 0x3363: 0x000d, + 0x3364: 0x000d, 0x3365: 0x000d, 0x3366: 0x000d, 0x3367: 0x000d, 0x3368: 0x000d, 0x3369: 0x000d, + 0x336a: 0x000d, 0x336b: 0x000d, 0x336c: 0x000d, 0x336d: 0x000d, 0x336e: 0x000d, 0x336f: 0x000d, + 0x3370: 0x000a, 0x3371: 0x000a, 0x3372: 0x000d, 0x3373: 0x000d, 0x3374: 0x000d, 0x3375: 0x000d, + 0x3376: 0x000d, 0x3377: 0x000d, 0x3378: 0x000d, 0x3379: 0x000d, 0x337a: 0x000d, 0x337b: 0x000d, + 0x337c: 0x000d, 0x337d: 0x000d, 0x337e: 0x000d, 0x337f: 0x000d, + // Block 0xce, offset 0x3380 + 0x3380: 0x000a, 0x3381: 0x000a, 0x3382: 0x000a, 0x3383: 0x000a, 0x3384: 0x000a, 0x3385: 0x000a, + 0x3386: 0x000a, 0x3387: 0x000a, 0x3388: 0x000a, 0x3389: 0x000a, 0x338a: 0x000a, 0x338b: 0x000a, + 0x338c: 0x000a, 0x338d: 0x000a, 0x338e: 0x000a, 0x338f: 0x000a, 0x3390: 0x000a, 0x3391: 0x000a, + 0x3392: 0x000a, 0x3393: 0x000a, 0x3394: 0x000a, 0x3395: 0x000a, 0x3396: 0x000a, 0x3397: 0x000a, + 0x3398: 0x000a, 0x3399: 0x000a, 0x339a: 0x000a, 0x339b: 0x000a, 0x339c: 0x000a, 0x339d: 0x000a, + 0x339e: 0x000a, 0x339f: 0x000a, 0x33a0: 0x000a, 0x33a1: 0x000a, 0x33a2: 0x000a, 0x33a3: 0x000a, + 0x33a4: 0x000a, 0x33a5: 0x000a, 0x33a6: 0x000a, 0x33a7: 0x000a, 0x33a8: 0x000a, 0x33a9: 0x000a, + 0x33aa: 0x000a, 0x33ab: 0x000a, + 0x33b0: 0x000a, 0x33b1: 0x000a, 0x33b2: 0x000a, 0x33b3: 0x000a, 0x33b4: 0x000a, 0x33b5: 0x000a, + 0x33b6: 0x000a, 0x33b7: 0x000a, 0x33b8: 0x000a, 0x33b9: 0x000a, 0x33ba: 0x000a, 0x33bb: 0x000a, + 0x33bc: 0x000a, 0x33bd: 0x000a, 0x33be: 0x000a, 0x33bf: 0x000a, + // Block 0xcf, offset 0x33c0 + 0x33c0: 0x000a, 0x33c1: 0x000a, 0x33c2: 0x000a, 0x33c3: 0x000a, 0x33c4: 0x000a, 0x33c5: 0x000a, + 0x33c6: 0x000a, 0x33c7: 0x000a, 0x33c8: 0x000a, 0x33c9: 0x000a, 0x33ca: 0x000a, 0x33cb: 0x000a, + 0x33cc: 0x000a, 0x33cd: 0x000a, 0x33ce: 0x000a, 0x33cf: 0x000a, 0x33d0: 0x000a, 0x33d1: 0x000a, + 0x33d2: 0x000a, 0x33d3: 0x000a, + 0x33e0: 0x000a, 0x33e1: 0x000a, 0x33e2: 0x000a, 0x33e3: 0x000a, + 0x33e4: 0x000a, 0x33e5: 0x000a, 0x33e6: 0x000a, 0x33e7: 0x000a, 0x33e8: 0x000a, 0x33e9: 0x000a, + 0x33ea: 0x000a, 0x33eb: 0x000a, 0x33ec: 0x000a, 0x33ed: 0x000a, 0x33ee: 0x000a, + 0x33f1: 0x000a, 0x33f2: 0x000a, 0x33f3: 0x000a, 0x33f4: 0x000a, 0x33f5: 0x000a, + 0x33f6: 0x000a, 0x33f7: 0x000a, 0x33f8: 0x000a, 0x33f9: 0x000a, 0x33fa: 0x000a, 0x33fb: 0x000a, + 0x33fc: 0x000a, 0x33fd: 0x000a, 0x33fe: 0x000a, 0x33ff: 0x000a, + // Block 0xd0, offset 0x3400 + 0x3401: 0x000a, 0x3402: 0x000a, 0x3403: 0x000a, 0x3404: 0x000a, 0x3405: 0x000a, + 0x3406: 0x000a, 0x3407: 0x000a, 0x3408: 0x000a, 0x3409: 0x000a, 0x340a: 0x000a, 0x340b: 0x000a, + 0x340c: 0x000a, 0x340d: 0x000a, 0x340e: 0x000a, 0x340f: 0x000a, 0x3411: 0x000a, + 0x3412: 0x000a, 0x3413: 0x000a, 0x3414: 0x000a, 0x3415: 0x000a, 0x3416: 0x000a, 0x3417: 0x000a, + 0x3418: 0x000a, 0x3419: 0x000a, 0x341a: 0x000a, 0x341b: 0x000a, 0x341c: 0x000a, 0x341d: 0x000a, + 0x341e: 0x000a, 0x341f: 0x000a, 0x3420: 0x000a, 0x3421: 0x000a, 0x3422: 0x000a, 0x3423: 0x000a, + 0x3424: 0x000a, 0x3425: 0x000a, 0x3426: 0x000a, 0x3427: 0x000a, 0x3428: 0x000a, 0x3429: 0x000a, + 0x342a: 0x000a, 0x342b: 0x000a, 0x342c: 0x000a, 0x342d: 0x000a, 0x342e: 0x000a, 0x342f: 0x000a, + 0x3430: 0x000a, 0x3431: 0x000a, 0x3432: 0x000a, 0x3433: 0x000a, 0x3434: 0x000a, 0x3435: 0x000a, + // Block 0xd1, offset 0x3440 + 0x3440: 0x0002, 0x3441: 0x0002, 0x3442: 0x0002, 0x3443: 0x0002, 0x3444: 0x0002, 0x3445: 0x0002, + 0x3446: 0x0002, 0x3447: 0x0002, 0x3448: 0x0002, 0x3449: 0x0002, 0x344a: 0x0002, 0x344b: 0x000a, + 0x344c: 0x000a, + // Block 0xd2, offset 0x3480 + 0x34aa: 0x000a, 0x34ab: 0x000a, + // Block 0xd3, offset 0x34c0 + 0x34c0: 0x000a, 0x34c1: 0x000a, 0x34c2: 0x000a, 0x34c3: 0x000a, 0x34c4: 0x000a, 0x34c5: 0x000a, + 0x34c6: 0x000a, 0x34c7: 0x000a, 0x34c8: 0x000a, 0x34c9: 0x000a, 0x34ca: 0x000a, 0x34cb: 0x000a, + 0x34cc: 0x000a, 0x34cd: 0x000a, 0x34ce: 0x000a, 0x34cf: 0x000a, 0x34d0: 0x000a, 0x34d1: 0x000a, + 0x34d2: 0x000a, + 0x34e0: 0x000a, 0x34e1: 0x000a, 0x34e2: 0x000a, 0x34e3: 0x000a, + 0x34e4: 0x000a, 0x34e5: 0x000a, 0x34e6: 0x000a, 0x34e7: 0x000a, 0x34e8: 0x000a, 0x34e9: 0x000a, + 0x34ea: 0x000a, 0x34eb: 0x000a, 0x34ec: 0x000a, + 0x34f0: 0x000a, 0x34f1: 0x000a, 0x34f2: 0x000a, 0x34f3: 0x000a, 0x34f4: 0x000a, 0x34f5: 0x000a, + 0x34f6: 0x000a, + // Block 0xd4, offset 0x3500 + 0x3500: 0x000a, 0x3501: 0x000a, 0x3502: 0x000a, 0x3503: 0x000a, 0x3504: 0x000a, 0x3505: 0x000a, + 0x3506: 0x000a, 0x3507: 0x000a, 0x3508: 0x000a, 0x3509: 0x000a, 0x350a: 0x000a, 0x350b: 0x000a, + 0x350c: 0x000a, 0x350d: 0x000a, 0x350e: 0x000a, 0x350f: 0x000a, 0x3510: 0x000a, 0x3511: 0x000a, + 0x3512: 0x000a, 0x3513: 0x000a, 0x3514: 0x000a, + // Block 0xd5, offset 0x3540 + 0x3540: 0x000a, 0x3541: 0x000a, 0x3542: 0x000a, 0x3543: 0x000a, 0x3544: 0x000a, 0x3545: 0x000a, + 0x3546: 0x000a, 0x3547: 0x000a, 0x3548: 0x000a, 0x3549: 0x000a, 0x354a: 0x000a, 0x354b: 0x000a, + 0x3550: 0x000a, 0x3551: 0x000a, + 0x3552: 0x000a, 0x3553: 0x000a, 0x3554: 0x000a, 0x3555: 0x000a, 0x3556: 0x000a, 0x3557: 0x000a, + 0x3558: 0x000a, 0x3559: 0x000a, 0x355a: 0x000a, 0x355b: 0x000a, 0x355c: 0x000a, 0x355d: 0x000a, + 0x355e: 0x000a, 0x355f: 0x000a, 0x3560: 0x000a, 0x3561: 0x000a, 0x3562: 0x000a, 0x3563: 0x000a, + 0x3564: 0x000a, 0x3565: 0x000a, 0x3566: 0x000a, 0x3567: 0x000a, 0x3568: 0x000a, 0x3569: 0x000a, + 0x356a: 0x000a, 0x356b: 0x000a, 0x356c: 0x000a, 0x356d: 0x000a, 0x356e: 0x000a, 0x356f: 0x000a, + 0x3570: 0x000a, 0x3571: 0x000a, 0x3572: 0x000a, 0x3573: 0x000a, 0x3574: 0x000a, 0x3575: 0x000a, + 0x3576: 0x000a, 0x3577: 0x000a, 0x3578: 0x000a, 0x3579: 0x000a, 0x357a: 0x000a, 0x357b: 0x000a, + 0x357c: 0x000a, 0x357d: 0x000a, 0x357e: 0x000a, 0x357f: 0x000a, + // Block 0xd6, offset 0x3580 + 0x3580: 0x000a, 0x3581: 0x000a, 0x3582: 0x000a, 0x3583: 0x000a, 0x3584: 0x000a, 0x3585: 0x000a, + 0x3586: 0x000a, 0x3587: 0x000a, + 0x3590: 0x000a, 0x3591: 0x000a, + 0x3592: 0x000a, 0x3593: 0x000a, 0x3594: 0x000a, 0x3595: 0x000a, 0x3596: 0x000a, 0x3597: 0x000a, + 0x3598: 0x000a, 0x3599: 0x000a, + 0x35a0: 0x000a, 0x35a1: 0x000a, 0x35a2: 0x000a, 0x35a3: 0x000a, + 0x35a4: 0x000a, 0x35a5: 0x000a, 0x35a6: 0x000a, 0x35a7: 0x000a, 0x35a8: 0x000a, 0x35a9: 0x000a, + 0x35aa: 0x000a, 0x35ab: 0x000a, 0x35ac: 0x000a, 0x35ad: 0x000a, 0x35ae: 0x000a, 0x35af: 0x000a, + 0x35b0: 0x000a, 0x35b1: 0x000a, 0x35b2: 0x000a, 0x35b3: 0x000a, 0x35b4: 0x000a, 0x35b5: 0x000a, + 0x35b6: 0x000a, 0x35b7: 0x000a, 0x35b8: 0x000a, 0x35b9: 0x000a, 0x35ba: 0x000a, 0x35bb: 0x000a, + 0x35bc: 0x000a, 0x35bd: 0x000a, 0x35be: 0x000a, 0x35bf: 0x000a, + // Block 0xd7, offset 0x35c0 + 0x35c0: 0x000a, 0x35c1: 0x000a, 0x35c2: 0x000a, 0x35c3: 0x000a, 0x35c4: 0x000a, 0x35c5: 0x000a, + 0x35c6: 0x000a, 0x35c7: 0x000a, + 0x35d0: 0x000a, 0x35d1: 0x000a, + 0x35d2: 0x000a, 0x35d3: 0x000a, 0x35d4: 0x000a, 0x35d5: 0x000a, 0x35d6: 0x000a, 0x35d7: 0x000a, + 0x35d8: 0x000a, 0x35d9: 0x000a, 0x35da: 0x000a, 0x35db: 0x000a, 0x35dc: 0x000a, 0x35dd: 0x000a, + 0x35de: 0x000a, 0x35df: 0x000a, 0x35e0: 0x000a, 0x35e1: 0x000a, 0x35e2: 0x000a, 0x35e3: 0x000a, + 0x35e4: 0x000a, 0x35e5: 0x000a, 0x35e6: 0x000a, 0x35e7: 0x000a, 0x35e8: 0x000a, 0x35e9: 0x000a, + 0x35ea: 0x000a, 0x35eb: 0x000a, 0x35ec: 0x000a, 0x35ed: 0x000a, + // Block 0xd8, offset 0x3600 + 0x3610: 0x000a, 0x3611: 0x000a, + 0x3612: 0x000a, 0x3613: 0x000a, 0x3614: 0x000a, 0x3615: 0x000a, 0x3616: 0x000a, 0x3617: 0x000a, + 0x3618: 0x000a, 0x3619: 0x000a, 0x361a: 0x000a, 0x361b: 0x000a, 0x361c: 0x000a, 0x361d: 0x000a, + 0x361e: 0x000a, 0x3620: 0x000a, 0x3621: 0x000a, 0x3622: 0x000a, 0x3623: 0x000a, + 0x3624: 0x000a, 0x3625: 0x000a, 0x3626: 0x000a, 0x3627: 0x000a, + 0x3630: 0x000a, 0x3633: 0x000a, 0x3634: 0x000a, 0x3635: 0x000a, + 0x3636: 0x000a, 0x3637: 0x000a, 0x3638: 0x000a, 0x3639: 0x000a, 0x363a: 0x000a, 0x363b: 0x000a, + 0x363c: 0x000a, 0x363d: 0x000a, 0x363e: 0x000a, + // Block 0xd9, offset 0x3640 + 0x3640: 0x000a, 0x3641: 0x000a, 0x3642: 0x000a, 0x3643: 0x000a, 0x3644: 0x000a, 0x3645: 0x000a, + 0x3646: 0x000a, 0x3647: 0x000a, 0x3648: 0x000a, 0x3649: 0x000a, 0x364a: 0x000a, 0x364b: 0x000a, + 0x3650: 0x000a, 0x3651: 0x000a, + 0x3652: 0x000a, 0x3653: 0x000a, 0x3654: 0x000a, 0x3655: 0x000a, 0x3656: 0x000a, 0x3657: 0x000a, + 0x3658: 0x000a, 0x3659: 0x000a, 0x365a: 0x000a, 0x365b: 0x000a, 0x365c: 0x000a, 0x365d: 0x000a, + 0x365e: 0x000a, + // Block 0xda, offset 0x3680 + 0x3680: 0x000a, 0x3681: 0x000a, 0x3682: 0x000a, 0x3683: 0x000a, 0x3684: 0x000a, 0x3685: 0x000a, + 0x3686: 0x000a, 0x3687: 0x000a, 0x3688: 0x000a, 0x3689: 0x000a, 0x368a: 0x000a, 0x368b: 0x000a, + 0x368c: 0x000a, 0x368d: 0x000a, 0x368e: 0x000a, 0x368f: 0x000a, 0x3690: 0x000a, 0x3691: 0x000a, + // Block 0xdb, offset 0x36c0 + 0x36fe: 0x000b, 0x36ff: 0x000b, + // Block 0xdc, offset 0x3700 + 0x3700: 0x000b, 0x3701: 0x000b, 0x3702: 0x000b, 0x3703: 0x000b, 0x3704: 0x000b, 0x3705: 0x000b, + 0x3706: 0x000b, 0x3707: 0x000b, 0x3708: 0x000b, 0x3709: 0x000b, 0x370a: 0x000b, 0x370b: 0x000b, + 0x370c: 0x000b, 0x370d: 0x000b, 0x370e: 0x000b, 0x370f: 0x000b, 0x3710: 0x000b, 0x3711: 0x000b, + 0x3712: 0x000b, 0x3713: 0x000b, 0x3714: 0x000b, 0x3715: 0x000b, 0x3716: 0x000b, 0x3717: 0x000b, + 0x3718: 0x000b, 0x3719: 0x000b, 0x371a: 0x000b, 0x371b: 0x000b, 0x371c: 0x000b, 0x371d: 0x000b, + 0x371e: 0x000b, 0x371f: 0x000b, 0x3720: 0x000b, 0x3721: 0x000b, 0x3722: 0x000b, 0x3723: 0x000b, + 0x3724: 0x000b, 0x3725: 0x000b, 0x3726: 0x000b, 0x3727: 0x000b, 0x3728: 0x000b, 0x3729: 0x000b, + 0x372a: 0x000b, 0x372b: 0x000b, 0x372c: 0x000b, 0x372d: 0x000b, 0x372e: 0x000b, 0x372f: 0x000b, + 0x3730: 0x000b, 0x3731: 0x000b, 0x3732: 0x000b, 0x3733: 0x000b, 0x3734: 0x000b, 0x3735: 0x000b, + 0x3736: 0x000b, 0x3737: 0x000b, 0x3738: 0x000b, 0x3739: 0x000b, 0x373a: 0x000b, 0x373b: 0x000b, + 0x373c: 0x000b, 0x373d: 0x000b, 0x373e: 0x000b, 0x373f: 0x000b, + // Block 0xdd, offset 0x3740 + 0x3740: 0x000c, 0x3741: 0x000c, 0x3742: 0x000c, 0x3743: 0x000c, 0x3744: 0x000c, 0x3745: 0x000c, + 0x3746: 0x000c, 0x3747: 0x000c, 0x3748: 0x000c, 0x3749: 0x000c, 0x374a: 0x000c, 0x374b: 0x000c, + 0x374c: 0x000c, 0x374d: 0x000c, 0x374e: 0x000c, 0x374f: 0x000c, 0x3750: 0x000c, 0x3751: 0x000c, + 0x3752: 0x000c, 0x3753: 0x000c, 0x3754: 0x000c, 0x3755: 0x000c, 0x3756: 0x000c, 0x3757: 0x000c, + 0x3758: 0x000c, 0x3759: 0x000c, 0x375a: 0x000c, 0x375b: 0x000c, 0x375c: 0x000c, 0x375d: 0x000c, + 0x375e: 0x000c, 0x375f: 0x000c, 0x3760: 0x000c, 0x3761: 0x000c, 0x3762: 0x000c, 0x3763: 0x000c, + 0x3764: 0x000c, 0x3765: 0x000c, 0x3766: 0x000c, 0x3767: 0x000c, 0x3768: 0x000c, 0x3769: 0x000c, + 0x376a: 0x000c, 0x376b: 0x000c, 0x376c: 0x000c, 0x376d: 0x000c, 0x376e: 0x000c, 0x376f: 0x000c, + 0x3770: 0x000b, 0x3771: 0x000b, 0x3772: 0x000b, 0x3773: 0x000b, 0x3774: 0x000b, 0x3775: 0x000b, + 0x3776: 0x000b, 0x3777: 0x000b, 0x3778: 0x000b, 0x3779: 0x000b, 0x377a: 0x000b, 0x377b: 0x000b, + 0x377c: 0x000b, 0x377d: 0x000b, 0x377e: 0x000b, 0x377f: 0x000b, +} + +// bidiIndex: 24 blocks, 1536 entries, 1536 bytes +// Block 0 is the zero block. +var bidiIndex = [1536]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x01, 0xc3: 0x02, + 0xca: 0x03, 0xcb: 0x04, 0xcc: 0x05, 0xcd: 0x06, 0xce: 0x07, 0xcf: 0x08, + 0xd2: 0x09, 0xd6: 0x0a, 0xd7: 0x0b, + 0xd8: 0x0c, 0xd9: 0x0d, 0xda: 0x0e, 0xdb: 0x0f, 0xdc: 0x10, 0xdd: 0x11, 0xde: 0x12, 0xdf: 0x13, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, + 0xea: 0x07, 0xef: 0x08, + 0xf0: 0x11, 0xf1: 0x12, 0xf2: 0x12, 0xf3: 0x14, 0xf4: 0x15, + // Block 0x4, offset 0x100 + 0x120: 0x14, 0x121: 0x15, 0x122: 0x16, 0x123: 0x17, 0x124: 0x18, 0x125: 0x19, 0x126: 0x1a, 0x127: 0x1b, + 0x128: 0x1c, 0x129: 0x1d, 0x12a: 0x1c, 0x12b: 0x1e, 0x12c: 0x1f, 0x12d: 0x20, 0x12e: 0x21, 0x12f: 0x22, + 0x130: 0x23, 0x131: 0x24, 0x132: 0x1a, 0x133: 0x25, 0x134: 0x26, 0x135: 0x27, 0x137: 0x28, + 0x138: 0x29, 0x139: 0x2a, 0x13a: 0x2b, 0x13b: 0x2c, 0x13c: 0x2d, 0x13d: 0x2e, 0x13e: 0x2f, 0x13f: 0x30, + // Block 0x5, offset 0x140 + 0x140: 0x31, 0x141: 0x32, 0x142: 0x33, + 0x14d: 0x34, 0x14e: 0x35, + 0x150: 0x36, + 0x15a: 0x37, 0x15c: 0x38, 0x15d: 0x39, 0x15e: 0x3a, 0x15f: 0x3b, + 0x160: 0x3c, 0x162: 0x3d, 0x164: 0x3e, 0x165: 0x3f, 0x167: 0x40, + 0x168: 0x41, 0x169: 0x42, 0x16a: 0x43, 0x16c: 0x44, 0x16d: 0x45, 0x16e: 0x46, 0x16f: 0x47, + 0x170: 0x48, 0x173: 0x49, 0x177: 0x4a, + 0x17e: 0x4b, 0x17f: 0x4c, + // Block 0x6, offset 0x180 + 0x180: 0x4d, 0x181: 0x4e, 0x182: 0x4f, 0x183: 0x50, 0x184: 0x51, 0x185: 0x52, 0x186: 0x53, 0x187: 0x54, + 0x188: 0x55, 0x189: 0x54, 0x18a: 0x54, 0x18b: 0x54, 0x18c: 0x56, 0x18d: 0x57, 0x18e: 0x58, 0x18f: 0x59, + 0x190: 0x5a, 0x191: 0x5b, 0x192: 0x5c, 0x193: 0x5d, 0x194: 0x54, 0x195: 0x54, 0x196: 0x54, 0x197: 0x54, + 0x198: 0x54, 0x199: 0x54, 0x19a: 0x5e, 0x19b: 0x54, 0x19c: 0x54, 0x19d: 0x5f, 0x19e: 0x54, 0x19f: 0x60, + 0x1a4: 0x54, 0x1a5: 0x54, 0x1a6: 0x61, 0x1a7: 0x62, + 0x1a8: 0x54, 0x1a9: 0x54, 0x1aa: 0x54, 0x1ab: 0x54, 0x1ac: 0x54, 0x1ad: 0x63, 0x1ae: 0x64, 0x1af: 0x65, + 0x1b3: 0x66, 0x1b5: 0x67, 0x1b7: 0x68, + 0x1b8: 0x69, 0x1b9: 0x6a, 0x1ba: 0x6b, 0x1bb: 0x6c, 0x1bc: 0x54, 0x1bd: 0x54, 0x1be: 0x54, 0x1bf: 0x6d, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x6e, 0x1c2: 0x6f, 0x1c3: 0x70, 0x1c7: 0x71, + 0x1c8: 0x72, 0x1c9: 0x73, 0x1ca: 0x74, 0x1cb: 0x75, 0x1cd: 0x76, 0x1cf: 0x77, + // Block 0x8, offset 0x200 + 0x237: 0x54, + // Block 0x9, offset 0x240 + 0x252: 0x78, 0x253: 0x79, + 0x258: 0x7a, 0x259: 0x7b, 0x25a: 0x7c, 0x25b: 0x7d, 0x25c: 0x7e, 0x25e: 0x7f, + 0x260: 0x80, 0x261: 0x81, 0x263: 0x82, 0x264: 0x83, 0x265: 0x84, 0x266: 0x85, 0x267: 0x86, + 0x268: 0x87, 0x269: 0x88, 0x26a: 0x89, 0x26b: 0x8a, 0x26f: 0x8b, + // Block 0xa, offset 0x280 + 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x0e, 0x2af: 0x0e, + 0x2b0: 0x0e, 0x2b1: 0x0e, 0x2b2: 0x0e, 0x2b3: 0x0e, 0x2b4: 0x8e, 0x2b5: 0x0e, 0x2b6: 0x0e, 0x2b7: 0x8f, + 0x2b8: 0x90, 0x2b9: 0x91, 0x2ba: 0x0e, 0x2bb: 0x92, 0x2bc: 0x93, 0x2bd: 0x94, 0x2bf: 0x95, + // Block 0xb, offset 0x2c0 + 0x2c4: 0x96, 0x2c5: 0x54, 0x2c6: 0x97, 0x2c7: 0x98, + 0x2cb: 0x99, 0x2cd: 0x9a, + 0x2e0: 0x9b, 0x2e1: 0x9b, 0x2e2: 0x9b, 0x2e3: 0x9b, 0x2e4: 0x9c, 0x2e5: 0x9b, 0x2e6: 0x9b, 0x2e7: 0x9b, + 0x2e8: 0x9d, 0x2e9: 0x9b, 0x2ea: 0x9b, 0x2eb: 0x9e, 0x2ec: 0x9f, 0x2ed: 0x9b, 0x2ee: 0x9b, 0x2ef: 0x9b, + 0x2f0: 0x9b, 0x2f1: 0x9b, 0x2f2: 0x9b, 0x2f3: 0x9b, 0x2f4: 0x9b, 0x2f5: 0x9b, 0x2f6: 0x9b, 0x2f7: 0x9b, + 0x2f8: 0x9b, 0x2f9: 0xa0, 0x2fa: 0x9b, 0x2fb: 0x9b, 0x2fc: 0x9b, 0x2fd: 0x9b, 0x2fe: 0x9b, 0x2ff: 0x9b, + // Block 0xc, offset 0x300 + 0x300: 0xa1, 0x301: 0xa2, 0x302: 0xa3, 0x304: 0xa4, 0x305: 0xa5, 0x306: 0xa6, 0x307: 0xa7, + 0x308: 0xa8, 0x30b: 0xa9, 0x30c: 0xaa, 0x30d: 0xab, + 0x310: 0xac, 0x311: 0xad, 0x312: 0xae, 0x313: 0xaf, 0x316: 0xb0, 0x317: 0xb1, + 0x318: 0xb2, 0x319: 0xb3, 0x31a: 0xb4, 0x31c: 0xb5, + 0x330: 0xb6, 0x332: 0xb7, + // Block 0xd, offset 0x340 + 0x36b: 0xb8, 0x36c: 0xb9, + 0x37e: 0xba, + // Block 0xe, offset 0x380 + 0x3b2: 0xbb, + // Block 0xf, offset 0x3c0 + 0x3c5: 0xbc, 0x3c6: 0xbd, + 0x3c8: 0x54, 0x3c9: 0xbe, 0x3cc: 0x54, 0x3cd: 0xbf, + 0x3db: 0xc0, 0x3dc: 0xc1, 0x3dd: 0xc2, 0x3de: 0xc3, 0x3df: 0xc4, + 0x3e8: 0xc5, 0x3e9: 0xc6, 0x3ea: 0xc7, + // Block 0x10, offset 0x400 + 0x400: 0xc8, + 0x420: 0x9b, 0x421: 0x9b, 0x422: 0x9b, 0x423: 0xc9, 0x424: 0x9b, 0x425: 0xca, 0x426: 0x9b, 0x427: 0x9b, + 0x428: 0x9b, 0x429: 0x9b, 0x42a: 0x9b, 0x42b: 0x9b, 0x42c: 0x9b, 0x42d: 0x9b, 0x42e: 0x9b, 0x42f: 0x9b, + 0x430: 0x9b, 0x431: 0x9b, 0x432: 0x9b, 0x433: 0x9b, 0x434: 0x9b, 0x435: 0x9b, 0x436: 0x9b, 0x437: 0x9b, + 0x438: 0x0e, 0x439: 0x0e, 0x43a: 0x0e, 0x43b: 0xcb, 0x43c: 0x9b, 0x43d: 0x9b, 0x43e: 0x9b, 0x43f: 0x9b, + // Block 0x11, offset 0x440 + 0x440: 0xcc, 0x441: 0x54, 0x442: 0xcd, 0x443: 0xce, 0x444: 0xcf, 0x445: 0xd0, + 0x44c: 0x54, 0x44d: 0x54, 0x44e: 0x54, 0x44f: 0x54, + 0x450: 0x54, 0x451: 0x54, 0x452: 0x54, 0x453: 0x54, 0x454: 0x54, 0x455: 0x54, 0x456: 0x54, 0x457: 0x54, + 0x458: 0x54, 0x459: 0x54, 0x45a: 0x54, 0x45b: 0xd1, 0x45c: 0x54, 0x45d: 0x6c, 0x45e: 0x54, 0x45f: 0xd2, + 0x460: 0xd3, 0x461: 0xd4, 0x462: 0xd5, 0x464: 0xd6, 0x465: 0xd7, 0x466: 0xd8, 0x467: 0x36, + 0x47f: 0xd9, + // Block 0x12, offset 0x480 + 0x4bf: 0xd9, + // Block 0x13, offset 0x4c0 + 0x4d0: 0x09, 0x4d1: 0x0a, 0x4d6: 0x0b, + 0x4db: 0x0c, 0x4dd: 0x0d, 0x4de: 0x0e, 0x4df: 0x0f, + 0x4ef: 0x10, + 0x4ff: 0x10, + // Block 0x14, offset 0x500 + 0x50f: 0x10, + 0x51f: 0x10, + 0x52f: 0x10, + 0x53f: 0x10, + // Block 0x15, offset 0x540 + 0x540: 0xda, 0x541: 0xda, 0x542: 0xda, 0x543: 0xda, 0x544: 0x05, 0x545: 0x05, 0x546: 0x05, 0x547: 0xdb, + 0x548: 0xda, 0x549: 0xda, 0x54a: 0xda, 0x54b: 0xda, 0x54c: 0xda, 0x54d: 0xda, 0x54e: 0xda, 0x54f: 0xda, + 0x550: 0xda, 0x551: 0xda, 0x552: 0xda, 0x553: 0xda, 0x554: 0xda, 0x555: 0xda, 0x556: 0xda, 0x557: 0xda, + 0x558: 0xda, 0x559: 0xda, 0x55a: 0xda, 0x55b: 0xda, 0x55c: 0xda, 0x55d: 0xda, 0x55e: 0xda, 0x55f: 0xda, + 0x560: 0xda, 0x561: 0xda, 0x562: 0xda, 0x563: 0xda, 0x564: 0xda, 0x565: 0xda, 0x566: 0xda, 0x567: 0xda, + 0x568: 0xda, 0x569: 0xda, 0x56a: 0xda, 0x56b: 0xda, 0x56c: 0xda, 0x56d: 0xda, 0x56e: 0xda, 0x56f: 0xda, + 0x570: 0xda, 0x571: 0xda, 0x572: 0xda, 0x573: 0xda, 0x574: 0xda, 0x575: 0xda, 0x576: 0xda, 0x577: 0xda, + 0x578: 0xda, 0x579: 0xda, 0x57a: 0xda, 0x57b: 0xda, 0x57c: 0xda, 0x57d: 0xda, 0x57e: 0xda, 0x57f: 0xda, + // Block 0x16, offset 0x580 + 0x58f: 0x10, + 0x59f: 0x10, + 0x5a0: 0x13, + 0x5af: 0x10, + 0x5bf: 0x10, + // Block 0x17, offset 0x5c0 + 0x5cf: 0x10, +} + +// Total table size 15800 bytes (15KiB); checksum: F50EF68C diff --git a/vendor/golang.org/x/text/unicode/bidi/trieval.go b/vendor/golang.org/x/text/unicode/bidi/trieval.go new file mode 100644 index 0000000000..4c459c4b72 --- /dev/null +++ b/vendor/golang.org/x/text/unicode/bidi/trieval.go @@ -0,0 +1,60 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +package bidi + +// Class is the Unicode BiDi class. Each rune has a single class. +type Class uint + +const ( + L Class = iota // LeftToRight + R // RightToLeft + EN // EuropeanNumber + ES // EuropeanSeparator + ET // EuropeanTerminator + AN // ArabicNumber + CS // CommonSeparator + B // ParagraphSeparator + S // SegmentSeparator + WS // WhiteSpace + ON // OtherNeutral + BN // BoundaryNeutral + NSM // NonspacingMark + AL // ArabicLetter + Control // Control LRO - PDI + + numClass + + LRO // LeftToRightOverride + RLO // RightToLeftOverride + LRE // LeftToRightEmbedding + RLE // RightToLeftEmbedding + PDF // PopDirectionalFormat + LRI // LeftToRightIsolate + RLI // RightToLeftIsolate + FSI // FirstStrongIsolate + PDI // PopDirectionalIsolate + + unknownClass = ^Class(0) +) + +var controlToClass = map[rune]Class{ + 0x202D: LRO, // LeftToRightOverride, + 0x202E: RLO, // RightToLeftOverride, + 0x202A: LRE, // LeftToRightEmbedding, + 0x202B: RLE, // RightToLeftEmbedding, + 0x202C: PDF, // PopDirectionalFormat, + 0x2066: LRI, // LeftToRightIsolate, + 0x2067: RLI, // RightToLeftIsolate, + 0x2068: FSI, // FirstStrongIsolate, + 0x2069: PDI, // PopDirectionalIsolate, +} + +// A trie entry has the following bits: +// 7..5 XOR mask for brackets +// 4 1: Bracket open, 0: Bracket close +// 3..0 Class type + +const ( + openMask = 0x10 + xorMaskShift = 5 +) diff --git a/vendor/golang.org/x/text/unicode/norm/composition.go b/vendor/golang.org/x/text/unicode/norm/composition.go index bab4c5de02..e2087bce52 100644 --- a/vendor/golang.org/x/text/unicode/norm/composition.go +++ b/vendor/golang.org/x/text/unicode/norm/composition.go @@ -407,7 +407,7 @@ func decomposeHangul(buf []byte, r rune) int { // decomposeHangul algorithmically decomposes a Hangul rune into // its Jamo components. -// See http://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul. +// See https://unicode.org/reports/tr15/#Hangul for details on decomposing Hangul. func (rb *reorderBuffer) decomposeHangul(r rune) { r -= hangulBase x := r % jamoTCount @@ -420,7 +420,7 @@ func (rb *reorderBuffer) decomposeHangul(r rune) { } // combineHangul algorithmically combines Jamo character components into Hangul. -// See http://unicode.org/reports/tr15/#Hangul for details on combining Hangul. +// See https://unicode.org/reports/tr15/#Hangul for details on combining Hangul. func (rb *reorderBuffer) combineHangul(s, i, k int) { b := rb.rune[:] bn := rb.nrune @@ -461,6 +461,10 @@ func (rb *reorderBuffer) combineHangul(s, i, k int) { // It should only be used to recompose a single segment, as it will not // handle alternations between Hangul and non-Hangul characters correctly. func (rb *reorderBuffer) compose() { + // Lazily load the map used by the combine func below, but do + // it outside of the loop. + recompMapOnce.Do(buildRecompMap) + // UAX #15, section X5 , including Corrigendum #5 // "In any character sequence beginning with starter S, a character C is // blocked from S if and only if there is some character B between S diff --git a/vendor/golang.org/x/text/unicode/norm/forminfo.go b/vendor/golang.org/x/text/unicode/norm/forminfo.go index e67e7655c5..526c7033ac 100644 --- a/vendor/golang.org/x/text/unicode/norm/forminfo.go +++ b/vendor/golang.org/x/text/unicode/norm/forminfo.go @@ -4,6 +4,8 @@ package norm +import "encoding/binary" + // This file contains Form-specific logic and wrappers for data in tables.go. // Rune info is stored in a separate trie per composing form. A composing form @@ -178,6 +180,17 @@ func (p Properties) TrailCCC() uint8 { return ccc[p.tccc] } +func buildRecompMap() { + recompMap = make(map[uint32]rune, len(recompMapPacked)/8) + var buf [8]byte + for i := 0; i < len(recompMapPacked); i += 8 { + copy(buf[:], recompMapPacked[i:i+8]) + key := binary.BigEndian.Uint32(buf[:4]) + val := binary.BigEndian.Uint32(buf[4:]) + recompMap[key] = rune(val) + } +} + // Recomposition // We use 32-bit keys instead of 64-bit for the two codepoint keys. // This clips off the bits of three entries, but we know this will not @@ -186,8 +199,14 @@ func (p Properties) TrailCCC() uint8 { // Note that the recomposition map for NFC and NFKC are identical. // combine returns the combined rune or 0 if it doesn't exist. +// +// The caller is responsible for calling +// recompMapOnce.Do(buildRecompMap) sometime before this is called. func combine(a, b rune) rune { key := uint32(uint16(a))<<16 + uint32(uint16(b)) + if recompMap == nil { + panic("caller error") // see func comment + } return recompMap[key] } diff --git a/vendor/golang.org/x/text/unicode/norm/iter.go b/vendor/golang.org/x/text/unicode/norm/iter.go index ce17f96c2e..417c6b2689 100644 --- a/vendor/golang.org/x/text/unicode/norm/iter.go +++ b/vendor/golang.org/x/text/unicode/norm/iter.go @@ -128,8 +128,9 @@ func (i *Iter) Next() []byte { func nextASCIIBytes(i *Iter) []byte { p := i.p + 1 if p >= i.rb.nsrc { + p0 := i.p i.setDone() - return i.rb.src.bytes[i.p:p] + return i.rb.src.bytes[p0:p] } if i.rb.src.bytes[p] < utf8.RuneSelf { p0 := i.p diff --git a/vendor/golang.org/x/text/unicode/norm/maketables.go b/vendor/golang.org/x/text/unicode/norm/maketables.go index 338c395ee6..30a3aa9334 100644 --- a/vendor/golang.org/x/text/unicode/norm/maketables.go +++ b/vendor/golang.org/x/text/unicode/norm/maketables.go @@ -12,6 +12,7 @@ package main import ( "bytes" + "encoding/binary" "flag" "fmt" "io" @@ -261,7 +262,7 @@ func compactCCC() { // CompositionExclusions.txt has form: // 0958 # ... -// See http://unicode.org/reports/tr44/ for full explanation +// See https://unicode.org/reports/tr44/ for full explanation func loadCompositionExclusions() { f := gen.OpenUCDFile("CompositionExclusions.txt") defer f.Close() @@ -735,6 +736,8 @@ func makeTables() { max = n } } + fmt.Fprintln(w, `import "sync"`) + fmt.Fprintln(w) fmt.Fprintln(w, "const (") fmt.Fprintln(w, "\t// Version is the Unicode edition from which the tables are derived.") @@ -782,16 +785,23 @@ func makeTables() { sz := nrentries * 8 size += sz fmt.Fprintf(w, "// recompMap: %d bytes (entries only)\n", sz) - fmt.Fprintln(w, "var recompMap = map[uint32]rune{") + fmt.Fprintln(w, "var recompMap map[uint32]rune") + fmt.Fprintln(w, "var recompMapOnce sync.Once\n") + fmt.Fprintln(w, `const recompMapPacked = "" +`) + var buf [8]byte for i, c := range chars { f := c.forms[FCanonical] d := f.decomp if !f.isOneWay && len(d) > 0 { key := uint32(uint16(d[0]))<<16 + uint32(uint16(d[1])) - fmt.Fprintf(w, "0x%.8X: 0x%.4X,\n", key, i) + binary.BigEndian.PutUint32(buf[:4], key) + binary.BigEndian.PutUint32(buf[4:], uint32(i)) + fmt.Fprintf(w, "\t\t%q + // 0x%.8X: 0x%.8X\n", string(buf[:]), key, uint32(i)) } } - fmt.Fprintf(w, "}\n\n") + // hack so we don't have to special case the trailing plus sign + fmt.Fprintf(w, ` ""`) + fmt.Fprintln(w) } fmt.Fprintf(w, "// Total size of tables: %dKB (%d bytes)\n", (size+512)/1024, size) @@ -857,7 +867,7 @@ func verifyComputed() { // DerivedNormalizationProps.txt has form: // 00C0..00C5 ; NFD_QC; N # ... // 0374 ; NFD_QC; N # ... -// See http://unicode.org/reports/tr44/ for full explanation +// See https://unicode.org/reports/tr44/ for full explanation func testDerived() { f := gen.OpenUCDFile("DerivedNormalizationProps.txt") defer f.Close() diff --git a/vendor/golang.org/x/text/unicode/norm/normalize.go b/vendor/golang.org/x/text/unicode/norm/normalize.go index e28ac641ac..95efcf26e8 100644 --- a/vendor/golang.org/x/text/unicode/norm/normalize.go +++ b/vendor/golang.org/x/text/unicode/norm/normalize.go @@ -29,8 +29,8 @@ import ( // proceed independently on both sides: // f(x) == append(f(x[0:n]), f(x[n:])...) // -// References: http://unicode.org/reports/tr15/ and -// http://unicode.org/notes/tn5/. +// References: https://unicode.org/reports/tr15/ and +// https://unicode.org/notes/tn5/. type Form int const ( diff --git a/vendor/golang.org/x/text/unicode/norm/readwriter.go b/vendor/golang.org/x/text/unicode/norm/readwriter.go index d926ee903e..b38096f5ca 100644 --- a/vendor/golang.org/x/text/unicode/norm/readwriter.go +++ b/vendor/golang.org/x/text/unicode/norm/readwriter.go @@ -60,8 +60,8 @@ func (w *normWriter) Close() error { } // Writer returns a new writer that implements Write(b) -// by writing f(b) to w. The returned writer may use an -// an internal buffer to maintain state across Write calls. +// by writing f(b) to w. The returned writer may use an +// internal buffer to maintain state across Write calls. // Calling its Close method writes any buffered data to w. func (f Form) Writer(w io.Writer) io.WriteCloser { wr := &normWriter{rb: reorderBuffer{}, w: w} diff --git a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go index 44dd3978ca..26fbd55a12 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables10.0.0.go @@ -1,9 +1,11 @@ // Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. -// +build go1.10 +// +build go1.10,!go1.13 package norm +import "sync" + const ( // Version is the Unicode edition from which the tables are derived. Version = "10.0.0" @@ -6707,947 +6709,949 @@ var nfkcSparseValues = [869]valueRange{ } // recompMap: 7520 bytes (entries only) -var recompMap = map[uint32]rune{ - 0x00410300: 0x00C0, - 0x00410301: 0x00C1, - 0x00410302: 0x00C2, - 0x00410303: 0x00C3, - 0x00410308: 0x00C4, - 0x0041030A: 0x00C5, - 0x00430327: 0x00C7, - 0x00450300: 0x00C8, - 0x00450301: 0x00C9, - 0x00450302: 0x00CA, - 0x00450308: 0x00CB, - 0x00490300: 0x00CC, - 0x00490301: 0x00CD, - 0x00490302: 0x00CE, - 0x00490308: 0x00CF, - 0x004E0303: 0x00D1, - 0x004F0300: 0x00D2, - 0x004F0301: 0x00D3, - 0x004F0302: 0x00D4, - 0x004F0303: 0x00D5, - 0x004F0308: 0x00D6, - 0x00550300: 0x00D9, - 0x00550301: 0x00DA, - 0x00550302: 0x00DB, - 0x00550308: 0x00DC, - 0x00590301: 0x00DD, - 0x00610300: 0x00E0, - 0x00610301: 0x00E1, - 0x00610302: 0x00E2, - 0x00610303: 0x00E3, - 0x00610308: 0x00E4, - 0x0061030A: 0x00E5, - 0x00630327: 0x00E7, - 0x00650300: 0x00E8, - 0x00650301: 0x00E9, - 0x00650302: 0x00EA, - 0x00650308: 0x00EB, - 0x00690300: 0x00EC, - 0x00690301: 0x00ED, - 0x00690302: 0x00EE, - 0x00690308: 0x00EF, - 0x006E0303: 0x00F1, - 0x006F0300: 0x00F2, - 0x006F0301: 0x00F3, - 0x006F0302: 0x00F4, - 0x006F0303: 0x00F5, - 0x006F0308: 0x00F6, - 0x00750300: 0x00F9, - 0x00750301: 0x00FA, - 0x00750302: 0x00FB, - 0x00750308: 0x00FC, - 0x00790301: 0x00FD, - 0x00790308: 0x00FF, - 0x00410304: 0x0100, - 0x00610304: 0x0101, - 0x00410306: 0x0102, - 0x00610306: 0x0103, - 0x00410328: 0x0104, - 0x00610328: 0x0105, - 0x00430301: 0x0106, - 0x00630301: 0x0107, - 0x00430302: 0x0108, - 0x00630302: 0x0109, - 0x00430307: 0x010A, - 0x00630307: 0x010B, - 0x0043030C: 0x010C, - 0x0063030C: 0x010D, - 0x0044030C: 0x010E, - 0x0064030C: 0x010F, - 0x00450304: 0x0112, - 0x00650304: 0x0113, - 0x00450306: 0x0114, - 0x00650306: 0x0115, - 0x00450307: 0x0116, - 0x00650307: 0x0117, - 0x00450328: 0x0118, - 0x00650328: 0x0119, - 0x0045030C: 0x011A, - 0x0065030C: 0x011B, - 0x00470302: 0x011C, - 0x00670302: 0x011D, - 0x00470306: 0x011E, - 0x00670306: 0x011F, - 0x00470307: 0x0120, - 0x00670307: 0x0121, - 0x00470327: 0x0122, - 0x00670327: 0x0123, - 0x00480302: 0x0124, - 0x00680302: 0x0125, - 0x00490303: 0x0128, - 0x00690303: 0x0129, - 0x00490304: 0x012A, - 0x00690304: 0x012B, - 0x00490306: 0x012C, - 0x00690306: 0x012D, - 0x00490328: 0x012E, - 0x00690328: 0x012F, - 0x00490307: 0x0130, - 0x004A0302: 0x0134, - 0x006A0302: 0x0135, - 0x004B0327: 0x0136, - 0x006B0327: 0x0137, - 0x004C0301: 0x0139, - 0x006C0301: 0x013A, - 0x004C0327: 0x013B, - 0x006C0327: 0x013C, - 0x004C030C: 0x013D, - 0x006C030C: 0x013E, - 0x004E0301: 0x0143, - 0x006E0301: 0x0144, - 0x004E0327: 0x0145, - 0x006E0327: 0x0146, - 0x004E030C: 0x0147, - 0x006E030C: 0x0148, - 0x004F0304: 0x014C, - 0x006F0304: 0x014D, - 0x004F0306: 0x014E, - 0x006F0306: 0x014F, - 0x004F030B: 0x0150, - 0x006F030B: 0x0151, - 0x00520301: 0x0154, - 0x00720301: 0x0155, - 0x00520327: 0x0156, - 0x00720327: 0x0157, - 0x0052030C: 0x0158, - 0x0072030C: 0x0159, - 0x00530301: 0x015A, - 0x00730301: 0x015B, - 0x00530302: 0x015C, - 0x00730302: 0x015D, - 0x00530327: 0x015E, - 0x00730327: 0x015F, - 0x0053030C: 0x0160, - 0x0073030C: 0x0161, - 0x00540327: 0x0162, - 0x00740327: 0x0163, - 0x0054030C: 0x0164, - 0x0074030C: 0x0165, - 0x00550303: 0x0168, - 0x00750303: 0x0169, - 0x00550304: 0x016A, - 0x00750304: 0x016B, - 0x00550306: 0x016C, - 0x00750306: 0x016D, - 0x0055030A: 0x016E, - 0x0075030A: 0x016F, - 0x0055030B: 0x0170, - 0x0075030B: 0x0171, - 0x00550328: 0x0172, - 0x00750328: 0x0173, - 0x00570302: 0x0174, - 0x00770302: 0x0175, - 0x00590302: 0x0176, - 0x00790302: 0x0177, - 0x00590308: 0x0178, - 0x005A0301: 0x0179, - 0x007A0301: 0x017A, - 0x005A0307: 0x017B, - 0x007A0307: 0x017C, - 0x005A030C: 0x017D, - 0x007A030C: 0x017E, - 0x004F031B: 0x01A0, - 0x006F031B: 0x01A1, - 0x0055031B: 0x01AF, - 0x0075031B: 0x01B0, - 0x0041030C: 0x01CD, - 0x0061030C: 0x01CE, - 0x0049030C: 0x01CF, - 0x0069030C: 0x01D0, - 0x004F030C: 0x01D1, - 0x006F030C: 0x01D2, - 0x0055030C: 0x01D3, - 0x0075030C: 0x01D4, - 0x00DC0304: 0x01D5, - 0x00FC0304: 0x01D6, - 0x00DC0301: 0x01D7, - 0x00FC0301: 0x01D8, - 0x00DC030C: 0x01D9, - 0x00FC030C: 0x01DA, - 0x00DC0300: 0x01DB, - 0x00FC0300: 0x01DC, - 0x00C40304: 0x01DE, - 0x00E40304: 0x01DF, - 0x02260304: 0x01E0, - 0x02270304: 0x01E1, - 0x00C60304: 0x01E2, - 0x00E60304: 0x01E3, - 0x0047030C: 0x01E6, - 0x0067030C: 0x01E7, - 0x004B030C: 0x01E8, - 0x006B030C: 0x01E9, - 0x004F0328: 0x01EA, - 0x006F0328: 0x01EB, - 0x01EA0304: 0x01EC, - 0x01EB0304: 0x01ED, - 0x01B7030C: 0x01EE, - 0x0292030C: 0x01EF, - 0x006A030C: 0x01F0, - 0x00470301: 0x01F4, - 0x00670301: 0x01F5, - 0x004E0300: 0x01F8, - 0x006E0300: 0x01F9, - 0x00C50301: 0x01FA, - 0x00E50301: 0x01FB, - 0x00C60301: 0x01FC, - 0x00E60301: 0x01FD, - 0x00D80301: 0x01FE, - 0x00F80301: 0x01FF, - 0x0041030F: 0x0200, - 0x0061030F: 0x0201, - 0x00410311: 0x0202, - 0x00610311: 0x0203, - 0x0045030F: 0x0204, - 0x0065030F: 0x0205, - 0x00450311: 0x0206, - 0x00650311: 0x0207, - 0x0049030F: 0x0208, - 0x0069030F: 0x0209, - 0x00490311: 0x020A, - 0x00690311: 0x020B, - 0x004F030F: 0x020C, - 0x006F030F: 0x020D, - 0x004F0311: 0x020E, - 0x006F0311: 0x020F, - 0x0052030F: 0x0210, - 0x0072030F: 0x0211, - 0x00520311: 0x0212, - 0x00720311: 0x0213, - 0x0055030F: 0x0214, - 0x0075030F: 0x0215, - 0x00550311: 0x0216, - 0x00750311: 0x0217, - 0x00530326: 0x0218, - 0x00730326: 0x0219, - 0x00540326: 0x021A, - 0x00740326: 0x021B, - 0x0048030C: 0x021E, - 0x0068030C: 0x021F, - 0x00410307: 0x0226, - 0x00610307: 0x0227, - 0x00450327: 0x0228, - 0x00650327: 0x0229, - 0x00D60304: 0x022A, - 0x00F60304: 0x022B, - 0x00D50304: 0x022C, - 0x00F50304: 0x022D, - 0x004F0307: 0x022E, - 0x006F0307: 0x022F, - 0x022E0304: 0x0230, - 0x022F0304: 0x0231, - 0x00590304: 0x0232, - 0x00790304: 0x0233, - 0x00A80301: 0x0385, - 0x03910301: 0x0386, - 0x03950301: 0x0388, - 0x03970301: 0x0389, - 0x03990301: 0x038A, - 0x039F0301: 0x038C, - 0x03A50301: 0x038E, - 0x03A90301: 0x038F, - 0x03CA0301: 0x0390, - 0x03990308: 0x03AA, - 0x03A50308: 0x03AB, - 0x03B10301: 0x03AC, - 0x03B50301: 0x03AD, - 0x03B70301: 0x03AE, - 0x03B90301: 0x03AF, - 0x03CB0301: 0x03B0, - 0x03B90308: 0x03CA, - 0x03C50308: 0x03CB, - 0x03BF0301: 0x03CC, - 0x03C50301: 0x03CD, - 0x03C90301: 0x03CE, - 0x03D20301: 0x03D3, - 0x03D20308: 0x03D4, - 0x04150300: 0x0400, - 0x04150308: 0x0401, - 0x04130301: 0x0403, - 0x04060308: 0x0407, - 0x041A0301: 0x040C, - 0x04180300: 0x040D, - 0x04230306: 0x040E, - 0x04180306: 0x0419, - 0x04380306: 0x0439, - 0x04350300: 0x0450, - 0x04350308: 0x0451, - 0x04330301: 0x0453, - 0x04560308: 0x0457, - 0x043A0301: 0x045C, - 0x04380300: 0x045D, - 0x04430306: 0x045E, - 0x0474030F: 0x0476, - 0x0475030F: 0x0477, - 0x04160306: 0x04C1, - 0x04360306: 0x04C2, - 0x04100306: 0x04D0, - 0x04300306: 0x04D1, - 0x04100308: 0x04D2, - 0x04300308: 0x04D3, - 0x04150306: 0x04D6, - 0x04350306: 0x04D7, - 0x04D80308: 0x04DA, - 0x04D90308: 0x04DB, - 0x04160308: 0x04DC, - 0x04360308: 0x04DD, - 0x04170308: 0x04DE, - 0x04370308: 0x04DF, - 0x04180304: 0x04E2, - 0x04380304: 0x04E3, - 0x04180308: 0x04E4, - 0x04380308: 0x04E5, - 0x041E0308: 0x04E6, - 0x043E0308: 0x04E7, - 0x04E80308: 0x04EA, - 0x04E90308: 0x04EB, - 0x042D0308: 0x04EC, - 0x044D0308: 0x04ED, - 0x04230304: 0x04EE, - 0x04430304: 0x04EF, - 0x04230308: 0x04F0, - 0x04430308: 0x04F1, - 0x0423030B: 0x04F2, - 0x0443030B: 0x04F3, - 0x04270308: 0x04F4, - 0x04470308: 0x04F5, - 0x042B0308: 0x04F8, - 0x044B0308: 0x04F9, - 0x06270653: 0x0622, - 0x06270654: 0x0623, - 0x06480654: 0x0624, - 0x06270655: 0x0625, - 0x064A0654: 0x0626, - 0x06D50654: 0x06C0, - 0x06C10654: 0x06C2, - 0x06D20654: 0x06D3, - 0x0928093C: 0x0929, - 0x0930093C: 0x0931, - 0x0933093C: 0x0934, - 0x09C709BE: 0x09CB, - 0x09C709D7: 0x09CC, - 0x0B470B56: 0x0B48, - 0x0B470B3E: 0x0B4B, - 0x0B470B57: 0x0B4C, - 0x0B920BD7: 0x0B94, - 0x0BC60BBE: 0x0BCA, - 0x0BC70BBE: 0x0BCB, - 0x0BC60BD7: 0x0BCC, - 0x0C460C56: 0x0C48, - 0x0CBF0CD5: 0x0CC0, - 0x0CC60CD5: 0x0CC7, - 0x0CC60CD6: 0x0CC8, - 0x0CC60CC2: 0x0CCA, - 0x0CCA0CD5: 0x0CCB, - 0x0D460D3E: 0x0D4A, - 0x0D470D3E: 0x0D4B, - 0x0D460D57: 0x0D4C, - 0x0DD90DCA: 0x0DDA, - 0x0DD90DCF: 0x0DDC, - 0x0DDC0DCA: 0x0DDD, - 0x0DD90DDF: 0x0DDE, - 0x1025102E: 0x1026, - 0x1B051B35: 0x1B06, - 0x1B071B35: 0x1B08, - 0x1B091B35: 0x1B0A, - 0x1B0B1B35: 0x1B0C, - 0x1B0D1B35: 0x1B0E, - 0x1B111B35: 0x1B12, - 0x1B3A1B35: 0x1B3B, - 0x1B3C1B35: 0x1B3D, - 0x1B3E1B35: 0x1B40, - 0x1B3F1B35: 0x1B41, - 0x1B421B35: 0x1B43, - 0x00410325: 0x1E00, - 0x00610325: 0x1E01, - 0x00420307: 0x1E02, - 0x00620307: 0x1E03, - 0x00420323: 0x1E04, - 0x00620323: 0x1E05, - 0x00420331: 0x1E06, - 0x00620331: 0x1E07, - 0x00C70301: 0x1E08, - 0x00E70301: 0x1E09, - 0x00440307: 0x1E0A, - 0x00640307: 0x1E0B, - 0x00440323: 0x1E0C, - 0x00640323: 0x1E0D, - 0x00440331: 0x1E0E, - 0x00640331: 0x1E0F, - 0x00440327: 0x1E10, - 0x00640327: 0x1E11, - 0x0044032D: 0x1E12, - 0x0064032D: 0x1E13, - 0x01120300: 0x1E14, - 0x01130300: 0x1E15, - 0x01120301: 0x1E16, - 0x01130301: 0x1E17, - 0x0045032D: 0x1E18, - 0x0065032D: 0x1E19, - 0x00450330: 0x1E1A, - 0x00650330: 0x1E1B, - 0x02280306: 0x1E1C, - 0x02290306: 0x1E1D, - 0x00460307: 0x1E1E, - 0x00660307: 0x1E1F, - 0x00470304: 0x1E20, - 0x00670304: 0x1E21, - 0x00480307: 0x1E22, - 0x00680307: 0x1E23, - 0x00480323: 0x1E24, - 0x00680323: 0x1E25, - 0x00480308: 0x1E26, - 0x00680308: 0x1E27, - 0x00480327: 0x1E28, - 0x00680327: 0x1E29, - 0x0048032E: 0x1E2A, - 0x0068032E: 0x1E2B, - 0x00490330: 0x1E2C, - 0x00690330: 0x1E2D, - 0x00CF0301: 0x1E2E, - 0x00EF0301: 0x1E2F, - 0x004B0301: 0x1E30, - 0x006B0301: 0x1E31, - 0x004B0323: 0x1E32, - 0x006B0323: 0x1E33, - 0x004B0331: 0x1E34, - 0x006B0331: 0x1E35, - 0x004C0323: 0x1E36, - 0x006C0323: 0x1E37, - 0x1E360304: 0x1E38, - 0x1E370304: 0x1E39, - 0x004C0331: 0x1E3A, - 0x006C0331: 0x1E3B, - 0x004C032D: 0x1E3C, - 0x006C032D: 0x1E3D, - 0x004D0301: 0x1E3E, - 0x006D0301: 0x1E3F, - 0x004D0307: 0x1E40, - 0x006D0307: 0x1E41, - 0x004D0323: 0x1E42, - 0x006D0323: 0x1E43, - 0x004E0307: 0x1E44, - 0x006E0307: 0x1E45, - 0x004E0323: 0x1E46, - 0x006E0323: 0x1E47, - 0x004E0331: 0x1E48, - 0x006E0331: 0x1E49, - 0x004E032D: 0x1E4A, - 0x006E032D: 0x1E4B, - 0x00D50301: 0x1E4C, - 0x00F50301: 0x1E4D, - 0x00D50308: 0x1E4E, - 0x00F50308: 0x1E4F, - 0x014C0300: 0x1E50, - 0x014D0300: 0x1E51, - 0x014C0301: 0x1E52, - 0x014D0301: 0x1E53, - 0x00500301: 0x1E54, - 0x00700301: 0x1E55, - 0x00500307: 0x1E56, - 0x00700307: 0x1E57, - 0x00520307: 0x1E58, - 0x00720307: 0x1E59, - 0x00520323: 0x1E5A, - 0x00720323: 0x1E5B, - 0x1E5A0304: 0x1E5C, - 0x1E5B0304: 0x1E5D, - 0x00520331: 0x1E5E, - 0x00720331: 0x1E5F, - 0x00530307: 0x1E60, - 0x00730307: 0x1E61, - 0x00530323: 0x1E62, - 0x00730323: 0x1E63, - 0x015A0307: 0x1E64, - 0x015B0307: 0x1E65, - 0x01600307: 0x1E66, - 0x01610307: 0x1E67, - 0x1E620307: 0x1E68, - 0x1E630307: 0x1E69, - 0x00540307: 0x1E6A, - 0x00740307: 0x1E6B, - 0x00540323: 0x1E6C, - 0x00740323: 0x1E6D, - 0x00540331: 0x1E6E, - 0x00740331: 0x1E6F, - 0x0054032D: 0x1E70, - 0x0074032D: 0x1E71, - 0x00550324: 0x1E72, - 0x00750324: 0x1E73, - 0x00550330: 0x1E74, - 0x00750330: 0x1E75, - 0x0055032D: 0x1E76, - 0x0075032D: 0x1E77, - 0x01680301: 0x1E78, - 0x01690301: 0x1E79, - 0x016A0308: 0x1E7A, - 0x016B0308: 0x1E7B, - 0x00560303: 0x1E7C, - 0x00760303: 0x1E7D, - 0x00560323: 0x1E7E, - 0x00760323: 0x1E7F, - 0x00570300: 0x1E80, - 0x00770300: 0x1E81, - 0x00570301: 0x1E82, - 0x00770301: 0x1E83, - 0x00570308: 0x1E84, - 0x00770308: 0x1E85, - 0x00570307: 0x1E86, - 0x00770307: 0x1E87, - 0x00570323: 0x1E88, - 0x00770323: 0x1E89, - 0x00580307: 0x1E8A, - 0x00780307: 0x1E8B, - 0x00580308: 0x1E8C, - 0x00780308: 0x1E8D, - 0x00590307: 0x1E8E, - 0x00790307: 0x1E8F, - 0x005A0302: 0x1E90, - 0x007A0302: 0x1E91, - 0x005A0323: 0x1E92, - 0x007A0323: 0x1E93, - 0x005A0331: 0x1E94, - 0x007A0331: 0x1E95, - 0x00680331: 0x1E96, - 0x00740308: 0x1E97, - 0x0077030A: 0x1E98, - 0x0079030A: 0x1E99, - 0x017F0307: 0x1E9B, - 0x00410323: 0x1EA0, - 0x00610323: 0x1EA1, - 0x00410309: 0x1EA2, - 0x00610309: 0x1EA3, - 0x00C20301: 0x1EA4, - 0x00E20301: 0x1EA5, - 0x00C20300: 0x1EA6, - 0x00E20300: 0x1EA7, - 0x00C20309: 0x1EA8, - 0x00E20309: 0x1EA9, - 0x00C20303: 0x1EAA, - 0x00E20303: 0x1EAB, - 0x1EA00302: 0x1EAC, - 0x1EA10302: 0x1EAD, - 0x01020301: 0x1EAE, - 0x01030301: 0x1EAF, - 0x01020300: 0x1EB0, - 0x01030300: 0x1EB1, - 0x01020309: 0x1EB2, - 0x01030309: 0x1EB3, - 0x01020303: 0x1EB4, - 0x01030303: 0x1EB5, - 0x1EA00306: 0x1EB6, - 0x1EA10306: 0x1EB7, - 0x00450323: 0x1EB8, - 0x00650323: 0x1EB9, - 0x00450309: 0x1EBA, - 0x00650309: 0x1EBB, - 0x00450303: 0x1EBC, - 0x00650303: 0x1EBD, - 0x00CA0301: 0x1EBE, - 0x00EA0301: 0x1EBF, - 0x00CA0300: 0x1EC0, - 0x00EA0300: 0x1EC1, - 0x00CA0309: 0x1EC2, - 0x00EA0309: 0x1EC3, - 0x00CA0303: 0x1EC4, - 0x00EA0303: 0x1EC5, - 0x1EB80302: 0x1EC6, - 0x1EB90302: 0x1EC7, - 0x00490309: 0x1EC8, - 0x00690309: 0x1EC9, - 0x00490323: 0x1ECA, - 0x00690323: 0x1ECB, - 0x004F0323: 0x1ECC, - 0x006F0323: 0x1ECD, - 0x004F0309: 0x1ECE, - 0x006F0309: 0x1ECF, - 0x00D40301: 0x1ED0, - 0x00F40301: 0x1ED1, - 0x00D40300: 0x1ED2, - 0x00F40300: 0x1ED3, - 0x00D40309: 0x1ED4, - 0x00F40309: 0x1ED5, - 0x00D40303: 0x1ED6, - 0x00F40303: 0x1ED7, - 0x1ECC0302: 0x1ED8, - 0x1ECD0302: 0x1ED9, - 0x01A00301: 0x1EDA, - 0x01A10301: 0x1EDB, - 0x01A00300: 0x1EDC, - 0x01A10300: 0x1EDD, - 0x01A00309: 0x1EDE, - 0x01A10309: 0x1EDF, - 0x01A00303: 0x1EE0, - 0x01A10303: 0x1EE1, - 0x01A00323: 0x1EE2, - 0x01A10323: 0x1EE3, - 0x00550323: 0x1EE4, - 0x00750323: 0x1EE5, - 0x00550309: 0x1EE6, - 0x00750309: 0x1EE7, - 0x01AF0301: 0x1EE8, - 0x01B00301: 0x1EE9, - 0x01AF0300: 0x1EEA, - 0x01B00300: 0x1EEB, - 0x01AF0309: 0x1EEC, - 0x01B00309: 0x1EED, - 0x01AF0303: 0x1EEE, - 0x01B00303: 0x1EEF, - 0x01AF0323: 0x1EF0, - 0x01B00323: 0x1EF1, - 0x00590300: 0x1EF2, - 0x00790300: 0x1EF3, - 0x00590323: 0x1EF4, - 0x00790323: 0x1EF5, - 0x00590309: 0x1EF6, - 0x00790309: 0x1EF7, - 0x00590303: 0x1EF8, - 0x00790303: 0x1EF9, - 0x03B10313: 0x1F00, - 0x03B10314: 0x1F01, - 0x1F000300: 0x1F02, - 0x1F010300: 0x1F03, - 0x1F000301: 0x1F04, - 0x1F010301: 0x1F05, - 0x1F000342: 0x1F06, - 0x1F010342: 0x1F07, - 0x03910313: 0x1F08, - 0x03910314: 0x1F09, - 0x1F080300: 0x1F0A, - 0x1F090300: 0x1F0B, - 0x1F080301: 0x1F0C, - 0x1F090301: 0x1F0D, - 0x1F080342: 0x1F0E, - 0x1F090342: 0x1F0F, - 0x03B50313: 0x1F10, - 0x03B50314: 0x1F11, - 0x1F100300: 0x1F12, - 0x1F110300: 0x1F13, - 0x1F100301: 0x1F14, - 0x1F110301: 0x1F15, - 0x03950313: 0x1F18, - 0x03950314: 0x1F19, - 0x1F180300: 0x1F1A, - 0x1F190300: 0x1F1B, - 0x1F180301: 0x1F1C, - 0x1F190301: 0x1F1D, - 0x03B70313: 0x1F20, - 0x03B70314: 0x1F21, - 0x1F200300: 0x1F22, - 0x1F210300: 0x1F23, - 0x1F200301: 0x1F24, - 0x1F210301: 0x1F25, - 0x1F200342: 0x1F26, - 0x1F210342: 0x1F27, - 0x03970313: 0x1F28, - 0x03970314: 0x1F29, - 0x1F280300: 0x1F2A, - 0x1F290300: 0x1F2B, - 0x1F280301: 0x1F2C, - 0x1F290301: 0x1F2D, - 0x1F280342: 0x1F2E, - 0x1F290342: 0x1F2F, - 0x03B90313: 0x1F30, - 0x03B90314: 0x1F31, - 0x1F300300: 0x1F32, - 0x1F310300: 0x1F33, - 0x1F300301: 0x1F34, - 0x1F310301: 0x1F35, - 0x1F300342: 0x1F36, - 0x1F310342: 0x1F37, - 0x03990313: 0x1F38, - 0x03990314: 0x1F39, - 0x1F380300: 0x1F3A, - 0x1F390300: 0x1F3B, - 0x1F380301: 0x1F3C, - 0x1F390301: 0x1F3D, - 0x1F380342: 0x1F3E, - 0x1F390342: 0x1F3F, - 0x03BF0313: 0x1F40, - 0x03BF0314: 0x1F41, - 0x1F400300: 0x1F42, - 0x1F410300: 0x1F43, - 0x1F400301: 0x1F44, - 0x1F410301: 0x1F45, - 0x039F0313: 0x1F48, - 0x039F0314: 0x1F49, - 0x1F480300: 0x1F4A, - 0x1F490300: 0x1F4B, - 0x1F480301: 0x1F4C, - 0x1F490301: 0x1F4D, - 0x03C50313: 0x1F50, - 0x03C50314: 0x1F51, - 0x1F500300: 0x1F52, - 0x1F510300: 0x1F53, - 0x1F500301: 0x1F54, - 0x1F510301: 0x1F55, - 0x1F500342: 0x1F56, - 0x1F510342: 0x1F57, - 0x03A50314: 0x1F59, - 0x1F590300: 0x1F5B, - 0x1F590301: 0x1F5D, - 0x1F590342: 0x1F5F, - 0x03C90313: 0x1F60, - 0x03C90314: 0x1F61, - 0x1F600300: 0x1F62, - 0x1F610300: 0x1F63, - 0x1F600301: 0x1F64, - 0x1F610301: 0x1F65, - 0x1F600342: 0x1F66, - 0x1F610342: 0x1F67, - 0x03A90313: 0x1F68, - 0x03A90314: 0x1F69, - 0x1F680300: 0x1F6A, - 0x1F690300: 0x1F6B, - 0x1F680301: 0x1F6C, - 0x1F690301: 0x1F6D, - 0x1F680342: 0x1F6E, - 0x1F690342: 0x1F6F, - 0x03B10300: 0x1F70, - 0x03B50300: 0x1F72, - 0x03B70300: 0x1F74, - 0x03B90300: 0x1F76, - 0x03BF0300: 0x1F78, - 0x03C50300: 0x1F7A, - 0x03C90300: 0x1F7C, - 0x1F000345: 0x1F80, - 0x1F010345: 0x1F81, - 0x1F020345: 0x1F82, - 0x1F030345: 0x1F83, - 0x1F040345: 0x1F84, - 0x1F050345: 0x1F85, - 0x1F060345: 0x1F86, - 0x1F070345: 0x1F87, - 0x1F080345: 0x1F88, - 0x1F090345: 0x1F89, - 0x1F0A0345: 0x1F8A, - 0x1F0B0345: 0x1F8B, - 0x1F0C0345: 0x1F8C, - 0x1F0D0345: 0x1F8D, - 0x1F0E0345: 0x1F8E, - 0x1F0F0345: 0x1F8F, - 0x1F200345: 0x1F90, - 0x1F210345: 0x1F91, - 0x1F220345: 0x1F92, - 0x1F230345: 0x1F93, - 0x1F240345: 0x1F94, - 0x1F250345: 0x1F95, - 0x1F260345: 0x1F96, - 0x1F270345: 0x1F97, - 0x1F280345: 0x1F98, - 0x1F290345: 0x1F99, - 0x1F2A0345: 0x1F9A, - 0x1F2B0345: 0x1F9B, - 0x1F2C0345: 0x1F9C, - 0x1F2D0345: 0x1F9D, - 0x1F2E0345: 0x1F9E, - 0x1F2F0345: 0x1F9F, - 0x1F600345: 0x1FA0, - 0x1F610345: 0x1FA1, - 0x1F620345: 0x1FA2, - 0x1F630345: 0x1FA3, - 0x1F640345: 0x1FA4, - 0x1F650345: 0x1FA5, - 0x1F660345: 0x1FA6, - 0x1F670345: 0x1FA7, - 0x1F680345: 0x1FA8, - 0x1F690345: 0x1FA9, - 0x1F6A0345: 0x1FAA, - 0x1F6B0345: 0x1FAB, - 0x1F6C0345: 0x1FAC, - 0x1F6D0345: 0x1FAD, - 0x1F6E0345: 0x1FAE, - 0x1F6F0345: 0x1FAF, - 0x03B10306: 0x1FB0, - 0x03B10304: 0x1FB1, - 0x1F700345: 0x1FB2, - 0x03B10345: 0x1FB3, - 0x03AC0345: 0x1FB4, - 0x03B10342: 0x1FB6, - 0x1FB60345: 0x1FB7, - 0x03910306: 0x1FB8, - 0x03910304: 0x1FB9, - 0x03910300: 0x1FBA, - 0x03910345: 0x1FBC, - 0x00A80342: 0x1FC1, - 0x1F740345: 0x1FC2, - 0x03B70345: 0x1FC3, - 0x03AE0345: 0x1FC4, - 0x03B70342: 0x1FC6, - 0x1FC60345: 0x1FC7, - 0x03950300: 0x1FC8, - 0x03970300: 0x1FCA, - 0x03970345: 0x1FCC, - 0x1FBF0300: 0x1FCD, - 0x1FBF0301: 0x1FCE, - 0x1FBF0342: 0x1FCF, - 0x03B90306: 0x1FD0, - 0x03B90304: 0x1FD1, - 0x03CA0300: 0x1FD2, - 0x03B90342: 0x1FD6, - 0x03CA0342: 0x1FD7, - 0x03990306: 0x1FD8, - 0x03990304: 0x1FD9, - 0x03990300: 0x1FDA, - 0x1FFE0300: 0x1FDD, - 0x1FFE0301: 0x1FDE, - 0x1FFE0342: 0x1FDF, - 0x03C50306: 0x1FE0, - 0x03C50304: 0x1FE1, - 0x03CB0300: 0x1FE2, - 0x03C10313: 0x1FE4, - 0x03C10314: 0x1FE5, - 0x03C50342: 0x1FE6, - 0x03CB0342: 0x1FE7, - 0x03A50306: 0x1FE8, - 0x03A50304: 0x1FE9, - 0x03A50300: 0x1FEA, - 0x03A10314: 0x1FEC, - 0x00A80300: 0x1FED, - 0x1F7C0345: 0x1FF2, - 0x03C90345: 0x1FF3, - 0x03CE0345: 0x1FF4, - 0x03C90342: 0x1FF6, - 0x1FF60345: 0x1FF7, - 0x039F0300: 0x1FF8, - 0x03A90300: 0x1FFA, - 0x03A90345: 0x1FFC, - 0x21900338: 0x219A, - 0x21920338: 0x219B, - 0x21940338: 0x21AE, - 0x21D00338: 0x21CD, - 0x21D40338: 0x21CE, - 0x21D20338: 0x21CF, - 0x22030338: 0x2204, - 0x22080338: 0x2209, - 0x220B0338: 0x220C, - 0x22230338: 0x2224, - 0x22250338: 0x2226, - 0x223C0338: 0x2241, - 0x22430338: 0x2244, - 0x22450338: 0x2247, - 0x22480338: 0x2249, - 0x003D0338: 0x2260, - 0x22610338: 0x2262, - 0x224D0338: 0x226D, - 0x003C0338: 0x226E, - 0x003E0338: 0x226F, - 0x22640338: 0x2270, - 0x22650338: 0x2271, - 0x22720338: 0x2274, - 0x22730338: 0x2275, - 0x22760338: 0x2278, - 0x22770338: 0x2279, - 0x227A0338: 0x2280, - 0x227B0338: 0x2281, - 0x22820338: 0x2284, - 0x22830338: 0x2285, - 0x22860338: 0x2288, - 0x22870338: 0x2289, - 0x22A20338: 0x22AC, - 0x22A80338: 0x22AD, - 0x22A90338: 0x22AE, - 0x22AB0338: 0x22AF, - 0x227C0338: 0x22E0, - 0x227D0338: 0x22E1, - 0x22910338: 0x22E2, - 0x22920338: 0x22E3, - 0x22B20338: 0x22EA, - 0x22B30338: 0x22EB, - 0x22B40338: 0x22EC, - 0x22B50338: 0x22ED, - 0x304B3099: 0x304C, - 0x304D3099: 0x304E, - 0x304F3099: 0x3050, - 0x30513099: 0x3052, - 0x30533099: 0x3054, - 0x30553099: 0x3056, - 0x30573099: 0x3058, - 0x30593099: 0x305A, - 0x305B3099: 0x305C, - 0x305D3099: 0x305E, - 0x305F3099: 0x3060, - 0x30613099: 0x3062, - 0x30643099: 0x3065, - 0x30663099: 0x3067, - 0x30683099: 0x3069, - 0x306F3099: 0x3070, - 0x306F309A: 0x3071, - 0x30723099: 0x3073, - 0x3072309A: 0x3074, - 0x30753099: 0x3076, - 0x3075309A: 0x3077, - 0x30783099: 0x3079, - 0x3078309A: 0x307A, - 0x307B3099: 0x307C, - 0x307B309A: 0x307D, - 0x30463099: 0x3094, - 0x309D3099: 0x309E, - 0x30AB3099: 0x30AC, - 0x30AD3099: 0x30AE, - 0x30AF3099: 0x30B0, - 0x30B13099: 0x30B2, - 0x30B33099: 0x30B4, - 0x30B53099: 0x30B6, - 0x30B73099: 0x30B8, - 0x30B93099: 0x30BA, - 0x30BB3099: 0x30BC, - 0x30BD3099: 0x30BE, - 0x30BF3099: 0x30C0, - 0x30C13099: 0x30C2, - 0x30C43099: 0x30C5, - 0x30C63099: 0x30C7, - 0x30C83099: 0x30C9, - 0x30CF3099: 0x30D0, - 0x30CF309A: 0x30D1, - 0x30D23099: 0x30D3, - 0x30D2309A: 0x30D4, - 0x30D53099: 0x30D6, - 0x30D5309A: 0x30D7, - 0x30D83099: 0x30D9, - 0x30D8309A: 0x30DA, - 0x30DB3099: 0x30DC, - 0x30DB309A: 0x30DD, - 0x30A63099: 0x30F4, - 0x30EF3099: 0x30F7, - 0x30F03099: 0x30F8, - 0x30F13099: 0x30F9, - 0x30F23099: 0x30FA, - 0x30FD3099: 0x30FE, - 0x109910BA: 0x1109A, - 0x109B10BA: 0x1109C, - 0x10A510BA: 0x110AB, - 0x11311127: 0x1112E, - 0x11321127: 0x1112F, - 0x1347133E: 0x1134B, - 0x13471357: 0x1134C, - 0x14B914BA: 0x114BB, - 0x14B914B0: 0x114BC, - 0x14B914BD: 0x114BE, - 0x15B815AF: 0x115BA, - 0x15B915AF: 0x115BB, -} +var recompMap map[uint32]rune +var recompMapOnce sync.Once -// Total size of tables: 53KB (54226 bytes) +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "" + // Total size of tables: 53KB (54226 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go new file mode 100644 index 0000000000..7297cce32b --- /dev/null +++ b/vendor/golang.org/x/text/unicode/norm/tables11.0.0.go @@ -0,0 +1,7693 @@ +// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. + +// +build go1.13 + +package norm + +import "sync" + +const ( + // Version is the Unicode edition from which the tables are derived. + Version = "11.0.0" + + // MaxTransformChunkSize indicates the maximum number of bytes that Transform + // may need to write atomically for any Form. Making a destination buffer at + // least this size ensures that Transform can always make progress and that + // the user does not need to grow the buffer on an ErrShortDst. + MaxTransformChunkSize = 35 + maxNonStarters*4 +) + +var ccc = [55]uint8{ + 0, 1, 7, 8, 9, 10, 11, 12, + 13, 14, 15, 16, 17, 18, 19, 20, + 21, 22, 23, 24, 25, 26, 27, 28, + 29, 30, 31, 32, 33, 34, 35, 36, + 84, 91, 103, 107, 118, 122, 129, 130, + 132, 202, 214, 216, 218, 220, 222, 224, + 226, 228, 230, 232, 233, 234, 240, +} + +const ( + firstMulti = 0x186D + firstCCC = 0x2C9E + endMulti = 0x2F60 + firstLeadingCCC = 0x49AE + firstCCCZeroExcept = 0x4A78 + firstStarterWithNLead = 0x4A9F + lastDecomp = 0x4AA1 + maxDecomp = 0x8000 +) + +// decomps: 19105 bytes +var decomps = [...]byte{ + // Bytes 0 - 3f + 0x00, 0x41, 0x20, 0x41, 0x21, 0x41, 0x22, 0x41, + 0x23, 0x41, 0x24, 0x41, 0x25, 0x41, 0x26, 0x41, + 0x27, 0x41, 0x28, 0x41, 0x29, 0x41, 0x2A, 0x41, + 0x2B, 0x41, 0x2C, 0x41, 0x2D, 0x41, 0x2E, 0x41, + 0x2F, 0x41, 0x30, 0x41, 0x31, 0x41, 0x32, 0x41, + 0x33, 0x41, 0x34, 0x41, 0x35, 0x41, 0x36, 0x41, + 0x37, 0x41, 0x38, 0x41, 0x39, 0x41, 0x3A, 0x41, + 0x3B, 0x41, 0x3C, 0x41, 0x3D, 0x41, 0x3E, 0x41, + // Bytes 40 - 7f + 0x3F, 0x41, 0x40, 0x41, 0x41, 0x41, 0x42, 0x41, + 0x43, 0x41, 0x44, 0x41, 0x45, 0x41, 0x46, 0x41, + 0x47, 0x41, 0x48, 0x41, 0x49, 0x41, 0x4A, 0x41, + 0x4B, 0x41, 0x4C, 0x41, 0x4D, 0x41, 0x4E, 0x41, + 0x4F, 0x41, 0x50, 0x41, 0x51, 0x41, 0x52, 0x41, + 0x53, 0x41, 0x54, 0x41, 0x55, 0x41, 0x56, 0x41, + 0x57, 0x41, 0x58, 0x41, 0x59, 0x41, 0x5A, 0x41, + 0x5B, 0x41, 0x5C, 0x41, 0x5D, 0x41, 0x5E, 0x41, + // Bytes 80 - bf + 0x5F, 0x41, 0x60, 0x41, 0x61, 0x41, 0x62, 0x41, + 0x63, 0x41, 0x64, 0x41, 0x65, 0x41, 0x66, 0x41, + 0x67, 0x41, 0x68, 0x41, 0x69, 0x41, 0x6A, 0x41, + 0x6B, 0x41, 0x6C, 0x41, 0x6D, 0x41, 0x6E, 0x41, + 0x6F, 0x41, 0x70, 0x41, 0x71, 0x41, 0x72, 0x41, + 0x73, 0x41, 0x74, 0x41, 0x75, 0x41, 0x76, 0x41, + 0x77, 0x41, 0x78, 0x41, 0x79, 0x41, 0x7A, 0x41, + 0x7B, 0x41, 0x7C, 0x41, 0x7D, 0x41, 0x7E, 0x42, + // Bytes c0 - ff + 0xC2, 0xA2, 0x42, 0xC2, 0xA3, 0x42, 0xC2, 0xA5, + 0x42, 0xC2, 0xA6, 0x42, 0xC2, 0xAC, 0x42, 0xC2, + 0xB7, 0x42, 0xC3, 0x86, 0x42, 0xC3, 0xB0, 0x42, + 0xC4, 0xA6, 0x42, 0xC4, 0xA7, 0x42, 0xC4, 0xB1, + 0x42, 0xC5, 0x8B, 0x42, 0xC5, 0x93, 0x42, 0xC6, + 0x8E, 0x42, 0xC6, 0x90, 0x42, 0xC6, 0xAB, 0x42, + 0xC8, 0xA2, 0x42, 0xC8, 0xB7, 0x42, 0xC9, 0x90, + 0x42, 0xC9, 0x91, 0x42, 0xC9, 0x92, 0x42, 0xC9, + // Bytes 100 - 13f + 0x94, 0x42, 0xC9, 0x95, 0x42, 0xC9, 0x99, 0x42, + 0xC9, 0x9B, 0x42, 0xC9, 0x9C, 0x42, 0xC9, 0x9F, + 0x42, 0xC9, 0xA1, 0x42, 0xC9, 0xA3, 0x42, 0xC9, + 0xA5, 0x42, 0xC9, 0xA6, 0x42, 0xC9, 0xA8, 0x42, + 0xC9, 0xA9, 0x42, 0xC9, 0xAA, 0x42, 0xC9, 0xAB, + 0x42, 0xC9, 0xAD, 0x42, 0xC9, 0xAF, 0x42, 0xC9, + 0xB0, 0x42, 0xC9, 0xB1, 0x42, 0xC9, 0xB2, 0x42, + 0xC9, 0xB3, 0x42, 0xC9, 0xB4, 0x42, 0xC9, 0xB5, + // Bytes 140 - 17f + 0x42, 0xC9, 0xB8, 0x42, 0xC9, 0xB9, 0x42, 0xC9, + 0xBB, 0x42, 0xCA, 0x81, 0x42, 0xCA, 0x82, 0x42, + 0xCA, 0x83, 0x42, 0xCA, 0x89, 0x42, 0xCA, 0x8A, + 0x42, 0xCA, 0x8B, 0x42, 0xCA, 0x8C, 0x42, 0xCA, + 0x90, 0x42, 0xCA, 0x91, 0x42, 0xCA, 0x92, 0x42, + 0xCA, 0x95, 0x42, 0xCA, 0x9D, 0x42, 0xCA, 0x9F, + 0x42, 0xCA, 0xB9, 0x42, 0xCE, 0x91, 0x42, 0xCE, + 0x92, 0x42, 0xCE, 0x93, 0x42, 0xCE, 0x94, 0x42, + // Bytes 180 - 1bf + 0xCE, 0x95, 0x42, 0xCE, 0x96, 0x42, 0xCE, 0x97, + 0x42, 0xCE, 0x98, 0x42, 0xCE, 0x99, 0x42, 0xCE, + 0x9A, 0x42, 0xCE, 0x9B, 0x42, 0xCE, 0x9C, 0x42, + 0xCE, 0x9D, 0x42, 0xCE, 0x9E, 0x42, 0xCE, 0x9F, + 0x42, 0xCE, 0xA0, 0x42, 0xCE, 0xA1, 0x42, 0xCE, + 0xA3, 0x42, 0xCE, 0xA4, 0x42, 0xCE, 0xA5, 0x42, + 0xCE, 0xA6, 0x42, 0xCE, 0xA7, 0x42, 0xCE, 0xA8, + 0x42, 0xCE, 0xA9, 0x42, 0xCE, 0xB1, 0x42, 0xCE, + // Bytes 1c0 - 1ff + 0xB2, 0x42, 0xCE, 0xB3, 0x42, 0xCE, 0xB4, 0x42, + 0xCE, 0xB5, 0x42, 0xCE, 0xB6, 0x42, 0xCE, 0xB7, + 0x42, 0xCE, 0xB8, 0x42, 0xCE, 0xB9, 0x42, 0xCE, + 0xBA, 0x42, 0xCE, 0xBB, 0x42, 0xCE, 0xBC, 0x42, + 0xCE, 0xBD, 0x42, 0xCE, 0xBE, 0x42, 0xCE, 0xBF, + 0x42, 0xCF, 0x80, 0x42, 0xCF, 0x81, 0x42, 0xCF, + 0x82, 0x42, 0xCF, 0x83, 0x42, 0xCF, 0x84, 0x42, + 0xCF, 0x85, 0x42, 0xCF, 0x86, 0x42, 0xCF, 0x87, + // Bytes 200 - 23f + 0x42, 0xCF, 0x88, 0x42, 0xCF, 0x89, 0x42, 0xCF, + 0x9C, 0x42, 0xCF, 0x9D, 0x42, 0xD0, 0xBD, 0x42, + 0xD1, 0x8A, 0x42, 0xD1, 0x8C, 0x42, 0xD7, 0x90, + 0x42, 0xD7, 0x91, 0x42, 0xD7, 0x92, 0x42, 0xD7, + 0x93, 0x42, 0xD7, 0x94, 0x42, 0xD7, 0x9B, 0x42, + 0xD7, 0x9C, 0x42, 0xD7, 0x9D, 0x42, 0xD7, 0xA2, + 0x42, 0xD7, 0xA8, 0x42, 0xD7, 0xAA, 0x42, 0xD8, + 0xA1, 0x42, 0xD8, 0xA7, 0x42, 0xD8, 0xA8, 0x42, + // Bytes 240 - 27f + 0xD8, 0xA9, 0x42, 0xD8, 0xAA, 0x42, 0xD8, 0xAB, + 0x42, 0xD8, 0xAC, 0x42, 0xD8, 0xAD, 0x42, 0xD8, + 0xAE, 0x42, 0xD8, 0xAF, 0x42, 0xD8, 0xB0, 0x42, + 0xD8, 0xB1, 0x42, 0xD8, 0xB2, 0x42, 0xD8, 0xB3, + 0x42, 0xD8, 0xB4, 0x42, 0xD8, 0xB5, 0x42, 0xD8, + 0xB6, 0x42, 0xD8, 0xB7, 0x42, 0xD8, 0xB8, 0x42, + 0xD8, 0xB9, 0x42, 0xD8, 0xBA, 0x42, 0xD9, 0x81, + 0x42, 0xD9, 0x82, 0x42, 0xD9, 0x83, 0x42, 0xD9, + // Bytes 280 - 2bf + 0x84, 0x42, 0xD9, 0x85, 0x42, 0xD9, 0x86, 0x42, + 0xD9, 0x87, 0x42, 0xD9, 0x88, 0x42, 0xD9, 0x89, + 0x42, 0xD9, 0x8A, 0x42, 0xD9, 0xAE, 0x42, 0xD9, + 0xAF, 0x42, 0xD9, 0xB1, 0x42, 0xD9, 0xB9, 0x42, + 0xD9, 0xBA, 0x42, 0xD9, 0xBB, 0x42, 0xD9, 0xBE, + 0x42, 0xD9, 0xBF, 0x42, 0xDA, 0x80, 0x42, 0xDA, + 0x83, 0x42, 0xDA, 0x84, 0x42, 0xDA, 0x86, 0x42, + 0xDA, 0x87, 0x42, 0xDA, 0x88, 0x42, 0xDA, 0x8C, + // Bytes 2c0 - 2ff + 0x42, 0xDA, 0x8D, 0x42, 0xDA, 0x8E, 0x42, 0xDA, + 0x91, 0x42, 0xDA, 0x98, 0x42, 0xDA, 0xA1, 0x42, + 0xDA, 0xA4, 0x42, 0xDA, 0xA6, 0x42, 0xDA, 0xA9, + 0x42, 0xDA, 0xAD, 0x42, 0xDA, 0xAF, 0x42, 0xDA, + 0xB1, 0x42, 0xDA, 0xB3, 0x42, 0xDA, 0xBA, 0x42, + 0xDA, 0xBB, 0x42, 0xDA, 0xBE, 0x42, 0xDB, 0x81, + 0x42, 0xDB, 0x85, 0x42, 0xDB, 0x86, 0x42, 0xDB, + 0x87, 0x42, 0xDB, 0x88, 0x42, 0xDB, 0x89, 0x42, + // Bytes 300 - 33f + 0xDB, 0x8B, 0x42, 0xDB, 0x8C, 0x42, 0xDB, 0x90, + 0x42, 0xDB, 0x92, 0x43, 0xE0, 0xBC, 0x8B, 0x43, + 0xE1, 0x83, 0x9C, 0x43, 0xE1, 0x84, 0x80, 0x43, + 0xE1, 0x84, 0x81, 0x43, 0xE1, 0x84, 0x82, 0x43, + 0xE1, 0x84, 0x83, 0x43, 0xE1, 0x84, 0x84, 0x43, + 0xE1, 0x84, 0x85, 0x43, 0xE1, 0x84, 0x86, 0x43, + 0xE1, 0x84, 0x87, 0x43, 0xE1, 0x84, 0x88, 0x43, + 0xE1, 0x84, 0x89, 0x43, 0xE1, 0x84, 0x8A, 0x43, + // Bytes 340 - 37f + 0xE1, 0x84, 0x8B, 0x43, 0xE1, 0x84, 0x8C, 0x43, + 0xE1, 0x84, 0x8D, 0x43, 0xE1, 0x84, 0x8E, 0x43, + 0xE1, 0x84, 0x8F, 0x43, 0xE1, 0x84, 0x90, 0x43, + 0xE1, 0x84, 0x91, 0x43, 0xE1, 0x84, 0x92, 0x43, + 0xE1, 0x84, 0x94, 0x43, 0xE1, 0x84, 0x95, 0x43, + 0xE1, 0x84, 0x9A, 0x43, 0xE1, 0x84, 0x9C, 0x43, + 0xE1, 0x84, 0x9D, 0x43, 0xE1, 0x84, 0x9E, 0x43, + 0xE1, 0x84, 0xA0, 0x43, 0xE1, 0x84, 0xA1, 0x43, + // Bytes 380 - 3bf + 0xE1, 0x84, 0xA2, 0x43, 0xE1, 0x84, 0xA3, 0x43, + 0xE1, 0x84, 0xA7, 0x43, 0xE1, 0x84, 0xA9, 0x43, + 0xE1, 0x84, 0xAB, 0x43, 0xE1, 0x84, 0xAC, 0x43, + 0xE1, 0x84, 0xAD, 0x43, 0xE1, 0x84, 0xAE, 0x43, + 0xE1, 0x84, 0xAF, 0x43, 0xE1, 0x84, 0xB2, 0x43, + 0xE1, 0x84, 0xB6, 0x43, 0xE1, 0x85, 0x80, 0x43, + 0xE1, 0x85, 0x87, 0x43, 0xE1, 0x85, 0x8C, 0x43, + 0xE1, 0x85, 0x97, 0x43, 0xE1, 0x85, 0x98, 0x43, + // Bytes 3c0 - 3ff + 0xE1, 0x85, 0x99, 0x43, 0xE1, 0x85, 0xA0, 0x43, + 0xE1, 0x86, 0x84, 0x43, 0xE1, 0x86, 0x85, 0x43, + 0xE1, 0x86, 0x88, 0x43, 0xE1, 0x86, 0x91, 0x43, + 0xE1, 0x86, 0x92, 0x43, 0xE1, 0x86, 0x94, 0x43, + 0xE1, 0x86, 0x9E, 0x43, 0xE1, 0x86, 0xA1, 0x43, + 0xE1, 0x87, 0x87, 0x43, 0xE1, 0x87, 0x88, 0x43, + 0xE1, 0x87, 0x8C, 0x43, 0xE1, 0x87, 0x8E, 0x43, + 0xE1, 0x87, 0x93, 0x43, 0xE1, 0x87, 0x97, 0x43, + // Bytes 400 - 43f + 0xE1, 0x87, 0x99, 0x43, 0xE1, 0x87, 0x9D, 0x43, + 0xE1, 0x87, 0x9F, 0x43, 0xE1, 0x87, 0xB1, 0x43, + 0xE1, 0x87, 0xB2, 0x43, 0xE1, 0xB4, 0x82, 0x43, + 0xE1, 0xB4, 0x96, 0x43, 0xE1, 0xB4, 0x97, 0x43, + 0xE1, 0xB4, 0x9C, 0x43, 0xE1, 0xB4, 0x9D, 0x43, + 0xE1, 0xB4, 0xA5, 0x43, 0xE1, 0xB5, 0xBB, 0x43, + 0xE1, 0xB6, 0x85, 0x43, 0xE2, 0x80, 0x82, 0x43, + 0xE2, 0x80, 0x83, 0x43, 0xE2, 0x80, 0x90, 0x43, + // Bytes 440 - 47f + 0xE2, 0x80, 0x93, 0x43, 0xE2, 0x80, 0x94, 0x43, + 0xE2, 0x82, 0xA9, 0x43, 0xE2, 0x86, 0x90, 0x43, + 0xE2, 0x86, 0x91, 0x43, 0xE2, 0x86, 0x92, 0x43, + 0xE2, 0x86, 0x93, 0x43, 0xE2, 0x88, 0x82, 0x43, + 0xE2, 0x88, 0x87, 0x43, 0xE2, 0x88, 0x91, 0x43, + 0xE2, 0x88, 0x92, 0x43, 0xE2, 0x94, 0x82, 0x43, + 0xE2, 0x96, 0xA0, 0x43, 0xE2, 0x97, 0x8B, 0x43, + 0xE2, 0xA6, 0x85, 0x43, 0xE2, 0xA6, 0x86, 0x43, + // Bytes 480 - 4bf + 0xE2, 0xB5, 0xA1, 0x43, 0xE3, 0x80, 0x81, 0x43, + 0xE3, 0x80, 0x82, 0x43, 0xE3, 0x80, 0x88, 0x43, + 0xE3, 0x80, 0x89, 0x43, 0xE3, 0x80, 0x8A, 0x43, + 0xE3, 0x80, 0x8B, 0x43, 0xE3, 0x80, 0x8C, 0x43, + 0xE3, 0x80, 0x8D, 0x43, 0xE3, 0x80, 0x8E, 0x43, + 0xE3, 0x80, 0x8F, 0x43, 0xE3, 0x80, 0x90, 0x43, + 0xE3, 0x80, 0x91, 0x43, 0xE3, 0x80, 0x92, 0x43, + 0xE3, 0x80, 0x94, 0x43, 0xE3, 0x80, 0x95, 0x43, + // Bytes 4c0 - 4ff + 0xE3, 0x80, 0x96, 0x43, 0xE3, 0x80, 0x97, 0x43, + 0xE3, 0x82, 0xA1, 0x43, 0xE3, 0x82, 0xA2, 0x43, + 0xE3, 0x82, 0xA3, 0x43, 0xE3, 0x82, 0xA4, 0x43, + 0xE3, 0x82, 0xA5, 0x43, 0xE3, 0x82, 0xA6, 0x43, + 0xE3, 0x82, 0xA7, 0x43, 0xE3, 0x82, 0xA8, 0x43, + 0xE3, 0x82, 0xA9, 0x43, 0xE3, 0x82, 0xAA, 0x43, + 0xE3, 0x82, 0xAB, 0x43, 0xE3, 0x82, 0xAD, 0x43, + 0xE3, 0x82, 0xAF, 0x43, 0xE3, 0x82, 0xB1, 0x43, + // Bytes 500 - 53f + 0xE3, 0x82, 0xB3, 0x43, 0xE3, 0x82, 0xB5, 0x43, + 0xE3, 0x82, 0xB7, 0x43, 0xE3, 0x82, 0xB9, 0x43, + 0xE3, 0x82, 0xBB, 0x43, 0xE3, 0x82, 0xBD, 0x43, + 0xE3, 0x82, 0xBF, 0x43, 0xE3, 0x83, 0x81, 0x43, + 0xE3, 0x83, 0x83, 0x43, 0xE3, 0x83, 0x84, 0x43, + 0xE3, 0x83, 0x86, 0x43, 0xE3, 0x83, 0x88, 0x43, + 0xE3, 0x83, 0x8A, 0x43, 0xE3, 0x83, 0x8B, 0x43, + 0xE3, 0x83, 0x8C, 0x43, 0xE3, 0x83, 0x8D, 0x43, + // Bytes 540 - 57f + 0xE3, 0x83, 0x8E, 0x43, 0xE3, 0x83, 0x8F, 0x43, + 0xE3, 0x83, 0x92, 0x43, 0xE3, 0x83, 0x95, 0x43, + 0xE3, 0x83, 0x98, 0x43, 0xE3, 0x83, 0x9B, 0x43, + 0xE3, 0x83, 0x9E, 0x43, 0xE3, 0x83, 0x9F, 0x43, + 0xE3, 0x83, 0xA0, 0x43, 0xE3, 0x83, 0xA1, 0x43, + 0xE3, 0x83, 0xA2, 0x43, 0xE3, 0x83, 0xA3, 0x43, + 0xE3, 0x83, 0xA4, 0x43, 0xE3, 0x83, 0xA5, 0x43, + 0xE3, 0x83, 0xA6, 0x43, 0xE3, 0x83, 0xA7, 0x43, + // Bytes 580 - 5bf + 0xE3, 0x83, 0xA8, 0x43, 0xE3, 0x83, 0xA9, 0x43, + 0xE3, 0x83, 0xAA, 0x43, 0xE3, 0x83, 0xAB, 0x43, + 0xE3, 0x83, 0xAC, 0x43, 0xE3, 0x83, 0xAD, 0x43, + 0xE3, 0x83, 0xAF, 0x43, 0xE3, 0x83, 0xB0, 0x43, + 0xE3, 0x83, 0xB1, 0x43, 0xE3, 0x83, 0xB2, 0x43, + 0xE3, 0x83, 0xB3, 0x43, 0xE3, 0x83, 0xBB, 0x43, + 0xE3, 0x83, 0xBC, 0x43, 0xE3, 0x92, 0x9E, 0x43, + 0xE3, 0x92, 0xB9, 0x43, 0xE3, 0x92, 0xBB, 0x43, + // Bytes 5c0 - 5ff + 0xE3, 0x93, 0x9F, 0x43, 0xE3, 0x94, 0x95, 0x43, + 0xE3, 0x9B, 0xAE, 0x43, 0xE3, 0x9B, 0xBC, 0x43, + 0xE3, 0x9E, 0x81, 0x43, 0xE3, 0xA0, 0xAF, 0x43, + 0xE3, 0xA1, 0xA2, 0x43, 0xE3, 0xA1, 0xBC, 0x43, + 0xE3, 0xA3, 0x87, 0x43, 0xE3, 0xA3, 0xA3, 0x43, + 0xE3, 0xA4, 0x9C, 0x43, 0xE3, 0xA4, 0xBA, 0x43, + 0xE3, 0xA8, 0xAE, 0x43, 0xE3, 0xA9, 0xAC, 0x43, + 0xE3, 0xAB, 0xA4, 0x43, 0xE3, 0xAC, 0x88, 0x43, + // Bytes 600 - 63f + 0xE3, 0xAC, 0x99, 0x43, 0xE3, 0xAD, 0x89, 0x43, + 0xE3, 0xAE, 0x9D, 0x43, 0xE3, 0xB0, 0x98, 0x43, + 0xE3, 0xB1, 0x8E, 0x43, 0xE3, 0xB4, 0xB3, 0x43, + 0xE3, 0xB6, 0x96, 0x43, 0xE3, 0xBA, 0xAC, 0x43, + 0xE3, 0xBA, 0xB8, 0x43, 0xE3, 0xBC, 0x9B, 0x43, + 0xE3, 0xBF, 0xBC, 0x43, 0xE4, 0x80, 0x88, 0x43, + 0xE4, 0x80, 0x98, 0x43, 0xE4, 0x80, 0xB9, 0x43, + 0xE4, 0x81, 0x86, 0x43, 0xE4, 0x82, 0x96, 0x43, + // Bytes 640 - 67f + 0xE4, 0x83, 0xA3, 0x43, 0xE4, 0x84, 0xAF, 0x43, + 0xE4, 0x88, 0x82, 0x43, 0xE4, 0x88, 0xA7, 0x43, + 0xE4, 0x8A, 0xA0, 0x43, 0xE4, 0x8C, 0x81, 0x43, + 0xE4, 0x8C, 0xB4, 0x43, 0xE4, 0x8D, 0x99, 0x43, + 0xE4, 0x8F, 0x95, 0x43, 0xE4, 0x8F, 0x99, 0x43, + 0xE4, 0x90, 0x8B, 0x43, 0xE4, 0x91, 0xAB, 0x43, + 0xE4, 0x94, 0xAB, 0x43, 0xE4, 0x95, 0x9D, 0x43, + 0xE4, 0x95, 0xA1, 0x43, 0xE4, 0x95, 0xAB, 0x43, + // Bytes 680 - 6bf + 0xE4, 0x97, 0x97, 0x43, 0xE4, 0x97, 0xB9, 0x43, + 0xE4, 0x98, 0xB5, 0x43, 0xE4, 0x9A, 0xBE, 0x43, + 0xE4, 0x9B, 0x87, 0x43, 0xE4, 0xA6, 0x95, 0x43, + 0xE4, 0xA7, 0xA6, 0x43, 0xE4, 0xA9, 0xAE, 0x43, + 0xE4, 0xA9, 0xB6, 0x43, 0xE4, 0xAA, 0xB2, 0x43, + 0xE4, 0xAC, 0xB3, 0x43, 0xE4, 0xAF, 0x8E, 0x43, + 0xE4, 0xB3, 0x8E, 0x43, 0xE4, 0xB3, 0xAD, 0x43, + 0xE4, 0xB3, 0xB8, 0x43, 0xE4, 0xB5, 0x96, 0x43, + // Bytes 6c0 - 6ff + 0xE4, 0xB8, 0x80, 0x43, 0xE4, 0xB8, 0x81, 0x43, + 0xE4, 0xB8, 0x83, 0x43, 0xE4, 0xB8, 0x89, 0x43, + 0xE4, 0xB8, 0x8A, 0x43, 0xE4, 0xB8, 0x8B, 0x43, + 0xE4, 0xB8, 0x8D, 0x43, 0xE4, 0xB8, 0x99, 0x43, + 0xE4, 0xB8, 0xA6, 0x43, 0xE4, 0xB8, 0xA8, 0x43, + 0xE4, 0xB8, 0xAD, 0x43, 0xE4, 0xB8, 0xB2, 0x43, + 0xE4, 0xB8, 0xB6, 0x43, 0xE4, 0xB8, 0xB8, 0x43, + 0xE4, 0xB8, 0xB9, 0x43, 0xE4, 0xB8, 0xBD, 0x43, + // Bytes 700 - 73f + 0xE4, 0xB8, 0xBF, 0x43, 0xE4, 0xB9, 0x81, 0x43, + 0xE4, 0xB9, 0x99, 0x43, 0xE4, 0xB9, 0x9D, 0x43, + 0xE4, 0xBA, 0x82, 0x43, 0xE4, 0xBA, 0x85, 0x43, + 0xE4, 0xBA, 0x86, 0x43, 0xE4, 0xBA, 0x8C, 0x43, + 0xE4, 0xBA, 0x94, 0x43, 0xE4, 0xBA, 0xA0, 0x43, + 0xE4, 0xBA, 0xA4, 0x43, 0xE4, 0xBA, 0xAE, 0x43, + 0xE4, 0xBA, 0xBA, 0x43, 0xE4, 0xBB, 0x80, 0x43, + 0xE4, 0xBB, 0x8C, 0x43, 0xE4, 0xBB, 0xA4, 0x43, + // Bytes 740 - 77f + 0xE4, 0xBC, 0x81, 0x43, 0xE4, 0xBC, 0x91, 0x43, + 0xE4, 0xBD, 0xA0, 0x43, 0xE4, 0xBE, 0x80, 0x43, + 0xE4, 0xBE, 0x86, 0x43, 0xE4, 0xBE, 0x8B, 0x43, + 0xE4, 0xBE, 0xAE, 0x43, 0xE4, 0xBE, 0xBB, 0x43, + 0xE4, 0xBE, 0xBF, 0x43, 0xE5, 0x80, 0x82, 0x43, + 0xE5, 0x80, 0xAB, 0x43, 0xE5, 0x81, 0xBA, 0x43, + 0xE5, 0x82, 0x99, 0x43, 0xE5, 0x83, 0x8F, 0x43, + 0xE5, 0x83, 0x9A, 0x43, 0xE5, 0x83, 0xA7, 0x43, + // Bytes 780 - 7bf + 0xE5, 0x84, 0xAA, 0x43, 0xE5, 0x84, 0xBF, 0x43, + 0xE5, 0x85, 0x80, 0x43, 0xE5, 0x85, 0x85, 0x43, + 0xE5, 0x85, 0x8D, 0x43, 0xE5, 0x85, 0x94, 0x43, + 0xE5, 0x85, 0xA4, 0x43, 0xE5, 0x85, 0xA5, 0x43, + 0xE5, 0x85, 0xA7, 0x43, 0xE5, 0x85, 0xA8, 0x43, + 0xE5, 0x85, 0xA9, 0x43, 0xE5, 0x85, 0xAB, 0x43, + 0xE5, 0x85, 0xAD, 0x43, 0xE5, 0x85, 0xB7, 0x43, + 0xE5, 0x86, 0x80, 0x43, 0xE5, 0x86, 0x82, 0x43, + // Bytes 7c0 - 7ff + 0xE5, 0x86, 0x8D, 0x43, 0xE5, 0x86, 0x92, 0x43, + 0xE5, 0x86, 0x95, 0x43, 0xE5, 0x86, 0x96, 0x43, + 0xE5, 0x86, 0x97, 0x43, 0xE5, 0x86, 0x99, 0x43, + 0xE5, 0x86, 0xA4, 0x43, 0xE5, 0x86, 0xAB, 0x43, + 0xE5, 0x86, 0xAC, 0x43, 0xE5, 0x86, 0xB5, 0x43, + 0xE5, 0x86, 0xB7, 0x43, 0xE5, 0x87, 0x89, 0x43, + 0xE5, 0x87, 0x8C, 0x43, 0xE5, 0x87, 0x9C, 0x43, + 0xE5, 0x87, 0x9E, 0x43, 0xE5, 0x87, 0xA0, 0x43, + // Bytes 800 - 83f + 0xE5, 0x87, 0xB5, 0x43, 0xE5, 0x88, 0x80, 0x43, + 0xE5, 0x88, 0x83, 0x43, 0xE5, 0x88, 0x87, 0x43, + 0xE5, 0x88, 0x97, 0x43, 0xE5, 0x88, 0x9D, 0x43, + 0xE5, 0x88, 0xA9, 0x43, 0xE5, 0x88, 0xBA, 0x43, + 0xE5, 0x88, 0xBB, 0x43, 0xE5, 0x89, 0x86, 0x43, + 0xE5, 0x89, 0x8D, 0x43, 0xE5, 0x89, 0xB2, 0x43, + 0xE5, 0x89, 0xB7, 0x43, 0xE5, 0x8A, 0x89, 0x43, + 0xE5, 0x8A, 0x9B, 0x43, 0xE5, 0x8A, 0xA3, 0x43, + // Bytes 840 - 87f + 0xE5, 0x8A, 0xB3, 0x43, 0xE5, 0x8A, 0xB4, 0x43, + 0xE5, 0x8B, 0x87, 0x43, 0xE5, 0x8B, 0x89, 0x43, + 0xE5, 0x8B, 0x92, 0x43, 0xE5, 0x8B, 0x9E, 0x43, + 0xE5, 0x8B, 0xA4, 0x43, 0xE5, 0x8B, 0xB5, 0x43, + 0xE5, 0x8B, 0xB9, 0x43, 0xE5, 0x8B, 0xBA, 0x43, + 0xE5, 0x8C, 0x85, 0x43, 0xE5, 0x8C, 0x86, 0x43, + 0xE5, 0x8C, 0x95, 0x43, 0xE5, 0x8C, 0x97, 0x43, + 0xE5, 0x8C, 0x9A, 0x43, 0xE5, 0x8C, 0xB8, 0x43, + // Bytes 880 - 8bf + 0xE5, 0x8C, 0xBB, 0x43, 0xE5, 0x8C, 0xBF, 0x43, + 0xE5, 0x8D, 0x81, 0x43, 0xE5, 0x8D, 0x84, 0x43, + 0xE5, 0x8D, 0x85, 0x43, 0xE5, 0x8D, 0x89, 0x43, + 0xE5, 0x8D, 0x91, 0x43, 0xE5, 0x8D, 0x94, 0x43, + 0xE5, 0x8D, 0x9A, 0x43, 0xE5, 0x8D, 0x9C, 0x43, + 0xE5, 0x8D, 0xA9, 0x43, 0xE5, 0x8D, 0xB0, 0x43, + 0xE5, 0x8D, 0xB3, 0x43, 0xE5, 0x8D, 0xB5, 0x43, + 0xE5, 0x8D, 0xBD, 0x43, 0xE5, 0x8D, 0xBF, 0x43, + // Bytes 8c0 - 8ff + 0xE5, 0x8E, 0x82, 0x43, 0xE5, 0x8E, 0xB6, 0x43, + 0xE5, 0x8F, 0x83, 0x43, 0xE5, 0x8F, 0x88, 0x43, + 0xE5, 0x8F, 0x8A, 0x43, 0xE5, 0x8F, 0x8C, 0x43, + 0xE5, 0x8F, 0x9F, 0x43, 0xE5, 0x8F, 0xA3, 0x43, + 0xE5, 0x8F, 0xA5, 0x43, 0xE5, 0x8F, 0xAB, 0x43, + 0xE5, 0x8F, 0xAF, 0x43, 0xE5, 0x8F, 0xB1, 0x43, + 0xE5, 0x8F, 0xB3, 0x43, 0xE5, 0x90, 0x86, 0x43, + 0xE5, 0x90, 0x88, 0x43, 0xE5, 0x90, 0x8D, 0x43, + // Bytes 900 - 93f + 0xE5, 0x90, 0x8F, 0x43, 0xE5, 0x90, 0x9D, 0x43, + 0xE5, 0x90, 0xB8, 0x43, 0xE5, 0x90, 0xB9, 0x43, + 0xE5, 0x91, 0x82, 0x43, 0xE5, 0x91, 0x88, 0x43, + 0xE5, 0x91, 0xA8, 0x43, 0xE5, 0x92, 0x9E, 0x43, + 0xE5, 0x92, 0xA2, 0x43, 0xE5, 0x92, 0xBD, 0x43, + 0xE5, 0x93, 0xB6, 0x43, 0xE5, 0x94, 0x90, 0x43, + 0xE5, 0x95, 0x8F, 0x43, 0xE5, 0x95, 0x93, 0x43, + 0xE5, 0x95, 0x95, 0x43, 0xE5, 0x95, 0xA3, 0x43, + // Bytes 940 - 97f + 0xE5, 0x96, 0x84, 0x43, 0xE5, 0x96, 0x87, 0x43, + 0xE5, 0x96, 0x99, 0x43, 0xE5, 0x96, 0x9D, 0x43, + 0xE5, 0x96, 0xAB, 0x43, 0xE5, 0x96, 0xB3, 0x43, + 0xE5, 0x96, 0xB6, 0x43, 0xE5, 0x97, 0x80, 0x43, + 0xE5, 0x97, 0x82, 0x43, 0xE5, 0x97, 0xA2, 0x43, + 0xE5, 0x98, 0x86, 0x43, 0xE5, 0x99, 0x91, 0x43, + 0xE5, 0x99, 0xA8, 0x43, 0xE5, 0x99, 0xB4, 0x43, + 0xE5, 0x9B, 0x97, 0x43, 0xE5, 0x9B, 0x9B, 0x43, + // Bytes 980 - 9bf + 0xE5, 0x9B, 0xB9, 0x43, 0xE5, 0x9C, 0x96, 0x43, + 0xE5, 0x9C, 0x97, 0x43, 0xE5, 0x9C, 0x9F, 0x43, + 0xE5, 0x9C, 0xB0, 0x43, 0xE5, 0x9E, 0x8B, 0x43, + 0xE5, 0x9F, 0x8E, 0x43, 0xE5, 0x9F, 0xB4, 0x43, + 0xE5, 0xA0, 0x8D, 0x43, 0xE5, 0xA0, 0xB1, 0x43, + 0xE5, 0xA0, 0xB2, 0x43, 0xE5, 0xA1, 0x80, 0x43, + 0xE5, 0xA1, 0x9A, 0x43, 0xE5, 0xA1, 0x9E, 0x43, + 0xE5, 0xA2, 0xA8, 0x43, 0xE5, 0xA2, 0xAC, 0x43, + // Bytes 9c0 - 9ff + 0xE5, 0xA2, 0xB3, 0x43, 0xE5, 0xA3, 0x98, 0x43, + 0xE5, 0xA3, 0x9F, 0x43, 0xE5, 0xA3, 0xAB, 0x43, + 0xE5, 0xA3, 0xAE, 0x43, 0xE5, 0xA3, 0xB0, 0x43, + 0xE5, 0xA3, 0xB2, 0x43, 0xE5, 0xA3, 0xB7, 0x43, + 0xE5, 0xA4, 0x82, 0x43, 0xE5, 0xA4, 0x86, 0x43, + 0xE5, 0xA4, 0x8A, 0x43, 0xE5, 0xA4, 0x95, 0x43, + 0xE5, 0xA4, 0x9A, 0x43, 0xE5, 0xA4, 0x9C, 0x43, + 0xE5, 0xA4, 0xA2, 0x43, 0xE5, 0xA4, 0xA7, 0x43, + // Bytes a00 - a3f + 0xE5, 0xA4, 0xA9, 0x43, 0xE5, 0xA5, 0x84, 0x43, + 0xE5, 0xA5, 0x88, 0x43, 0xE5, 0xA5, 0x91, 0x43, + 0xE5, 0xA5, 0x94, 0x43, 0xE5, 0xA5, 0xA2, 0x43, + 0xE5, 0xA5, 0xB3, 0x43, 0xE5, 0xA7, 0x98, 0x43, + 0xE5, 0xA7, 0xAC, 0x43, 0xE5, 0xA8, 0x9B, 0x43, + 0xE5, 0xA8, 0xA7, 0x43, 0xE5, 0xA9, 0xA2, 0x43, + 0xE5, 0xA9, 0xA6, 0x43, 0xE5, 0xAA, 0xB5, 0x43, + 0xE5, 0xAC, 0x88, 0x43, 0xE5, 0xAC, 0xA8, 0x43, + // Bytes a40 - a7f + 0xE5, 0xAC, 0xBE, 0x43, 0xE5, 0xAD, 0x90, 0x43, + 0xE5, 0xAD, 0x97, 0x43, 0xE5, 0xAD, 0xA6, 0x43, + 0xE5, 0xAE, 0x80, 0x43, 0xE5, 0xAE, 0x85, 0x43, + 0xE5, 0xAE, 0x97, 0x43, 0xE5, 0xAF, 0x83, 0x43, + 0xE5, 0xAF, 0x98, 0x43, 0xE5, 0xAF, 0xA7, 0x43, + 0xE5, 0xAF, 0xAE, 0x43, 0xE5, 0xAF, 0xB3, 0x43, + 0xE5, 0xAF, 0xB8, 0x43, 0xE5, 0xAF, 0xBF, 0x43, + 0xE5, 0xB0, 0x86, 0x43, 0xE5, 0xB0, 0x8F, 0x43, + // Bytes a80 - abf + 0xE5, 0xB0, 0xA2, 0x43, 0xE5, 0xB0, 0xB8, 0x43, + 0xE5, 0xB0, 0xBF, 0x43, 0xE5, 0xB1, 0xA0, 0x43, + 0xE5, 0xB1, 0xA2, 0x43, 0xE5, 0xB1, 0xA4, 0x43, + 0xE5, 0xB1, 0xA5, 0x43, 0xE5, 0xB1, 0xAE, 0x43, + 0xE5, 0xB1, 0xB1, 0x43, 0xE5, 0xB2, 0x8D, 0x43, + 0xE5, 0xB3, 0x80, 0x43, 0xE5, 0xB4, 0x99, 0x43, + 0xE5, 0xB5, 0x83, 0x43, 0xE5, 0xB5, 0x90, 0x43, + 0xE5, 0xB5, 0xAB, 0x43, 0xE5, 0xB5, 0xAE, 0x43, + // Bytes ac0 - aff + 0xE5, 0xB5, 0xBC, 0x43, 0xE5, 0xB6, 0xB2, 0x43, + 0xE5, 0xB6, 0xBA, 0x43, 0xE5, 0xB7, 0x9B, 0x43, + 0xE5, 0xB7, 0xA1, 0x43, 0xE5, 0xB7, 0xA2, 0x43, + 0xE5, 0xB7, 0xA5, 0x43, 0xE5, 0xB7, 0xA6, 0x43, + 0xE5, 0xB7, 0xB1, 0x43, 0xE5, 0xB7, 0xBD, 0x43, + 0xE5, 0xB7, 0xBE, 0x43, 0xE5, 0xB8, 0xA8, 0x43, + 0xE5, 0xB8, 0xBD, 0x43, 0xE5, 0xB9, 0xA9, 0x43, + 0xE5, 0xB9, 0xB2, 0x43, 0xE5, 0xB9, 0xB4, 0x43, + // Bytes b00 - b3f + 0xE5, 0xB9, 0xBA, 0x43, 0xE5, 0xB9, 0xBC, 0x43, + 0xE5, 0xB9, 0xBF, 0x43, 0xE5, 0xBA, 0xA6, 0x43, + 0xE5, 0xBA, 0xB0, 0x43, 0xE5, 0xBA, 0xB3, 0x43, + 0xE5, 0xBA, 0xB6, 0x43, 0xE5, 0xBB, 0x89, 0x43, + 0xE5, 0xBB, 0x8A, 0x43, 0xE5, 0xBB, 0x92, 0x43, + 0xE5, 0xBB, 0x93, 0x43, 0xE5, 0xBB, 0x99, 0x43, + 0xE5, 0xBB, 0xAC, 0x43, 0xE5, 0xBB, 0xB4, 0x43, + 0xE5, 0xBB, 0xBE, 0x43, 0xE5, 0xBC, 0x84, 0x43, + // Bytes b40 - b7f + 0xE5, 0xBC, 0x8B, 0x43, 0xE5, 0xBC, 0x93, 0x43, + 0xE5, 0xBC, 0xA2, 0x43, 0xE5, 0xBD, 0x90, 0x43, + 0xE5, 0xBD, 0x93, 0x43, 0xE5, 0xBD, 0xA1, 0x43, + 0xE5, 0xBD, 0xA2, 0x43, 0xE5, 0xBD, 0xA9, 0x43, + 0xE5, 0xBD, 0xAB, 0x43, 0xE5, 0xBD, 0xB3, 0x43, + 0xE5, 0xBE, 0x8B, 0x43, 0xE5, 0xBE, 0x8C, 0x43, + 0xE5, 0xBE, 0x97, 0x43, 0xE5, 0xBE, 0x9A, 0x43, + 0xE5, 0xBE, 0xA9, 0x43, 0xE5, 0xBE, 0xAD, 0x43, + // Bytes b80 - bbf + 0xE5, 0xBF, 0x83, 0x43, 0xE5, 0xBF, 0x8D, 0x43, + 0xE5, 0xBF, 0x97, 0x43, 0xE5, 0xBF, 0xB5, 0x43, + 0xE5, 0xBF, 0xB9, 0x43, 0xE6, 0x80, 0x92, 0x43, + 0xE6, 0x80, 0x9C, 0x43, 0xE6, 0x81, 0xB5, 0x43, + 0xE6, 0x82, 0x81, 0x43, 0xE6, 0x82, 0x94, 0x43, + 0xE6, 0x83, 0x87, 0x43, 0xE6, 0x83, 0x98, 0x43, + 0xE6, 0x83, 0xA1, 0x43, 0xE6, 0x84, 0x88, 0x43, + 0xE6, 0x85, 0x84, 0x43, 0xE6, 0x85, 0x88, 0x43, + // Bytes bc0 - bff + 0xE6, 0x85, 0x8C, 0x43, 0xE6, 0x85, 0x8E, 0x43, + 0xE6, 0x85, 0xA0, 0x43, 0xE6, 0x85, 0xA8, 0x43, + 0xE6, 0x85, 0xBA, 0x43, 0xE6, 0x86, 0x8E, 0x43, + 0xE6, 0x86, 0x90, 0x43, 0xE6, 0x86, 0xA4, 0x43, + 0xE6, 0x86, 0xAF, 0x43, 0xE6, 0x86, 0xB2, 0x43, + 0xE6, 0x87, 0x9E, 0x43, 0xE6, 0x87, 0xB2, 0x43, + 0xE6, 0x87, 0xB6, 0x43, 0xE6, 0x88, 0x80, 0x43, + 0xE6, 0x88, 0x88, 0x43, 0xE6, 0x88, 0x90, 0x43, + // Bytes c00 - c3f + 0xE6, 0x88, 0x9B, 0x43, 0xE6, 0x88, 0xAE, 0x43, + 0xE6, 0x88, 0xB4, 0x43, 0xE6, 0x88, 0xB6, 0x43, + 0xE6, 0x89, 0x8B, 0x43, 0xE6, 0x89, 0x93, 0x43, + 0xE6, 0x89, 0x9D, 0x43, 0xE6, 0x8A, 0x95, 0x43, + 0xE6, 0x8A, 0xB1, 0x43, 0xE6, 0x8B, 0x89, 0x43, + 0xE6, 0x8B, 0x8F, 0x43, 0xE6, 0x8B, 0x93, 0x43, + 0xE6, 0x8B, 0x94, 0x43, 0xE6, 0x8B, 0xBC, 0x43, + 0xE6, 0x8B, 0xBE, 0x43, 0xE6, 0x8C, 0x87, 0x43, + // Bytes c40 - c7f + 0xE6, 0x8C, 0xBD, 0x43, 0xE6, 0x8D, 0x90, 0x43, + 0xE6, 0x8D, 0x95, 0x43, 0xE6, 0x8D, 0xA8, 0x43, + 0xE6, 0x8D, 0xBB, 0x43, 0xE6, 0x8E, 0x83, 0x43, + 0xE6, 0x8E, 0xA0, 0x43, 0xE6, 0x8E, 0xA9, 0x43, + 0xE6, 0x8F, 0x84, 0x43, 0xE6, 0x8F, 0x85, 0x43, + 0xE6, 0x8F, 0xA4, 0x43, 0xE6, 0x90, 0x9C, 0x43, + 0xE6, 0x90, 0xA2, 0x43, 0xE6, 0x91, 0x92, 0x43, + 0xE6, 0x91, 0xA9, 0x43, 0xE6, 0x91, 0xB7, 0x43, + // Bytes c80 - cbf + 0xE6, 0x91, 0xBE, 0x43, 0xE6, 0x92, 0x9A, 0x43, + 0xE6, 0x92, 0x9D, 0x43, 0xE6, 0x93, 0x84, 0x43, + 0xE6, 0x94, 0xAF, 0x43, 0xE6, 0x94, 0xB4, 0x43, + 0xE6, 0x95, 0x8F, 0x43, 0xE6, 0x95, 0x96, 0x43, + 0xE6, 0x95, 0xAC, 0x43, 0xE6, 0x95, 0xB8, 0x43, + 0xE6, 0x96, 0x87, 0x43, 0xE6, 0x96, 0x97, 0x43, + 0xE6, 0x96, 0x99, 0x43, 0xE6, 0x96, 0xA4, 0x43, + 0xE6, 0x96, 0xB0, 0x43, 0xE6, 0x96, 0xB9, 0x43, + // Bytes cc0 - cff + 0xE6, 0x97, 0x85, 0x43, 0xE6, 0x97, 0xA0, 0x43, + 0xE6, 0x97, 0xA2, 0x43, 0xE6, 0x97, 0xA3, 0x43, + 0xE6, 0x97, 0xA5, 0x43, 0xE6, 0x98, 0x93, 0x43, + 0xE6, 0x98, 0xA0, 0x43, 0xE6, 0x99, 0x89, 0x43, + 0xE6, 0x99, 0xB4, 0x43, 0xE6, 0x9A, 0x88, 0x43, + 0xE6, 0x9A, 0x91, 0x43, 0xE6, 0x9A, 0x9C, 0x43, + 0xE6, 0x9A, 0xB4, 0x43, 0xE6, 0x9B, 0x86, 0x43, + 0xE6, 0x9B, 0xB0, 0x43, 0xE6, 0x9B, 0xB4, 0x43, + // Bytes d00 - d3f + 0xE6, 0x9B, 0xB8, 0x43, 0xE6, 0x9C, 0x80, 0x43, + 0xE6, 0x9C, 0x88, 0x43, 0xE6, 0x9C, 0x89, 0x43, + 0xE6, 0x9C, 0x97, 0x43, 0xE6, 0x9C, 0x9B, 0x43, + 0xE6, 0x9C, 0xA1, 0x43, 0xE6, 0x9C, 0xA8, 0x43, + 0xE6, 0x9D, 0x8E, 0x43, 0xE6, 0x9D, 0x93, 0x43, + 0xE6, 0x9D, 0x96, 0x43, 0xE6, 0x9D, 0x9E, 0x43, + 0xE6, 0x9D, 0xBB, 0x43, 0xE6, 0x9E, 0x85, 0x43, + 0xE6, 0x9E, 0x97, 0x43, 0xE6, 0x9F, 0xB3, 0x43, + // Bytes d40 - d7f + 0xE6, 0x9F, 0xBA, 0x43, 0xE6, 0xA0, 0x97, 0x43, + 0xE6, 0xA0, 0x9F, 0x43, 0xE6, 0xA0, 0xAA, 0x43, + 0xE6, 0xA1, 0x92, 0x43, 0xE6, 0xA2, 0x81, 0x43, + 0xE6, 0xA2, 0x85, 0x43, 0xE6, 0xA2, 0x8E, 0x43, + 0xE6, 0xA2, 0xA8, 0x43, 0xE6, 0xA4, 0x94, 0x43, + 0xE6, 0xA5, 0x82, 0x43, 0xE6, 0xA6, 0xA3, 0x43, + 0xE6, 0xA7, 0xAA, 0x43, 0xE6, 0xA8, 0x82, 0x43, + 0xE6, 0xA8, 0x93, 0x43, 0xE6, 0xAA, 0xA8, 0x43, + // Bytes d80 - dbf + 0xE6, 0xAB, 0x93, 0x43, 0xE6, 0xAB, 0x9B, 0x43, + 0xE6, 0xAC, 0x84, 0x43, 0xE6, 0xAC, 0xA0, 0x43, + 0xE6, 0xAC, 0xA1, 0x43, 0xE6, 0xAD, 0x94, 0x43, + 0xE6, 0xAD, 0xA2, 0x43, 0xE6, 0xAD, 0xA3, 0x43, + 0xE6, 0xAD, 0xB2, 0x43, 0xE6, 0xAD, 0xB7, 0x43, + 0xE6, 0xAD, 0xB9, 0x43, 0xE6, 0xAE, 0x9F, 0x43, + 0xE6, 0xAE, 0xAE, 0x43, 0xE6, 0xAE, 0xB3, 0x43, + 0xE6, 0xAE, 0xBA, 0x43, 0xE6, 0xAE, 0xBB, 0x43, + // Bytes dc0 - dff + 0xE6, 0xAF, 0x8B, 0x43, 0xE6, 0xAF, 0x8D, 0x43, + 0xE6, 0xAF, 0x94, 0x43, 0xE6, 0xAF, 0x9B, 0x43, + 0xE6, 0xB0, 0x8F, 0x43, 0xE6, 0xB0, 0x94, 0x43, + 0xE6, 0xB0, 0xB4, 0x43, 0xE6, 0xB1, 0x8E, 0x43, + 0xE6, 0xB1, 0xA7, 0x43, 0xE6, 0xB2, 0x88, 0x43, + 0xE6, 0xB2, 0xBF, 0x43, 0xE6, 0xB3, 0x8C, 0x43, + 0xE6, 0xB3, 0x8D, 0x43, 0xE6, 0xB3, 0xA5, 0x43, + 0xE6, 0xB3, 0xA8, 0x43, 0xE6, 0xB4, 0x96, 0x43, + // Bytes e00 - e3f + 0xE6, 0xB4, 0x9B, 0x43, 0xE6, 0xB4, 0x9E, 0x43, + 0xE6, 0xB4, 0xB4, 0x43, 0xE6, 0xB4, 0xBE, 0x43, + 0xE6, 0xB5, 0x81, 0x43, 0xE6, 0xB5, 0xA9, 0x43, + 0xE6, 0xB5, 0xAA, 0x43, 0xE6, 0xB5, 0xB7, 0x43, + 0xE6, 0xB5, 0xB8, 0x43, 0xE6, 0xB6, 0x85, 0x43, + 0xE6, 0xB7, 0x8B, 0x43, 0xE6, 0xB7, 0x9A, 0x43, + 0xE6, 0xB7, 0xAA, 0x43, 0xE6, 0xB7, 0xB9, 0x43, + 0xE6, 0xB8, 0x9A, 0x43, 0xE6, 0xB8, 0xAF, 0x43, + // Bytes e40 - e7f + 0xE6, 0xB9, 0xAE, 0x43, 0xE6, 0xBA, 0x80, 0x43, + 0xE6, 0xBA, 0x9C, 0x43, 0xE6, 0xBA, 0xBA, 0x43, + 0xE6, 0xBB, 0x87, 0x43, 0xE6, 0xBB, 0x8B, 0x43, + 0xE6, 0xBB, 0x91, 0x43, 0xE6, 0xBB, 0x9B, 0x43, + 0xE6, 0xBC, 0x8F, 0x43, 0xE6, 0xBC, 0x94, 0x43, + 0xE6, 0xBC, 0xA2, 0x43, 0xE6, 0xBC, 0xA3, 0x43, + 0xE6, 0xBD, 0xAE, 0x43, 0xE6, 0xBF, 0x86, 0x43, + 0xE6, 0xBF, 0xAB, 0x43, 0xE6, 0xBF, 0xBE, 0x43, + // Bytes e80 - ebf + 0xE7, 0x80, 0x9B, 0x43, 0xE7, 0x80, 0x9E, 0x43, + 0xE7, 0x80, 0xB9, 0x43, 0xE7, 0x81, 0x8A, 0x43, + 0xE7, 0x81, 0xAB, 0x43, 0xE7, 0x81, 0xB0, 0x43, + 0xE7, 0x81, 0xB7, 0x43, 0xE7, 0x81, 0xBD, 0x43, + 0xE7, 0x82, 0x99, 0x43, 0xE7, 0x82, 0xAD, 0x43, + 0xE7, 0x83, 0x88, 0x43, 0xE7, 0x83, 0x99, 0x43, + 0xE7, 0x84, 0xA1, 0x43, 0xE7, 0x85, 0x85, 0x43, + 0xE7, 0x85, 0x89, 0x43, 0xE7, 0x85, 0xAE, 0x43, + // Bytes ec0 - eff + 0xE7, 0x86, 0x9C, 0x43, 0xE7, 0x87, 0x8E, 0x43, + 0xE7, 0x87, 0x90, 0x43, 0xE7, 0x88, 0x90, 0x43, + 0xE7, 0x88, 0x9B, 0x43, 0xE7, 0x88, 0xA8, 0x43, + 0xE7, 0x88, 0xAA, 0x43, 0xE7, 0x88, 0xAB, 0x43, + 0xE7, 0x88, 0xB5, 0x43, 0xE7, 0x88, 0xB6, 0x43, + 0xE7, 0x88, 0xBB, 0x43, 0xE7, 0x88, 0xBF, 0x43, + 0xE7, 0x89, 0x87, 0x43, 0xE7, 0x89, 0x90, 0x43, + 0xE7, 0x89, 0x99, 0x43, 0xE7, 0x89, 0x9B, 0x43, + // Bytes f00 - f3f + 0xE7, 0x89, 0xA2, 0x43, 0xE7, 0x89, 0xB9, 0x43, + 0xE7, 0x8A, 0x80, 0x43, 0xE7, 0x8A, 0x95, 0x43, + 0xE7, 0x8A, 0xAC, 0x43, 0xE7, 0x8A, 0xAF, 0x43, + 0xE7, 0x8B, 0x80, 0x43, 0xE7, 0x8B, 0xBC, 0x43, + 0xE7, 0x8C, 0xAA, 0x43, 0xE7, 0x8D, 0xB5, 0x43, + 0xE7, 0x8D, 0xBA, 0x43, 0xE7, 0x8E, 0x84, 0x43, + 0xE7, 0x8E, 0x87, 0x43, 0xE7, 0x8E, 0x89, 0x43, + 0xE7, 0x8E, 0x8B, 0x43, 0xE7, 0x8E, 0xA5, 0x43, + // Bytes f40 - f7f + 0xE7, 0x8E, 0xB2, 0x43, 0xE7, 0x8F, 0x9E, 0x43, + 0xE7, 0x90, 0x86, 0x43, 0xE7, 0x90, 0x89, 0x43, + 0xE7, 0x90, 0xA2, 0x43, 0xE7, 0x91, 0x87, 0x43, + 0xE7, 0x91, 0x9C, 0x43, 0xE7, 0x91, 0xA9, 0x43, + 0xE7, 0x91, 0xB1, 0x43, 0xE7, 0x92, 0x85, 0x43, + 0xE7, 0x92, 0x89, 0x43, 0xE7, 0x92, 0x98, 0x43, + 0xE7, 0x93, 0x8A, 0x43, 0xE7, 0x93, 0x9C, 0x43, + 0xE7, 0x93, 0xA6, 0x43, 0xE7, 0x94, 0x86, 0x43, + // Bytes f80 - fbf + 0xE7, 0x94, 0x98, 0x43, 0xE7, 0x94, 0x9F, 0x43, + 0xE7, 0x94, 0xA4, 0x43, 0xE7, 0x94, 0xA8, 0x43, + 0xE7, 0x94, 0xB0, 0x43, 0xE7, 0x94, 0xB2, 0x43, + 0xE7, 0x94, 0xB3, 0x43, 0xE7, 0x94, 0xB7, 0x43, + 0xE7, 0x94, 0xBB, 0x43, 0xE7, 0x94, 0xBE, 0x43, + 0xE7, 0x95, 0x99, 0x43, 0xE7, 0x95, 0xA5, 0x43, + 0xE7, 0x95, 0xB0, 0x43, 0xE7, 0x96, 0x8B, 0x43, + 0xE7, 0x96, 0x92, 0x43, 0xE7, 0x97, 0xA2, 0x43, + // Bytes fc0 - fff + 0xE7, 0x98, 0x90, 0x43, 0xE7, 0x98, 0x9D, 0x43, + 0xE7, 0x98, 0x9F, 0x43, 0xE7, 0x99, 0x82, 0x43, + 0xE7, 0x99, 0xA9, 0x43, 0xE7, 0x99, 0xB6, 0x43, + 0xE7, 0x99, 0xBD, 0x43, 0xE7, 0x9A, 0xAE, 0x43, + 0xE7, 0x9A, 0xBF, 0x43, 0xE7, 0x9B, 0x8A, 0x43, + 0xE7, 0x9B, 0x9B, 0x43, 0xE7, 0x9B, 0xA3, 0x43, + 0xE7, 0x9B, 0xA7, 0x43, 0xE7, 0x9B, 0xAE, 0x43, + 0xE7, 0x9B, 0xB4, 0x43, 0xE7, 0x9C, 0x81, 0x43, + // Bytes 1000 - 103f + 0xE7, 0x9C, 0x9E, 0x43, 0xE7, 0x9C, 0x9F, 0x43, + 0xE7, 0x9D, 0x80, 0x43, 0xE7, 0x9D, 0x8A, 0x43, + 0xE7, 0x9E, 0x8B, 0x43, 0xE7, 0x9E, 0xA7, 0x43, + 0xE7, 0x9F, 0x9B, 0x43, 0xE7, 0x9F, 0xA2, 0x43, + 0xE7, 0x9F, 0xB3, 0x43, 0xE7, 0xA1, 0x8E, 0x43, + 0xE7, 0xA1, 0xAB, 0x43, 0xE7, 0xA2, 0x8C, 0x43, + 0xE7, 0xA2, 0x91, 0x43, 0xE7, 0xA3, 0x8A, 0x43, + 0xE7, 0xA3, 0x8C, 0x43, 0xE7, 0xA3, 0xBB, 0x43, + // Bytes 1040 - 107f + 0xE7, 0xA4, 0xAA, 0x43, 0xE7, 0xA4, 0xBA, 0x43, + 0xE7, 0xA4, 0xBC, 0x43, 0xE7, 0xA4, 0xBE, 0x43, + 0xE7, 0xA5, 0x88, 0x43, 0xE7, 0xA5, 0x89, 0x43, + 0xE7, 0xA5, 0x90, 0x43, 0xE7, 0xA5, 0x96, 0x43, + 0xE7, 0xA5, 0x9D, 0x43, 0xE7, 0xA5, 0x9E, 0x43, + 0xE7, 0xA5, 0xA5, 0x43, 0xE7, 0xA5, 0xBF, 0x43, + 0xE7, 0xA6, 0x81, 0x43, 0xE7, 0xA6, 0x8D, 0x43, + 0xE7, 0xA6, 0x8E, 0x43, 0xE7, 0xA6, 0x8F, 0x43, + // Bytes 1080 - 10bf + 0xE7, 0xA6, 0xAE, 0x43, 0xE7, 0xA6, 0xB8, 0x43, + 0xE7, 0xA6, 0xBE, 0x43, 0xE7, 0xA7, 0x8A, 0x43, + 0xE7, 0xA7, 0x98, 0x43, 0xE7, 0xA7, 0xAB, 0x43, + 0xE7, 0xA8, 0x9C, 0x43, 0xE7, 0xA9, 0x80, 0x43, + 0xE7, 0xA9, 0x8A, 0x43, 0xE7, 0xA9, 0x8F, 0x43, + 0xE7, 0xA9, 0xB4, 0x43, 0xE7, 0xA9, 0xBA, 0x43, + 0xE7, 0xAA, 0x81, 0x43, 0xE7, 0xAA, 0xB1, 0x43, + 0xE7, 0xAB, 0x8B, 0x43, 0xE7, 0xAB, 0xAE, 0x43, + // Bytes 10c0 - 10ff + 0xE7, 0xAB, 0xB9, 0x43, 0xE7, 0xAC, 0xA0, 0x43, + 0xE7, 0xAE, 0x8F, 0x43, 0xE7, 0xAF, 0x80, 0x43, + 0xE7, 0xAF, 0x86, 0x43, 0xE7, 0xAF, 0x89, 0x43, + 0xE7, 0xB0, 0xBE, 0x43, 0xE7, 0xB1, 0xA0, 0x43, + 0xE7, 0xB1, 0xB3, 0x43, 0xE7, 0xB1, 0xBB, 0x43, + 0xE7, 0xB2, 0x92, 0x43, 0xE7, 0xB2, 0xBE, 0x43, + 0xE7, 0xB3, 0x92, 0x43, 0xE7, 0xB3, 0x96, 0x43, + 0xE7, 0xB3, 0xA3, 0x43, 0xE7, 0xB3, 0xA7, 0x43, + // Bytes 1100 - 113f + 0xE7, 0xB3, 0xA8, 0x43, 0xE7, 0xB3, 0xB8, 0x43, + 0xE7, 0xB4, 0x80, 0x43, 0xE7, 0xB4, 0x90, 0x43, + 0xE7, 0xB4, 0xA2, 0x43, 0xE7, 0xB4, 0xAF, 0x43, + 0xE7, 0xB5, 0x82, 0x43, 0xE7, 0xB5, 0x9B, 0x43, + 0xE7, 0xB5, 0xA3, 0x43, 0xE7, 0xB6, 0xA0, 0x43, + 0xE7, 0xB6, 0xBE, 0x43, 0xE7, 0xB7, 0x87, 0x43, + 0xE7, 0xB7, 0xB4, 0x43, 0xE7, 0xB8, 0x82, 0x43, + 0xE7, 0xB8, 0x89, 0x43, 0xE7, 0xB8, 0xB7, 0x43, + // Bytes 1140 - 117f + 0xE7, 0xB9, 0x81, 0x43, 0xE7, 0xB9, 0x85, 0x43, + 0xE7, 0xBC, 0xB6, 0x43, 0xE7, 0xBC, 0xBE, 0x43, + 0xE7, 0xBD, 0x91, 0x43, 0xE7, 0xBD, 0xB2, 0x43, + 0xE7, 0xBD, 0xB9, 0x43, 0xE7, 0xBD, 0xBA, 0x43, + 0xE7, 0xBE, 0x85, 0x43, 0xE7, 0xBE, 0x8A, 0x43, + 0xE7, 0xBE, 0x95, 0x43, 0xE7, 0xBE, 0x9A, 0x43, + 0xE7, 0xBE, 0xBD, 0x43, 0xE7, 0xBF, 0xBA, 0x43, + 0xE8, 0x80, 0x81, 0x43, 0xE8, 0x80, 0x85, 0x43, + // Bytes 1180 - 11bf + 0xE8, 0x80, 0x8C, 0x43, 0xE8, 0x80, 0x92, 0x43, + 0xE8, 0x80, 0xB3, 0x43, 0xE8, 0x81, 0x86, 0x43, + 0xE8, 0x81, 0xA0, 0x43, 0xE8, 0x81, 0xAF, 0x43, + 0xE8, 0x81, 0xB0, 0x43, 0xE8, 0x81, 0xBE, 0x43, + 0xE8, 0x81, 0xBF, 0x43, 0xE8, 0x82, 0x89, 0x43, + 0xE8, 0x82, 0x8B, 0x43, 0xE8, 0x82, 0xAD, 0x43, + 0xE8, 0x82, 0xB2, 0x43, 0xE8, 0x84, 0x83, 0x43, + 0xE8, 0x84, 0xBE, 0x43, 0xE8, 0x87, 0x98, 0x43, + // Bytes 11c0 - 11ff + 0xE8, 0x87, 0xA3, 0x43, 0xE8, 0x87, 0xA8, 0x43, + 0xE8, 0x87, 0xAA, 0x43, 0xE8, 0x87, 0xAD, 0x43, + 0xE8, 0x87, 0xB3, 0x43, 0xE8, 0x87, 0xBC, 0x43, + 0xE8, 0x88, 0x81, 0x43, 0xE8, 0x88, 0x84, 0x43, + 0xE8, 0x88, 0x8C, 0x43, 0xE8, 0x88, 0x98, 0x43, + 0xE8, 0x88, 0x9B, 0x43, 0xE8, 0x88, 0x9F, 0x43, + 0xE8, 0x89, 0xAE, 0x43, 0xE8, 0x89, 0xAF, 0x43, + 0xE8, 0x89, 0xB2, 0x43, 0xE8, 0x89, 0xB8, 0x43, + // Bytes 1200 - 123f + 0xE8, 0x89, 0xB9, 0x43, 0xE8, 0x8A, 0x8B, 0x43, + 0xE8, 0x8A, 0x91, 0x43, 0xE8, 0x8A, 0x9D, 0x43, + 0xE8, 0x8A, 0xB1, 0x43, 0xE8, 0x8A, 0xB3, 0x43, + 0xE8, 0x8A, 0xBD, 0x43, 0xE8, 0x8B, 0xA5, 0x43, + 0xE8, 0x8B, 0xA6, 0x43, 0xE8, 0x8C, 0x9D, 0x43, + 0xE8, 0x8C, 0xA3, 0x43, 0xE8, 0x8C, 0xB6, 0x43, + 0xE8, 0x8D, 0x92, 0x43, 0xE8, 0x8D, 0x93, 0x43, + 0xE8, 0x8D, 0xA3, 0x43, 0xE8, 0x8E, 0xAD, 0x43, + // Bytes 1240 - 127f + 0xE8, 0x8E, 0xBD, 0x43, 0xE8, 0x8F, 0x89, 0x43, + 0xE8, 0x8F, 0x8A, 0x43, 0xE8, 0x8F, 0x8C, 0x43, + 0xE8, 0x8F, 0x9C, 0x43, 0xE8, 0x8F, 0xA7, 0x43, + 0xE8, 0x8F, 0xAF, 0x43, 0xE8, 0x8F, 0xB1, 0x43, + 0xE8, 0x90, 0xBD, 0x43, 0xE8, 0x91, 0x89, 0x43, + 0xE8, 0x91, 0x97, 0x43, 0xE8, 0x93, 0xAE, 0x43, + 0xE8, 0x93, 0xB1, 0x43, 0xE8, 0x93, 0xB3, 0x43, + 0xE8, 0x93, 0xBC, 0x43, 0xE8, 0x94, 0x96, 0x43, + // Bytes 1280 - 12bf + 0xE8, 0x95, 0xA4, 0x43, 0xE8, 0x97, 0x8D, 0x43, + 0xE8, 0x97, 0xBA, 0x43, 0xE8, 0x98, 0x86, 0x43, + 0xE8, 0x98, 0x92, 0x43, 0xE8, 0x98, 0xAD, 0x43, + 0xE8, 0x98, 0xBF, 0x43, 0xE8, 0x99, 0x8D, 0x43, + 0xE8, 0x99, 0x90, 0x43, 0xE8, 0x99, 0x9C, 0x43, + 0xE8, 0x99, 0xA7, 0x43, 0xE8, 0x99, 0xA9, 0x43, + 0xE8, 0x99, 0xAB, 0x43, 0xE8, 0x9A, 0x88, 0x43, + 0xE8, 0x9A, 0xA9, 0x43, 0xE8, 0x9B, 0xA2, 0x43, + // Bytes 12c0 - 12ff + 0xE8, 0x9C, 0x8E, 0x43, 0xE8, 0x9C, 0xA8, 0x43, + 0xE8, 0x9D, 0xAB, 0x43, 0xE8, 0x9D, 0xB9, 0x43, + 0xE8, 0x9E, 0x86, 0x43, 0xE8, 0x9E, 0xBA, 0x43, + 0xE8, 0x9F, 0xA1, 0x43, 0xE8, 0xA0, 0x81, 0x43, + 0xE8, 0xA0, 0x9F, 0x43, 0xE8, 0xA1, 0x80, 0x43, + 0xE8, 0xA1, 0x8C, 0x43, 0xE8, 0xA1, 0xA0, 0x43, + 0xE8, 0xA1, 0xA3, 0x43, 0xE8, 0xA3, 0x82, 0x43, + 0xE8, 0xA3, 0x8F, 0x43, 0xE8, 0xA3, 0x97, 0x43, + // Bytes 1300 - 133f + 0xE8, 0xA3, 0x9E, 0x43, 0xE8, 0xA3, 0xA1, 0x43, + 0xE8, 0xA3, 0xB8, 0x43, 0xE8, 0xA3, 0xBA, 0x43, + 0xE8, 0xA4, 0x90, 0x43, 0xE8, 0xA5, 0x81, 0x43, + 0xE8, 0xA5, 0xA4, 0x43, 0xE8, 0xA5, 0xBE, 0x43, + 0xE8, 0xA6, 0x86, 0x43, 0xE8, 0xA6, 0x8B, 0x43, + 0xE8, 0xA6, 0x96, 0x43, 0xE8, 0xA7, 0x92, 0x43, + 0xE8, 0xA7, 0xA3, 0x43, 0xE8, 0xA8, 0x80, 0x43, + 0xE8, 0xAA, 0xA0, 0x43, 0xE8, 0xAA, 0xAA, 0x43, + // Bytes 1340 - 137f + 0xE8, 0xAA, 0xBF, 0x43, 0xE8, 0xAB, 0x8B, 0x43, + 0xE8, 0xAB, 0x92, 0x43, 0xE8, 0xAB, 0x96, 0x43, + 0xE8, 0xAB, 0xAD, 0x43, 0xE8, 0xAB, 0xB8, 0x43, + 0xE8, 0xAB, 0xBE, 0x43, 0xE8, 0xAC, 0x81, 0x43, + 0xE8, 0xAC, 0xB9, 0x43, 0xE8, 0xAD, 0x98, 0x43, + 0xE8, 0xAE, 0x80, 0x43, 0xE8, 0xAE, 0x8A, 0x43, + 0xE8, 0xB0, 0xB7, 0x43, 0xE8, 0xB1, 0x86, 0x43, + 0xE8, 0xB1, 0x88, 0x43, 0xE8, 0xB1, 0x95, 0x43, + // Bytes 1380 - 13bf + 0xE8, 0xB1, 0xB8, 0x43, 0xE8, 0xB2, 0x9D, 0x43, + 0xE8, 0xB2, 0xA1, 0x43, 0xE8, 0xB2, 0xA9, 0x43, + 0xE8, 0xB2, 0xAB, 0x43, 0xE8, 0xB3, 0x81, 0x43, + 0xE8, 0xB3, 0x82, 0x43, 0xE8, 0xB3, 0x87, 0x43, + 0xE8, 0xB3, 0x88, 0x43, 0xE8, 0xB3, 0x93, 0x43, + 0xE8, 0xB4, 0x88, 0x43, 0xE8, 0xB4, 0x9B, 0x43, + 0xE8, 0xB5, 0xA4, 0x43, 0xE8, 0xB5, 0xB0, 0x43, + 0xE8, 0xB5, 0xB7, 0x43, 0xE8, 0xB6, 0xB3, 0x43, + // Bytes 13c0 - 13ff + 0xE8, 0xB6, 0xBC, 0x43, 0xE8, 0xB7, 0x8B, 0x43, + 0xE8, 0xB7, 0xAF, 0x43, 0xE8, 0xB7, 0xB0, 0x43, + 0xE8, 0xBA, 0xAB, 0x43, 0xE8, 0xBB, 0x8A, 0x43, + 0xE8, 0xBB, 0x94, 0x43, 0xE8, 0xBC, 0xA6, 0x43, + 0xE8, 0xBC, 0xAA, 0x43, 0xE8, 0xBC, 0xB8, 0x43, + 0xE8, 0xBC, 0xBB, 0x43, 0xE8, 0xBD, 0xA2, 0x43, + 0xE8, 0xBE, 0x9B, 0x43, 0xE8, 0xBE, 0x9E, 0x43, + 0xE8, 0xBE, 0xB0, 0x43, 0xE8, 0xBE, 0xB5, 0x43, + // Bytes 1400 - 143f + 0xE8, 0xBE, 0xB6, 0x43, 0xE9, 0x80, 0xA3, 0x43, + 0xE9, 0x80, 0xB8, 0x43, 0xE9, 0x81, 0x8A, 0x43, + 0xE9, 0x81, 0xA9, 0x43, 0xE9, 0x81, 0xB2, 0x43, + 0xE9, 0x81, 0xBC, 0x43, 0xE9, 0x82, 0x8F, 0x43, + 0xE9, 0x82, 0x91, 0x43, 0xE9, 0x82, 0x94, 0x43, + 0xE9, 0x83, 0x8E, 0x43, 0xE9, 0x83, 0x9E, 0x43, + 0xE9, 0x83, 0xB1, 0x43, 0xE9, 0x83, 0xBD, 0x43, + 0xE9, 0x84, 0x91, 0x43, 0xE9, 0x84, 0x9B, 0x43, + // Bytes 1440 - 147f + 0xE9, 0x85, 0x89, 0x43, 0xE9, 0x85, 0x8D, 0x43, + 0xE9, 0x85, 0xAA, 0x43, 0xE9, 0x86, 0x99, 0x43, + 0xE9, 0x86, 0xB4, 0x43, 0xE9, 0x87, 0x86, 0x43, + 0xE9, 0x87, 0x8C, 0x43, 0xE9, 0x87, 0x8F, 0x43, + 0xE9, 0x87, 0x91, 0x43, 0xE9, 0x88, 0xB4, 0x43, + 0xE9, 0x88, 0xB8, 0x43, 0xE9, 0x89, 0xB6, 0x43, + 0xE9, 0x89, 0xBC, 0x43, 0xE9, 0x8B, 0x97, 0x43, + 0xE9, 0x8B, 0x98, 0x43, 0xE9, 0x8C, 0x84, 0x43, + // Bytes 1480 - 14bf + 0xE9, 0x8D, 0x8A, 0x43, 0xE9, 0x8F, 0xB9, 0x43, + 0xE9, 0x90, 0x95, 0x43, 0xE9, 0x95, 0xB7, 0x43, + 0xE9, 0x96, 0x80, 0x43, 0xE9, 0x96, 0x8B, 0x43, + 0xE9, 0x96, 0xAD, 0x43, 0xE9, 0x96, 0xB7, 0x43, + 0xE9, 0x98, 0x9C, 0x43, 0xE9, 0x98, 0xAE, 0x43, + 0xE9, 0x99, 0x8B, 0x43, 0xE9, 0x99, 0x8D, 0x43, + 0xE9, 0x99, 0xB5, 0x43, 0xE9, 0x99, 0xB8, 0x43, + 0xE9, 0x99, 0xBC, 0x43, 0xE9, 0x9A, 0x86, 0x43, + // Bytes 14c0 - 14ff + 0xE9, 0x9A, 0xA3, 0x43, 0xE9, 0x9A, 0xB6, 0x43, + 0xE9, 0x9A, 0xB7, 0x43, 0xE9, 0x9A, 0xB8, 0x43, + 0xE9, 0x9A, 0xB9, 0x43, 0xE9, 0x9B, 0x83, 0x43, + 0xE9, 0x9B, 0xA2, 0x43, 0xE9, 0x9B, 0xA3, 0x43, + 0xE9, 0x9B, 0xA8, 0x43, 0xE9, 0x9B, 0xB6, 0x43, + 0xE9, 0x9B, 0xB7, 0x43, 0xE9, 0x9C, 0xA3, 0x43, + 0xE9, 0x9C, 0xB2, 0x43, 0xE9, 0x9D, 0x88, 0x43, + 0xE9, 0x9D, 0x91, 0x43, 0xE9, 0x9D, 0x96, 0x43, + // Bytes 1500 - 153f + 0xE9, 0x9D, 0x9E, 0x43, 0xE9, 0x9D, 0xA2, 0x43, + 0xE9, 0x9D, 0xA9, 0x43, 0xE9, 0x9F, 0x8B, 0x43, + 0xE9, 0x9F, 0x9B, 0x43, 0xE9, 0x9F, 0xA0, 0x43, + 0xE9, 0x9F, 0xAD, 0x43, 0xE9, 0x9F, 0xB3, 0x43, + 0xE9, 0x9F, 0xBF, 0x43, 0xE9, 0xA0, 0x81, 0x43, + 0xE9, 0xA0, 0x85, 0x43, 0xE9, 0xA0, 0x8B, 0x43, + 0xE9, 0xA0, 0x98, 0x43, 0xE9, 0xA0, 0xA9, 0x43, + 0xE9, 0xA0, 0xBB, 0x43, 0xE9, 0xA1, 0x9E, 0x43, + // Bytes 1540 - 157f + 0xE9, 0xA2, 0xA8, 0x43, 0xE9, 0xA3, 0x9B, 0x43, + 0xE9, 0xA3, 0x9F, 0x43, 0xE9, 0xA3, 0xA2, 0x43, + 0xE9, 0xA3, 0xAF, 0x43, 0xE9, 0xA3, 0xBC, 0x43, + 0xE9, 0xA4, 0xA8, 0x43, 0xE9, 0xA4, 0xA9, 0x43, + 0xE9, 0xA6, 0x96, 0x43, 0xE9, 0xA6, 0x99, 0x43, + 0xE9, 0xA6, 0xA7, 0x43, 0xE9, 0xA6, 0xAC, 0x43, + 0xE9, 0xA7, 0x82, 0x43, 0xE9, 0xA7, 0xB1, 0x43, + 0xE9, 0xA7, 0xBE, 0x43, 0xE9, 0xA9, 0xAA, 0x43, + // Bytes 1580 - 15bf + 0xE9, 0xAA, 0xA8, 0x43, 0xE9, 0xAB, 0x98, 0x43, + 0xE9, 0xAB, 0x9F, 0x43, 0xE9, 0xAC, 0x92, 0x43, + 0xE9, 0xAC, 0xA5, 0x43, 0xE9, 0xAC, 0xAF, 0x43, + 0xE9, 0xAC, 0xB2, 0x43, 0xE9, 0xAC, 0xBC, 0x43, + 0xE9, 0xAD, 0x9A, 0x43, 0xE9, 0xAD, 0xAF, 0x43, + 0xE9, 0xB1, 0x80, 0x43, 0xE9, 0xB1, 0x97, 0x43, + 0xE9, 0xB3, 0xA5, 0x43, 0xE9, 0xB3, 0xBD, 0x43, + 0xE9, 0xB5, 0xA7, 0x43, 0xE9, 0xB6, 0xB4, 0x43, + // Bytes 15c0 - 15ff + 0xE9, 0xB7, 0xBA, 0x43, 0xE9, 0xB8, 0x9E, 0x43, + 0xE9, 0xB9, 0xB5, 0x43, 0xE9, 0xB9, 0xBF, 0x43, + 0xE9, 0xBA, 0x97, 0x43, 0xE9, 0xBA, 0x9F, 0x43, + 0xE9, 0xBA, 0xA5, 0x43, 0xE9, 0xBA, 0xBB, 0x43, + 0xE9, 0xBB, 0x83, 0x43, 0xE9, 0xBB, 0x8D, 0x43, + 0xE9, 0xBB, 0x8E, 0x43, 0xE9, 0xBB, 0x91, 0x43, + 0xE9, 0xBB, 0xB9, 0x43, 0xE9, 0xBB, 0xBD, 0x43, + 0xE9, 0xBB, 0xBE, 0x43, 0xE9, 0xBC, 0x85, 0x43, + // Bytes 1600 - 163f + 0xE9, 0xBC, 0x8E, 0x43, 0xE9, 0xBC, 0x8F, 0x43, + 0xE9, 0xBC, 0x93, 0x43, 0xE9, 0xBC, 0x96, 0x43, + 0xE9, 0xBC, 0xA0, 0x43, 0xE9, 0xBC, 0xBB, 0x43, + 0xE9, 0xBD, 0x83, 0x43, 0xE9, 0xBD, 0x8A, 0x43, + 0xE9, 0xBD, 0x92, 0x43, 0xE9, 0xBE, 0x8D, 0x43, + 0xE9, 0xBE, 0x8E, 0x43, 0xE9, 0xBE, 0x9C, 0x43, + 0xE9, 0xBE, 0x9F, 0x43, 0xE9, 0xBE, 0xA0, 0x43, + 0xEA, 0x9C, 0xA7, 0x43, 0xEA, 0x9D, 0xAF, 0x43, + // Bytes 1640 - 167f + 0xEA, 0xAC, 0xB7, 0x43, 0xEA, 0xAD, 0x92, 0x44, + 0xF0, 0xA0, 0x84, 0xA2, 0x44, 0xF0, 0xA0, 0x94, + 0x9C, 0x44, 0xF0, 0xA0, 0x94, 0xA5, 0x44, 0xF0, + 0xA0, 0x95, 0x8B, 0x44, 0xF0, 0xA0, 0x98, 0xBA, + 0x44, 0xF0, 0xA0, 0xA0, 0x84, 0x44, 0xF0, 0xA0, + 0xA3, 0x9E, 0x44, 0xF0, 0xA0, 0xA8, 0xAC, 0x44, + 0xF0, 0xA0, 0xAD, 0xA3, 0x44, 0xF0, 0xA1, 0x93, + 0xA4, 0x44, 0xF0, 0xA1, 0x9A, 0xA8, 0x44, 0xF0, + // Bytes 1680 - 16bf + 0xA1, 0x9B, 0xAA, 0x44, 0xF0, 0xA1, 0xA7, 0x88, + 0x44, 0xF0, 0xA1, 0xAC, 0x98, 0x44, 0xF0, 0xA1, + 0xB4, 0x8B, 0x44, 0xF0, 0xA1, 0xB7, 0xA4, 0x44, + 0xF0, 0xA1, 0xB7, 0xA6, 0x44, 0xF0, 0xA2, 0x86, + 0x83, 0x44, 0xF0, 0xA2, 0x86, 0x9F, 0x44, 0xF0, + 0xA2, 0x8C, 0xB1, 0x44, 0xF0, 0xA2, 0x9B, 0x94, + 0x44, 0xF0, 0xA2, 0xA1, 0x84, 0x44, 0xF0, 0xA2, + 0xA1, 0x8A, 0x44, 0xF0, 0xA2, 0xAC, 0x8C, 0x44, + // Bytes 16c0 - 16ff + 0xF0, 0xA2, 0xAF, 0xB1, 0x44, 0xF0, 0xA3, 0x80, + 0x8A, 0x44, 0xF0, 0xA3, 0x8A, 0xB8, 0x44, 0xF0, + 0xA3, 0x8D, 0x9F, 0x44, 0xF0, 0xA3, 0x8E, 0x93, + 0x44, 0xF0, 0xA3, 0x8E, 0x9C, 0x44, 0xF0, 0xA3, + 0x8F, 0x83, 0x44, 0xF0, 0xA3, 0x8F, 0x95, 0x44, + 0xF0, 0xA3, 0x91, 0xAD, 0x44, 0xF0, 0xA3, 0x9A, + 0xA3, 0x44, 0xF0, 0xA3, 0xA2, 0xA7, 0x44, 0xF0, + 0xA3, 0xAA, 0x8D, 0x44, 0xF0, 0xA3, 0xAB, 0xBA, + // Bytes 1700 - 173f + 0x44, 0xF0, 0xA3, 0xB2, 0xBC, 0x44, 0xF0, 0xA3, + 0xB4, 0x9E, 0x44, 0xF0, 0xA3, 0xBB, 0x91, 0x44, + 0xF0, 0xA3, 0xBD, 0x9E, 0x44, 0xF0, 0xA3, 0xBE, + 0x8E, 0x44, 0xF0, 0xA4, 0x89, 0xA3, 0x44, 0xF0, + 0xA4, 0x8B, 0xAE, 0x44, 0xF0, 0xA4, 0x8E, 0xAB, + 0x44, 0xF0, 0xA4, 0x98, 0x88, 0x44, 0xF0, 0xA4, + 0x9C, 0xB5, 0x44, 0xF0, 0xA4, 0xA0, 0x94, 0x44, + 0xF0, 0xA4, 0xB0, 0xB6, 0x44, 0xF0, 0xA4, 0xB2, + // Bytes 1740 - 177f + 0x92, 0x44, 0xF0, 0xA4, 0xBE, 0xA1, 0x44, 0xF0, + 0xA4, 0xBE, 0xB8, 0x44, 0xF0, 0xA5, 0x81, 0x84, + 0x44, 0xF0, 0xA5, 0x83, 0xB2, 0x44, 0xF0, 0xA5, + 0x83, 0xB3, 0x44, 0xF0, 0xA5, 0x84, 0x99, 0x44, + 0xF0, 0xA5, 0x84, 0xB3, 0x44, 0xF0, 0xA5, 0x89, + 0x89, 0x44, 0xF0, 0xA5, 0x90, 0x9D, 0x44, 0xF0, + 0xA5, 0x98, 0xA6, 0x44, 0xF0, 0xA5, 0x9A, 0x9A, + 0x44, 0xF0, 0xA5, 0x9B, 0x85, 0x44, 0xF0, 0xA5, + // Bytes 1780 - 17bf + 0xA5, 0xBC, 0x44, 0xF0, 0xA5, 0xAA, 0xA7, 0x44, + 0xF0, 0xA5, 0xAE, 0xAB, 0x44, 0xF0, 0xA5, 0xB2, + 0x80, 0x44, 0xF0, 0xA5, 0xB3, 0x90, 0x44, 0xF0, + 0xA5, 0xBE, 0x86, 0x44, 0xF0, 0xA6, 0x87, 0x9A, + 0x44, 0xF0, 0xA6, 0x88, 0xA8, 0x44, 0xF0, 0xA6, + 0x89, 0x87, 0x44, 0xF0, 0xA6, 0x8B, 0x99, 0x44, + 0xF0, 0xA6, 0x8C, 0xBE, 0x44, 0xF0, 0xA6, 0x93, + 0x9A, 0x44, 0xF0, 0xA6, 0x94, 0xA3, 0x44, 0xF0, + // Bytes 17c0 - 17ff + 0xA6, 0x96, 0xA8, 0x44, 0xF0, 0xA6, 0x9E, 0xA7, + 0x44, 0xF0, 0xA6, 0x9E, 0xB5, 0x44, 0xF0, 0xA6, + 0xAC, 0xBC, 0x44, 0xF0, 0xA6, 0xB0, 0xB6, 0x44, + 0xF0, 0xA6, 0xB3, 0x95, 0x44, 0xF0, 0xA6, 0xB5, + 0xAB, 0x44, 0xF0, 0xA6, 0xBC, 0xAC, 0x44, 0xF0, + 0xA6, 0xBE, 0xB1, 0x44, 0xF0, 0xA7, 0x83, 0x92, + 0x44, 0xF0, 0xA7, 0x8F, 0x8A, 0x44, 0xF0, 0xA7, + 0x99, 0xA7, 0x44, 0xF0, 0xA7, 0xA2, 0xAE, 0x44, + // Bytes 1800 - 183f + 0xF0, 0xA7, 0xA5, 0xA6, 0x44, 0xF0, 0xA7, 0xB2, + 0xA8, 0x44, 0xF0, 0xA7, 0xBB, 0x93, 0x44, 0xF0, + 0xA7, 0xBC, 0xAF, 0x44, 0xF0, 0xA8, 0x97, 0x92, + 0x44, 0xF0, 0xA8, 0x97, 0xAD, 0x44, 0xF0, 0xA8, + 0x9C, 0xAE, 0x44, 0xF0, 0xA8, 0xAF, 0xBA, 0x44, + 0xF0, 0xA8, 0xB5, 0xB7, 0x44, 0xF0, 0xA9, 0x85, + 0x85, 0x44, 0xF0, 0xA9, 0x87, 0x9F, 0x44, 0xF0, + 0xA9, 0x88, 0x9A, 0x44, 0xF0, 0xA9, 0x90, 0x8A, + // Bytes 1840 - 187f + 0x44, 0xF0, 0xA9, 0x92, 0x96, 0x44, 0xF0, 0xA9, + 0x96, 0xB6, 0x44, 0xF0, 0xA9, 0xAC, 0xB0, 0x44, + 0xF0, 0xAA, 0x83, 0x8E, 0x44, 0xF0, 0xAA, 0x84, + 0x85, 0x44, 0xF0, 0xAA, 0x88, 0x8E, 0x44, 0xF0, + 0xAA, 0x8A, 0x91, 0x44, 0xF0, 0xAA, 0x8E, 0x92, + 0x44, 0xF0, 0xAA, 0x98, 0x80, 0x42, 0x21, 0x21, + 0x42, 0x21, 0x3F, 0x42, 0x2E, 0x2E, 0x42, 0x30, + 0x2C, 0x42, 0x30, 0x2E, 0x42, 0x31, 0x2C, 0x42, + // Bytes 1880 - 18bf + 0x31, 0x2E, 0x42, 0x31, 0x30, 0x42, 0x31, 0x31, + 0x42, 0x31, 0x32, 0x42, 0x31, 0x33, 0x42, 0x31, + 0x34, 0x42, 0x31, 0x35, 0x42, 0x31, 0x36, 0x42, + 0x31, 0x37, 0x42, 0x31, 0x38, 0x42, 0x31, 0x39, + 0x42, 0x32, 0x2C, 0x42, 0x32, 0x2E, 0x42, 0x32, + 0x30, 0x42, 0x32, 0x31, 0x42, 0x32, 0x32, 0x42, + 0x32, 0x33, 0x42, 0x32, 0x34, 0x42, 0x32, 0x35, + 0x42, 0x32, 0x36, 0x42, 0x32, 0x37, 0x42, 0x32, + // Bytes 18c0 - 18ff + 0x38, 0x42, 0x32, 0x39, 0x42, 0x33, 0x2C, 0x42, + 0x33, 0x2E, 0x42, 0x33, 0x30, 0x42, 0x33, 0x31, + 0x42, 0x33, 0x32, 0x42, 0x33, 0x33, 0x42, 0x33, + 0x34, 0x42, 0x33, 0x35, 0x42, 0x33, 0x36, 0x42, + 0x33, 0x37, 0x42, 0x33, 0x38, 0x42, 0x33, 0x39, + 0x42, 0x34, 0x2C, 0x42, 0x34, 0x2E, 0x42, 0x34, + 0x30, 0x42, 0x34, 0x31, 0x42, 0x34, 0x32, 0x42, + 0x34, 0x33, 0x42, 0x34, 0x34, 0x42, 0x34, 0x35, + // Bytes 1900 - 193f + 0x42, 0x34, 0x36, 0x42, 0x34, 0x37, 0x42, 0x34, + 0x38, 0x42, 0x34, 0x39, 0x42, 0x35, 0x2C, 0x42, + 0x35, 0x2E, 0x42, 0x35, 0x30, 0x42, 0x36, 0x2C, + 0x42, 0x36, 0x2E, 0x42, 0x37, 0x2C, 0x42, 0x37, + 0x2E, 0x42, 0x38, 0x2C, 0x42, 0x38, 0x2E, 0x42, + 0x39, 0x2C, 0x42, 0x39, 0x2E, 0x42, 0x3D, 0x3D, + 0x42, 0x3F, 0x21, 0x42, 0x3F, 0x3F, 0x42, 0x41, + 0x55, 0x42, 0x42, 0x71, 0x42, 0x43, 0x44, 0x42, + // Bytes 1940 - 197f + 0x44, 0x4A, 0x42, 0x44, 0x5A, 0x42, 0x44, 0x7A, + 0x42, 0x47, 0x42, 0x42, 0x47, 0x79, 0x42, 0x48, + 0x50, 0x42, 0x48, 0x56, 0x42, 0x48, 0x67, 0x42, + 0x48, 0x7A, 0x42, 0x49, 0x49, 0x42, 0x49, 0x4A, + 0x42, 0x49, 0x55, 0x42, 0x49, 0x56, 0x42, 0x49, + 0x58, 0x42, 0x4B, 0x42, 0x42, 0x4B, 0x4B, 0x42, + 0x4B, 0x4D, 0x42, 0x4C, 0x4A, 0x42, 0x4C, 0x6A, + 0x42, 0x4D, 0x42, 0x42, 0x4D, 0x43, 0x42, 0x4D, + // Bytes 1980 - 19bf + 0x44, 0x42, 0x4D, 0x56, 0x42, 0x4D, 0x57, 0x42, + 0x4E, 0x4A, 0x42, 0x4E, 0x6A, 0x42, 0x4E, 0x6F, + 0x42, 0x50, 0x48, 0x42, 0x50, 0x52, 0x42, 0x50, + 0x61, 0x42, 0x52, 0x73, 0x42, 0x53, 0x44, 0x42, + 0x53, 0x4D, 0x42, 0x53, 0x53, 0x42, 0x53, 0x76, + 0x42, 0x54, 0x4D, 0x42, 0x56, 0x49, 0x42, 0x57, + 0x43, 0x42, 0x57, 0x5A, 0x42, 0x57, 0x62, 0x42, + 0x58, 0x49, 0x42, 0x63, 0x63, 0x42, 0x63, 0x64, + // Bytes 19c0 - 19ff + 0x42, 0x63, 0x6D, 0x42, 0x64, 0x42, 0x42, 0x64, + 0x61, 0x42, 0x64, 0x6C, 0x42, 0x64, 0x6D, 0x42, + 0x64, 0x7A, 0x42, 0x65, 0x56, 0x42, 0x66, 0x66, + 0x42, 0x66, 0x69, 0x42, 0x66, 0x6C, 0x42, 0x66, + 0x6D, 0x42, 0x68, 0x61, 0x42, 0x69, 0x69, 0x42, + 0x69, 0x6A, 0x42, 0x69, 0x6E, 0x42, 0x69, 0x76, + 0x42, 0x69, 0x78, 0x42, 0x6B, 0x41, 0x42, 0x6B, + 0x56, 0x42, 0x6B, 0x57, 0x42, 0x6B, 0x67, 0x42, + // Bytes 1a00 - 1a3f + 0x6B, 0x6C, 0x42, 0x6B, 0x6D, 0x42, 0x6B, 0x74, + 0x42, 0x6C, 0x6A, 0x42, 0x6C, 0x6D, 0x42, 0x6C, + 0x6E, 0x42, 0x6C, 0x78, 0x42, 0x6D, 0x32, 0x42, + 0x6D, 0x33, 0x42, 0x6D, 0x41, 0x42, 0x6D, 0x56, + 0x42, 0x6D, 0x57, 0x42, 0x6D, 0x62, 0x42, 0x6D, + 0x67, 0x42, 0x6D, 0x6C, 0x42, 0x6D, 0x6D, 0x42, + 0x6D, 0x73, 0x42, 0x6E, 0x41, 0x42, 0x6E, 0x46, + 0x42, 0x6E, 0x56, 0x42, 0x6E, 0x57, 0x42, 0x6E, + // Bytes 1a40 - 1a7f + 0x6A, 0x42, 0x6E, 0x6D, 0x42, 0x6E, 0x73, 0x42, + 0x6F, 0x56, 0x42, 0x70, 0x41, 0x42, 0x70, 0x46, + 0x42, 0x70, 0x56, 0x42, 0x70, 0x57, 0x42, 0x70, + 0x63, 0x42, 0x70, 0x73, 0x42, 0x73, 0x72, 0x42, + 0x73, 0x74, 0x42, 0x76, 0x69, 0x42, 0x78, 0x69, + 0x43, 0x28, 0x31, 0x29, 0x43, 0x28, 0x32, 0x29, + 0x43, 0x28, 0x33, 0x29, 0x43, 0x28, 0x34, 0x29, + 0x43, 0x28, 0x35, 0x29, 0x43, 0x28, 0x36, 0x29, + // Bytes 1a80 - 1abf + 0x43, 0x28, 0x37, 0x29, 0x43, 0x28, 0x38, 0x29, + 0x43, 0x28, 0x39, 0x29, 0x43, 0x28, 0x41, 0x29, + 0x43, 0x28, 0x42, 0x29, 0x43, 0x28, 0x43, 0x29, + 0x43, 0x28, 0x44, 0x29, 0x43, 0x28, 0x45, 0x29, + 0x43, 0x28, 0x46, 0x29, 0x43, 0x28, 0x47, 0x29, + 0x43, 0x28, 0x48, 0x29, 0x43, 0x28, 0x49, 0x29, + 0x43, 0x28, 0x4A, 0x29, 0x43, 0x28, 0x4B, 0x29, + 0x43, 0x28, 0x4C, 0x29, 0x43, 0x28, 0x4D, 0x29, + // Bytes 1ac0 - 1aff + 0x43, 0x28, 0x4E, 0x29, 0x43, 0x28, 0x4F, 0x29, + 0x43, 0x28, 0x50, 0x29, 0x43, 0x28, 0x51, 0x29, + 0x43, 0x28, 0x52, 0x29, 0x43, 0x28, 0x53, 0x29, + 0x43, 0x28, 0x54, 0x29, 0x43, 0x28, 0x55, 0x29, + 0x43, 0x28, 0x56, 0x29, 0x43, 0x28, 0x57, 0x29, + 0x43, 0x28, 0x58, 0x29, 0x43, 0x28, 0x59, 0x29, + 0x43, 0x28, 0x5A, 0x29, 0x43, 0x28, 0x61, 0x29, + 0x43, 0x28, 0x62, 0x29, 0x43, 0x28, 0x63, 0x29, + // Bytes 1b00 - 1b3f + 0x43, 0x28, 0x64, 0x29, 0x43, 0x28, 0x65, 0x29, + 0x43, 0x28, 0x66, 0x29, 0x43, 0x28, 0x67, 0x29, + 0x43, 0x28, 0x68, 0x29, 0x43, 0x28, 0x69, 0x29, + 0x43, 0x28, 0x6A, 0x29, 0x43, 0x28, 0x6B, 0x29, + 0x43, 0x28, 0x6C, 0x29, 0x43, 0x28, 0x6D, 0x29, + 0x43, 0x28, 0x6E, 0x29, 0x43, 0x28, 0x6F, 0x29, + 0x43, 0x28, 0x70, 0x29, 0x43, 0x28, 0x71, 0x29, + 0x43, 0x28, 0x72, 0x29, 0x43, 0x28, 0x73, 0x29, + // Bytes 1b40 - 1b7f + 0x43, 0x28, 0x74, 0x29, 0x43, 0x28, 0x75, 0x29, + 0x43, 0x28, 0x76, 0x29, 0x43, 0x28, 0x77, 0x29, + 0x43, 0x28, 0x78, 0x29, 0x43, 0x28, 0x79, 0x29, + 0x43, 0x28, 0x7A, 0x29, 0x43, 0x2E, 0x2E, 0x2E, + 0x43, 0x31, 0x30, 0x2E, 0x43, 0x31, 0x31, 0x2E, + 0x43, 0x31, 0x32, 0x2E, 0x43, 0x31, 0x33, 0x2E, + 0x43, 0x31, 0x34, 0x2E, 0x43, 0x31, 0x35, 0x2E, + 0x43, 0x31, 0x36, 0x2E, 0x43, 0x31, 0x37, 0x2E, + // Bytes 1b80 - 1bbf + 0x43, 0x31, 0x38, 0x2E, 0x43, 0x31, 0x39, 0x2E, + 0x43, 0x32, 0x30, 0x2E, 0x43, 0x3A, 0x3A, 0x3D, + 0x43, 0x3D, 0x3D, 0x3D, 0x43, 0x43, 0x6F, 0x2E, + 0x43, 0x46, 0x41, 0x58, 0x43, 0x47, 0x48, 0x7A, + 0x43, 0x47, 0x50, 0x61, 0x43, 0x49, 0x49, 0x49, + 0x43, 0x4C, 0x54, 0x44, 0x43, 0x4C, 0xC2, 0xB7, + 0x43, 0x4D, 0x48, 0x7A, 0x43, 0x4D, 0x50, 0x61, + 0x43, 0x4D, 0xCE, 0xA9, 0x43, 0x50, 0x50, 0x4D, + // Bytes 1bc0 - 1bff + 0x43, 0x50, 0x50, 0x56, 0x43, 0x50, 0x54, 0x45, + 0x43, 0x54, 0x45, 0x4C, 0x43, 0x54, 0x48, 0x7A, + 0x43, 0x56, 0x49, 0x49, 0x43, 0x58, 0x49, 0x49, + 0x43, 0x61, 0x2F, 0x63, 0x43, 0x61, 0x2F, 0x73, + 0x43, 0x61, 0xCA, 0xBE, 0x43, 0x62, 0x61, 0x72, + 0x43, 0x63, 0x2F, 0x6F, 0x43, 0x63, 0x2F, 0x75, + 0x43, 0x63, 0x61, 0x6C, 0x43, 0x63, 0x6D, 0x32, + 0x43, 0x63, 0x6D, 0x33, 0x43, 0x64, 0x6D, 0x32, + // Bytes 1c00 - 1c3f + 0x43, 0x64, 0x6D, 0x33, 0x43, 0x65, 0x72, 0x67, + 0x43, 0x66, 0x66, 0x69, 0x43, 0x66, 0x66, 0x6C, + 0x43, 0x67, 0x61, 0x6C, 0x43, 0x68, 0x50, 0x61, + 0x43, 0x69, 0x69, 0x69, 0x43, 0x6B, 0x48, 0x7A, + 0x43, 0x6B, 0x50, 0x61, 0x43, 0x6B, 0x6D, 0x32, + 0x43, 0x6B, 0x6D, 0x33, 0x43, 0x6B, 0xCE, 0xA9, + 0x43, 0x6C, 0x6F, 0x67, 0x43, 0x6C, 0xC2, 0xB7, + 0x43, 0x6D, 0x69, 0x6C, 0x43, 0x6D, 0x6D, 0x32, + // Bytes 1c40 - 1c7f + 0x43, 0x6D, 0x6D, 0x33, 0x43, 0x6D, 0x6F, 0x6C, + 0x43, 0x72, 0x61, 0x64, 0x43, 0x76, 0x69, 0x69, + 0x43, 0x78, 0x69, 0x69, 0x43, 0xC2, 0xB0, 0x43, + 0x43, 0xC2, 0xB0, 0x46, 0x43, 0xCA, 0xBC, 0x6E, + 0x43, 0xCE, 0xBC, 0x41, 0x43, 0xCE, 0xBC, 0x46, + 0x43, 0xCE, 0xBC, 0x56, 0x43, 0xCE, 0xBC, 0x57, + 0x43, 0xCE, 0xBC, 0x67, 0x43, 0xCE, 0xBC, 0x6C, + 0x43, 0xCE, 0xBC, 0x6D, 0x43, 0xCE, 0xBC, 0x73, + // Bytes 1c80 - 1cbf + 0x44, 0x28, 0x31, 0x30, 0x29, 0x44, 0x28, 0x31, + 0x31, 0x29, 0x44, 0x28, 0x31, 0x32, 0x29, 0x44, + 0x28, 0x31, 0x33, 0x29, 0x44, 0x28, 0x31, 0x34, + 0x29, 0x44, 0x28, 0x31, 0x35, 0x29, 0x44, 0x28, + 0x31, 0x36, 0x29, 0x44, 0x28, 0x31, 0x37, 0x29, + 0x44, 0x28, 0x31, 0x38, 0x29, 0x44, 0x28, 0x31, + 0x39, 0x29, 0x44, 0x28, 0x32, 0x30, 0x29, 0x44, + 0x30, 0xE7, 0x82, 0xB9, 0x44, 0x31, 0xE2, 0x81, + // Bytes 1cc0 - 1cff + 0x84, 0x44, 0x31, 0xE6, 0x97, 0xA5, 0x44, 0x31, + 0xE6, 0x9C, 0x88, 0x44, 0x31, 0xE7, 0x82, 0xB9, + 0x44, 0x32, 0xE6, 0x97, 0xA5, 0x44, 0x32, 0xE6, + 0x9C, 0x88, 0x44, 0x32, 0xE7, 0x82, 0xB9, 0x44, + 0x33, 0xE6, 0x97, 0xA5, 0x44, 0x33, 0xE6, 0x9C, + 0x88, 0x44, 0x33, 0xE7, 0x82, 0xB9, 0x44, 0x34, + 0xE6, 0x97, 0xA5, 0x44, 0x34, 0xE6, 0x9C, 0x88, + 0x44, 0x34, 0xE7, 0x82, 0xB9, 0x44, 0x35, 0xE6, + // Bytes 1d00 - 1d3f + 0x97, 0xA5, 0x44, 0x35, 0xE6, 0x9C, 0x88, 0x44, + 0x35, 0xE7, 0x82, 0xB9, 0x44, 0x36, 0xE6, 0x97, + 0xA5, 0x44, 0x36, 0xE6, 0x9C, 0x88, 0x44, 0x36, + 0xE7, 0x82, 0xB9, 0x44, 0x37, 0xE6, 0x97, 0xA5, + 0x44, 0x37, 0xE6, 0x9C, 0x88, 0x44, 0x37, 0xE7, + 0x82, 0xB9, 0x44, 0x38, 0xE6, 0x97, 0xA5, 0x44, + 0x38, 0xE6, 0x9C, 0x88, 0x44, 0x38, 0xE7, 0x82, + 0xB9, 0x44, 0x39, 0xE6, 0x97, 0xA5, 0x44, 0x39, + // Bytes 1d40 - 1d7f + 0xE6, 0x9C, 0x88, 0x44, 0x39, 0xE7, 0x82, 0xB9, + 0x44, 0x56, 0x49, 0x49, 0x49, 0x44, 0x61, 0x2E, + 0x6D, 0x2E, 0x44, 0x6B, 0x63, 0x61, 0x6C, 0x44, + 0x70, 0x2E, 0x6D, 0x2E, 0x44, 0x76, 0x69, 0x69, + 0x69, 0x44, 0xD5, 0xA5, 0xD6, 0x82, 0x44, 0xD5, + 0xB4, 0xD5, 0xA5, 0x44, 0xD5, 0xB4, 0xD5, 0xAB, + 0x44, 0xD5, 0xB4, 0xD5, 0xAD, 0x44, 0xD5, 0xB4, + 0xD5, 0xB6, 0x44, 0xD5, 0xBE, 0xD5, 0xB6, 0x44, + // Bytes 1d80 - 1dbf + 0xD7, 0x90, 0xD7, 0x9C, 0x44, 0xD8, 0xA7, 0xD9, + 0xB4, 0x44, 0xD8, 0xA8, 0xD8, 0xAC, 0x44, 0xD8, + 0xA8, 0xD8, 0xAD, 0x44, 0xD8, 0xA8, 0xD8, 0xAE, + 0x44, 0xD8, 0xA8, 0xD8, 0xB1, 0x44, 0xD8, 0xA8, + 0xD8, 0xB2, 0x44, 0xD8, 0xA8, 0xD9, 0x85, 0x44, + 0xD8, 0xA8, 0xD9, 0x86, 0x44, 0xD8, 0xA8, 0xD9, + 0x87, 0x44, 0xD8, 0xA8, 0xD9, 0x89, 0x44, 0xD8, + 0xA8, 0xD9, 0x8A, 0x44, 0xD8, 0xAA, 0xD8, 0xAC, + // Bytes 1dc0 - 1dff + 0x44, 0xD8, 0xAA, 0xD8, 0xAD, 0x44, 0xD8, 0xAA, + 0xD8, 0xAE, 0x44, 0xD8, 0xAA, 0xD8, 0xB1, 0x44, + 0xD8, 0xAA, 0xD8, 0xB2, 0x44, 0xD8, 0xAA, 0xD9, + 0x85, 0x44, 0xD8, 0xAA, 0xD9, 0x86, 0x44, 0xD8, + 0xAA, 0xD9, 0x87, 0x44, 0xD8, 0xAA, 0xD9, 0x89, + 0x44, 0xD8, 0xAA, 0xD9, 0x8A, 0x44, 0xD8, 0xAB, + 0xD8, 0xAC, 0x44, 0xD8, 0xAB, 0xD8, 0xB1, 0x44, + 0xD8, 0xAB, 0xD8, 0xB2, 0x44, 0xD8, 0xAB, 0xD9, + // Bytes 1e00 - 1e3f + 0x85, 0x44, 0xD8, 0xAB, 0xD9, 0x86, 0x44, 0xD8, + 0xAB, 0xD9, 0x87, 0x44, 0xD8, 0xAB, 0xD9, 0x89, + 0x44, 0xD8, 0xAB, 0xD9, 0x8A, 0x44, 0xD8, 0xAC, + 0xD8, 0xAD, 0x44, 0xD8, 0xAC, 0xD9, 0x85, 0x44, + 0xD8, 0xAC, 0xD9, 0x89, 0x44, 0xD8, 0xAC, 0xD9, + 0x8A, 0x44, 0xD8, 0xAD, 0xD8, 0xAC, 0x44, 0xD8, + 0xAD, 0xD9, 0x85, 0x44, 0xD8, 0xAD, 0xD9, 0x89, + 0x44, 0xD8, 0xAD, 0xD9, 0x8A, 0x44, 0xD8, 0xAE, + // Bytes 1e40 - 1e7f + 0xD8, 0xAC, 0x44, 0xD8, 0xAE, 0xD8, 0xAD, 0x44, + 0xD8, 0xAE, 0xD9, 0x85, 0x44, 0xD8, 0xAE, 0xD9, + 0x89, 0x44, 0xD8, 0xAE, 0xD9, 0x8A, 0x44, 0xD8, + 0xB3, 0xD8, 0xAC, 0x44, 0xD8, 0xB3, 0xD8, 0xAD, + 0x44, 0xD8, 0xB3, 0xD8, 0xAE, 0x44, 0xD8, 0xB3, + 0xD8, 0xB1, 0x44, 0xD8, 0xB3, 0xD9, 0x85, 0x44, + 0xD8, 0xB3, 0xD9, 0x87, 0x44, 0xD8, 0xB3, 0xD9, + 0x89, 0x44, 0xD8, 0xB3, 0xD9, 0x8A, 0x44, 0xD8, + // Bytes 1e80 - 1ebf + 0xB4, 0xD8, 0xAC, 0x44, 0xD8, 0xB4, 0xD8, 0xAD, + 0x44, 0xD8, 0xB4, 0xD8, 0xAE, 0x44, 0xD8, 0xB4, + 0xD8, 0xB1, 0x44, 0xD8, 0xB4, 0xD9, 0x85, 0x44, + 0xD8, 0xB4, 0xD9, 0x87, 0x44, 0xD8, 0xB4, 0xD9, + 0x89, 0x44, 0xD8, 0xB4, 0xD9, 0x8A, 0x44, 0xD8, + 0xB5, 0xD8, 0xAD, 0x44, 0xD8, 0xB5, 0xD8, 0xAE, + 0x44, 0xD8, 0xB5, 0xD8, 0xB1, 0x44, 0xD8, 0xB5, + 0xD9, 0x85, 0x44, 0xD8, 0xB5, 0xD9, 0x89, 0x44, + // Bytes 1ec0 - 1eff + 0xD8, 0xB5, 0xD9, 0x8A, 0x44, 0xD8, 0xB6, 0xD8, + 0xAC, 0x44, 0xD8, 0xB6, 0xD8, 0xAD, 0x44, 0xD8, + 0xB6, 0xD8, 0xAE, 0x44, 0xD8, 0xB6, 0xD8, 0xB1, + 0x44, 0xD8, 0xB6, 0xD9, 0x85, 0x44, 0xD8, 0xB6, + 0xD9, 0x89, 0x44, 0xD8, 0xB6, 0xD9, 0x8A, 0x44, + 0xD8, 0xB7, 0xD8, 0xAD, 0x44, 0xD8, 0xB7, 0xD9, + 0x85, 0x44, 0xD8, 0xB7, 0xD9, 0x89, 0x44, 0xD8, + 0xB7, 0xD9, 0x8A, 0x44, 0xD8, 0xB8, 0xD9, 0x85, + // Bytes 1f00 - 1f3f + 0x44, 0xD8, 0xB9, 0xD8, 0xAC, 0x44, 0xD8, 0xB9, + 0xD9, 0x85, 0x44, 0xD8, 0xB9, 0xD9, 0x89, 0x44, + 0xD8, 0xB9, 0xD9, 0x8A, 0x44, 0xD8, 0xBA, 0xD8, + 0xAC, 0x44, 0xD8, 0xBA, 0xD9, 0x85, 0x44, 0xD8, + 0xBA, 0xD9, 0x89, 0x44, 0xD8, 0xBA, 0xD9, 0x8A, + 0x44, 0xD9, 0x81, 0xD8, 0xAC, 0x44, 0xD9, 0x81, + 0xD8, 0xAD, 0x44, 0xD9, 0x81, 0xD8, 0xAE, 0x44, + 0xD9, 0x81, 0xD9, 0x85, 0x44, 0xD9, 0x81, 0xD9, + // Bytes 1f40 - 1f7f + 0x89, 0x44, 0xD9, 0x81, 0xD9, 0x8A, 0x44, 0xD9, + 0x82, 0xD8, 0xAD, 0x44, 0xD9, 0x82, 0xD9, 0x85, + 0x44, 0xD9, 0x82, 0xD9, 0x89, 0x44, 0xD9, 0x82, + 0xD9, 0x8A, 0x44, 0xD9, 0x83, 0xD8, 0xA7, 0x44, + 0xD9, 0x83, 0xD8, 0xAC, 0x44, 0xD9, 0x83, 0xD8, + 0xAD, 0x44, 0xD9, 0x83, 0xD8, 0xAE, 0x44, 0xD9, + 0x83, 0xD9, 0x84, 0x44, 0xD9, 0x83, 0xD9, 0x85, + 0x44, 0xD9, 0x83, 0xD9, 0x89, 0x44, 0xD9, 0x83, + // Bytes 1f80 - 1fbf + 0xD9, 0x8A, 0x44, 0xD9, 0x84, 0xD8, 0xA7, 0x44, + 0xD9, 0x84, 0xD8, 0xAC, 0x44, 0xD9, 0x84, 0xD8, + 0xAD, 0x44, 0xD9, 0x84, 0xD8, 0xAE, 0x44, 0xD9, + 0x84, 0xD9, 0x85, 0x44, 0xD9, 0x84, 0xD9, 0x87, + 0x44, 0xD9, 0x84, 0xD9, 0x89, 0x44, 0xD9, 0x84, + 0xD9, 0x8A, 0x44, 0xD9, 0x85, 0xD8, 0xA7, 0x44, + 0xD9, 0x85, 0xD8, 0xAC, 0x44, 0xD9, 0x85, 0xD8, + 0xAD, 0x44, 0xD9, 0x85, 0xD8, 0xAE, 0x44, 0xD9, + // Bytes 1fc0 - 1fff + 0x85, 0xD9, 0x85, 0x44, 0xD9, 0x85, 0xD9, 0x89, + 0x44, 0xD9, 0x85, 0xD9, 0x8A, 0x44, 0xD9, 0x86, + 0xD8, 0xAC, 0x44, 0xD9, 0x86, 0xD8, 0xAD, 0x44, + 0xD9, 0x86, 0xD8, 0xAE, 0x44, 0xD9, 0x86, 0xD8, + 0xB1, 0x44, 0xD9, 0x86, 0xD8, 0xB2, 0x44, 0xD9, + 0x86, 0xD9, 0x85, 0x44, 0xD9, 0x86, 0xD9, 0x86, + 0x44, 0xD9, 0x86, 0xD9, 0x87, 0x44, 0xD9, 0x86, + 0xD9, 0x89, 0x44, 0xD9, 0x86, 0xD9, 0x8A, 0x44, + // Bytes 2000 - 203f + 0xD9, 0x87, 0xD8, 0xAC, 0x44, 0xD9, 0x87, 0xD9, + 0x85, 0x44, 0xD9, 0x87, 0xD9, 0x89, 0x44, 0xD9, + 0x87, 0xD9, 0x8A, 0x44, 0xD9, 0x88, 0xD9, 0xB4, + 0x44, 0xD9, 0x8A, 0xD8, 0xAC, 0x44, 0xD9, 0x8A, + 0xD8, 0xAD, 0x44, 0xD9, 0x8A, 0xD8, 0xAE, 0x44, + 0xD9, 0x8A, 0xD8, 0xB1, 0x44, 0xD9, 0x8A, 0xD8, + 0xB2, 0x44, 0xD9, 0x8A, 0xD9, 0x85, 0x44, 0xD9, + 0x8A, 0xD9, 0x86, 0x44, 0xD9, 0x8A, 0xD9, 0x87, + // Bytes 2040 - 207f + 0x44, 0xD9, 0x8A, 0xD9, 0x89, 0x44, 0xD9, 0x8A, + 0xD9, 0x8A, 0x44, 0xD9, 0x8A, 0xD9, 0xB4, 0x44, + 0xDB, 0x87, 0xD9, 0xB4, 0x45, 0x28, 0xE1, 0x84, + 0x80, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x82, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x83, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x85, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x86, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x87, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x89, 0x29, 0x45, 0x28, + // Bytes 2080 - 20bf + 0xE1, 0x84, 0x8B, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x8C, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x8E, 0x29, + 0x45, 0x28, 0xE1, 0x84, 0x8F, 0x29, 0x45, 0x28, + 0xE1, 0x84, 0x90, 0x29, 0x45, 0x28, 0xE1, 0x84, + 0x91, 0x29, 0x45, 0x28, 0xE1, 0x84, 0x92, 0x29, + 0x45, 0x28, 0xE4, 0xB8, 0x80, 0x29, 0x45, 0x28, + 0xE4, 0xB8, 0x83, 0x29, 0x45, 0x28, 0xE4, 0xB8, + 0x89, 0x29, 0x45, 0x28, 0xE4, 0xB9, 0x9D, 0x29, + // Bytes 20c0 - 20ff + 0x45, 0x28, 0xE4, 0xBA, 0x8C, 0x29, 0x45, 0x28, + 0xE4, 0xBA, 0x94, 0x29, 0x45, 0x28, 0xE4, 0xBB, + 0xA3, 0x29, 0x45, 0x28, 0xE4, 0xBC, 0x81, 0x29, + 0x45, 0x28, 0xE4, 0xBC, 0x91, 0x29, 0x45, 0x28, + 0xE5, 0x85, 0xAB, 0x29, 0x45, 0x28, 0xE5, 0x85, + 0xAD, 0x29, 0x45, 0x28, 0xE5, 0x8A, 0xB4, 0x29, + 0x45, 0x28, 0xE5, 0x8D, 0x81, 0x29, 0x45, 0x28, + 0xE5, 0x8D, 0x94, 0x29, 0x45, 0x28, 0xE5, 0x90, + // Bytes 2100 - 213f + 0x8D, 0x29, 0x45, 0x28, 0xE5, 0x91, 0xBC, 0x29, + 0x45, 0x28, 0xE5, 0x9B, 0x9B, 0x29, 0x45, 0x28, + 0xE5, 0x9C, 0x9F, 0x29, 0x45, 0x28, 0xE5, 0xAD, + 0xA6, 0x29, 0x45, 0x28, 0xE6, 0x97, 0xA5, 0x29, + 0x45, 0x28, 0xE6, 0x9C, 0x88, 0x29, 0x45, 0x28, + 0xE6, 0x9C, 0x89, 0x29, 0x45, 0x28, 0xE6, 0x9C, + 0xA8, 0x29, 0x45, 0x28, 0xE6, 0xA0, 0xAA, 0x29, + 0x45, 0x28, 0xE6, 0xB0, 0xB4, 0x29, 0x45, 0x28, + // Bytes 2140 - 217f + 0xE7, 0x81, 0xAB, 0x29, 0x45, 0x28, 0xE7, 0x89, + 0xB9, 0x29, 0x45, 0x28, 0xE7, 0x9B, 0xA3, 0x29, + 0x45, 0x28, 0xE7, 0xA4, 0xBE, 0x29, 0x45, 0x28, + 0xE7, 0xA5, 0x9D, 0x29, 0x45, 0x28, 0xE7, 0xA5, + 0xAD, 0x29, 0x45, 0x28, 0xE8, 0x87, 0xAA, 0x29, + 0x45, 0x28, 0xE8, 0x87, 0xB3, 0x29, 0x45, 0x28, + 0xE8, 0xB2, 0xA1, 0x29, 0x45, 0x28, 0xE8, 0xB3, + 0x87, 0x29, 0x45, 0x28, 0xE9, 0x87, 0x91, 0x29, + // Bytes 2180 - 21bf + 0x45, 0x30, 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x31, 0x30, 0xE6, + 0x9C, 0x88, 0x45, 0x31, 0x30, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x31, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x31, 0xE6, 0x9C, 0x88, 0x45, 0x31, 0x31, 0xE7, + 0x82, 0xB9, 0x45, 0x31, 0x32, 0xE6, 0x97, 0xA5, + 0x45, 0x31, 0x32, 0xE6, 0x9C, 0x88, 0x45, 0x31, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x33, 0xE6, + // Bytes 21c0 - 21ff + 0x97, 0xA5, 0x45, 0x31, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x35, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x35, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x36, 0xE6, 0x97, 0xA5, 0x45, 0x31, + 0x36, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x37, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x37, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x31, + // Bytes 2200 - 223f + 0x38, 0xE7, 0x82, 0xB9, 0x45, 0x31, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x31, 0x39, 0xE7, 0x82, 0xB9, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x32, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x33, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x34, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x35, + 0x45, 0x31, 0xE2, 0x81, 0x84, 0x36, 0x45, 0x31, + 0xE2, 0x81, 0x84, 0x37, 0x45, 0x31, 0xE2, 0x81, + 0x84, 0x38, 0x45, 0x31, 0xE2, 0x81, 0x84, 0x39, + // Bytes 2240 - 227f + 0x45, 0x32, 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x30, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x31, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x32, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x32, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x33, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0x33, 0xE7, 0x82, 0xB9, + 0x45, 0x32, 0x34, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x34, 0xE7, 0x82, 0xB9, 0x45, 0x32, 0x35, 0xE6, + // Bytes 2280 - 22bf + 0x97, 0xA5, 0x45, 0x32, 0x36, 0xE6, 0x97, 0xA5, + 0x45, 0x32, 0x37, 0xE6, 0x97, 0xA5, 0x45, 0x32, + 0x38, 0xE6, 0x97, 0xA5, 0x45, 0x32, 0x39, 0xE6, + 0x97, 0xA5, 0x45, 0x32, 0xE2, 0x81, 0x84, 0x33, + 0x45, 0x32, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + 0x30, 0xE6, 0x97, 0xA5, 0x45, 0x33, 0x31, 0xE6, + 0x97, 0xA5, 0x45, 0x33, 0xE2, 0x81, 0x84, 0x34, + 0x45, 0x33, 0xE2, 0x81, 0x84, 0x35, 0x45, 0x33, + // Bytes 22c0 - 22ff + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x34, 0xE2, 0x81, + 0x84, 0x35, 0x45, 0x35, 0xE2, 0x81, 0x84, 0x36, + 0x45, 0x35, 0xE2, 0x81, 0x84, 0x38, 0x45, 0x37, + 0xE2, 0x81, 0x84, 0x38, 0x45, 0x41, 0xE2, 0x88, + 0x95, 0x6D, 0x45, 0x56, 0xE2, 0x88, 0x95, 0x6D, + 0x45, 0x6D, 0xE2, 0x88, 0x95, 0x73, 0x46, 0x31, + 0xE2, 0x81, 0x84, 0x31, 0x30, 0x46, 0x43, 0xE2, + 0x88, 0x95, 0x6B, 0x67, 0x46, 0x6D, 0xE2, 0x88, + // Bytes 2300 - 233f + 0x95, 0x73, 0x32, 0x46, 0xD8, 0xA8, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xA8, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x85, + 0x46, 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x89, 0x46, + 0xD8, 0xAA, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAA, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, 0xD8, 0xAA, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, + // Bytes 2340 - 237f + 0xD9, 0x89, 0x46, 0xD8, 0xAA, 0xD8, 0xAE, 0xD9, + 0x8A, 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAC, + 0x46, 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAD, 0x46, + 0xD8, 0xAA, 0xD9, 0x85, 0xD8, 0xAE, 0x46, 0xD8, + 0xAA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAA, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD8, 0xAC, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD8, + // Bytes 2380 - 23bf + 0xAD, 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x89, + 0x46, 0xD8, 0xAC, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD8, 0xAD, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD8, + 0xAD, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, 0xAD, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB3, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, 0xD8, 0xAC, + 0xD9, 0x89, 0x46, 0xD8, 0xB3, 0xD8, 0xAD, 0xD8, + 0xAC, 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x89, + // Bytes 23c0 - 23ff + 0x46, 0xD8, 0xB3, 0xD8, 0xAE, 0xD9, 0x8A, 0x46, + 0xD8, 0xB3, 0xD9, 0x85, 0xD8, 0xAC, 0x46, 0xD8, + 0xB3, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, 0xB3, + 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, + 0xAC, 0xD9, 0x8A, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, + 0xD9, 0x85, 0x46, 0xD8, 0xB4, 0xD8, 0xAD, 0xD9, + 0x8A, 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD8, 0xAE, + 0x46, 0xD8, 0xB4, 0xD9, 0x85, 0xD9, 0x85, 0x46, + // Bytes 2400 - 243f + 0xD8, 0xB5, 0xD8, 0xAD, 0xD8, 0xAD, 0x46, 0xD8, + 0xB5, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD8, 0xB5, + 0xD9, 0x84, 0xD9, 0x89, 0x46, 0xD8, 0xB5, 0xD9, + 0x84, 0xDB, 0x92, 0x46, 0xD8, 0xB5, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, + 0x89, 0x46, 0xD8, 0xB6, 0xD8, 0xAD, 0xD9, 0x8A, + 0x46, 0xD8, 0xB6, 0xD8, 0xAE, 0xD9, 0x85, 0x46, + 0xD8, 0xB7, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD8, + // Bytes 2440 - 247f + 0xB7, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD8, 0xB7, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD8, 0xB9, 0xD8, + 0xAC, 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, + 0xD9, 0x85, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD8, 0xB9, 0xD9, 0x85, 0xD9, 0x8A, + 0x46, 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x85, 0x46, + 0xD8, 0xBA, 0xD9, 0x85, 0xD9, 0x89, 0x46, 0xD8, + 0xBA, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x81, + // Bytes 2480 - 24bf + 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x81, 0xD9, + 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x82, 0xD9, 0x84, + 0xDB, 0x92, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD8, + 0xAD, 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x85, + 0x46, 0xD9, 0x82, 0xD9, 0x85, 0xD9, 0x8A, 0x46, + 0xD9, 0x83, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x83, 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x84, + 0xD8, 0xAC, 0xD8, 0xAC, 0x46, 0xD9, 0x84, 0xD8, + // Bytes 24c0 - 24ff + 0xAC, 0xD9, 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAC, + 0xD9, 0x8A, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, + 0x85, 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x89, + 0x46, 0xD9, 0x84, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, + 0xD9, 0x84, 0xD8, 0xAE, 0xD9, 0x85, 0x46, 0xD9, + 0x84, 0xD9, 0x85, 0xD8, 0xAD, 0x46, 0xD9, 0x84, + 0xD9, 0x85, 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD8, + 0xAC, 0xD8, 0xAD, 0x46, 0xD9, 0x85, 0xD8, 0xAC, + // Bytes 2500 - 253f + 0xD8, 0xAE, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, + 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAC, 0xD9, 0x8A, + 0x46, 0xD9, 0x85, 0xD8, 0xAD, 0xD8, 0xAC, 0x46, + 0xD9, 0x85, 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, + 0x85, 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x85, + 0xD8, 0xAE, 0xD8, 0xAC, 0x46, 0xD9, 0x85, 0xD8, + 0xAE, 0xD9, 0x85, 0x46, 0xD9, 0x85, 0xD8, 0xAE, + 0xD9, 0x8A, 0x46, 0xD9, 0x85, 0xD9, 0x85, 0xD9, + // Bytes 2540 - 257f + 0x8A, 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD8, 0xAD, + 0x46, 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x85, 0x46, + 0xD9, 0x86, 0xD8, 0xAC, 0xD9, 0x89, 0x46, 0xD9, + 0x86, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x86, + 0xD8, 0xAD, 0xD9, 0x85, 0x46, 0xD9, 0x86, 0xD8, + 0xAD, 0xD9, 0x89, 0x46, 0xD9, 0x86, 0xD8, 0xAD, + 0xD9, 0x8A, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, + 0x89, 0x46, 0xD9, 0x86, 0xD9, 0x85, 0xD9, 0x8A, + // Bytes 2580 - 25bf + 0x46, 0xD9, 0x87, 0xD9, 0x85, 0xD8, 0xAC, 0x46, + 0xD9, 0x87, 0xD9, 0x85, 0xD9, 0x85, 0x46, 0xD9, + 0x8A, 0xD8, 0xAC, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, + 0xD8, 0xAD, 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, + 0x85, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x85, + 0xD9, 0x8A, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, + 0xA7, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAC, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAD, 0x46, + // Bytes 25c0 - 25ff + 0xD9, 0x8A, 0xD9, 0x94, 0xD8, 0xAE, 0x46, 0xD9, + 0x8A, 0xD9, 0x94, 0xD8, 0xB1, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xD8, 0xB2, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xD9, 0x85, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xD9, 0x86, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, + 0x87, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x88, + 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x89, 0x46, + 0xD9, 0x8A, 0xD9, 0x94, 0xD9, 0x8A, 0x46, 0xD9, + // Bytes 2600 - 263f + 0x8A, 0xD9, 0x94, 0xDB, 0x86, 0x46, 0xD9, 0x8A, + 0xD9, 0x94, 0xDB, 0x87, 0x46, 0xD9, 0x8A, 0xD9, + 0x94, 0xDB, 0x88, 0x46, 0xD9, 0x8A, 0xD9, 0x94, + 0xDB, 0x90, 0x46, 0xD9, 0x8A, 0xD9, 0x94, 0xDB, + 0x95, 0x46, 0xE0, 0xB9, 0x8D, 0xE0, 0xB8, 0xB2, + 0x46, 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0x99, 0x46, + 0xE0, 0xBA, 0xAB, 0xE0, 0xBA, 0xA1, 0x46, 0xE0, + 0xBB, 0x8D, 0xE0, 0xBA, 0xB2, 0x46, 0xE0, 0xBD, + // Bytes 2640 - 267f + 0x80, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, 0xBD, 0x82, + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x8C, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBD, 0x91, 0xE0, 0xBE, + 0xB7, 0x46, 0xE0, 0xBD, 0x96, 0xE0, 0xBE, 0xB7, + 0x46, 0xE0, 0xBD, 0x9B, 0xE0, 0xBE, 0xB7, 0x46, + 0xE0, 0xBE, 0x90, 0xE0, 0xBE, 0xB5, 0x46, 0xE0, + 0xBE, 0x92, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, + 0x9C, 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA1, + // Bytes 2680 - 26bf + 0xE0, 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xA6, 0xE0, + 0xBE, 0xB7, 0x46, 0xE0, 0xBE, 0xAB, 0xE0, 0xBE, + 0xB7, 0x46, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x46, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0x46, + 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0x46, 0xE2, + 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x46, 0xE3, 0x81, + 0xBB, 0xE3, 0x81, 0x8B, 0x46, 0xE3, 0x82, 0x88, + 0xE3, 0x82, 0x8A, 0x46, 0xE3, 0x82, 0xAD, 0xE3, + // Bytes 26c0 - 26ff + 0x83, 0xAD, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x82, + 0xB3, 0x46, 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0x88, + 0x46, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xB3, 0x46, + 0xE3, 0x83, 0x8A, 0xE3, 0x83, 0x8E, 0x46, 0xE3, + 0x83, 0x9B, 0xE3, 0x83, 0xB3, 0x46, 0xE3, 0x83, + 0x9F, 0xE3, 0x83, 0xAA, 0x46, 0xE3, 0x83, 0xAA, + 0xE3, 0x83, 0xA9, 0x46, 0xE3, 0x83, 0xAC, 0xE3, + 0x83, 0xA0, 0x46, 0xE5, 0xA4, 0xA7, 0xE6, 0xAD, + // Bytes 2700 - 273f + 0xA3, 0x46, 0xE5, 0xB9, 0xB3, 0xE6, 0x88, 0x90, + 0x46, 0xE6, 0x98, 0x8E, 0xE6, 0xB2, 0xBB, 0x46, + 0xE6, 0x98, 0xAD, 0xE5, 0x92, 0x8C, 0x47, 0x72, + 0x61, 0x64, 0xE2, 0x88, 0x95, 0x73, 0x47, 0xE3, + 0x80, 0x94, 0x53, 0xE3, 0x80, 0x95, 0x48, 0x28, + 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x29, + 0x48, 0x28, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, + // Bytes 2740 - 277f + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x85, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x86, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x87, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x89, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, + 0x84, 0x8B, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, + 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x29, 0x48, + 0x28, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xAE, 0x29, + // Bytes 2780 - 27bf + 0x48, 0x28, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, + 0x29, 0x48, 0x28, 0xE1, 0x84, 0x8F, 0xE1, 0x85, + 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x90, 0xE1, + 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, 0x91, + 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x28, 0xE1, 0x84, + 0x92, 0xE1, 0x85, 0xA1, 0x29, 0x48, 0x72, 0x61, + 0x64, 0xE2, 0x88, 0x95, 0x73, 0x32, 0x48, 0xD8, + 0xA7, 0xD9, 0x83, 0xD8, 0xA8, 0xD8, 0xB1, 0x48, + // Bytes 27c0 - 27ff + 0xD8, 0xA7, 0xD9, 0x84, 0xD9, 0x84, 0xD9, 0x87, + 0x48, 0xD8, 0xB1, 0xD8, 0xB3, 0xD9, 0x88, 0xD9, + 0x84, 0x48, 0xD8, 0xB1, 0xDB, 0x8C, 0xD8, 0xA7, + 0xD9, 0x84, 0x48, 0xD8, 0xB5, 0xD9, 0x84, 0xD8, + 0xB9, 0xD9, 0x85, 0x48, 0xD8, 0xB9, 0xD9, 0x84, + 0xD9, 0x8A, 0xD9, 0x87, 0x48, 0xD9, 0x85, 0xD8, + 0xAD, 0xD9, 0x85, 0xD8, 0xAF, 0x48, 0xD9, 0x88, + 0xD8, 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x49, 0xE2, + // Bytes 2800 - 283f + 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0x49, 0xE2, 0x80, 0xB5, 0xE2, 0x80, 0xB5, 0xE2, + 0x80, 0xB5, 0x49, 0xE2, 0x88, 0xAB, 0xE2, 0x88, + 0xAB, 0xE2, 0x88, 0xAB, 0x49, 0xE2, 0x88, 0xAE, + 0xE2, 0x88, 0xAE, 0xE2, 0x88, 0xAE, 0x49, 0xE3, + 0x80, 0x94, 0xE4, 0xB8, 0x89, 0xE3, 0x80, 0x95, + 0x49, 0xE3, 0x80, 0x94, 0xE4, 0xBA, 0x8C, 0xE3, + 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE5, 0x8B, + // Bytes 2840 - 287f + 0x9D, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, + 0xE5, 0xAE, 0x89, 0xE3, 0x80, 0x95, 0x49, 0xE3, + 0x80, 0x94, 0xE6, 0x89, 0x93, 0xE3, 0x80, 0x95, + 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x95, 0x97, 0xE3, + 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, 0xE6, 0x9C, + 0xAC, 0xE3, 0x80, 0x95, 0x49, 0xE3, 0x80, 0x94, + 0xE7, 0x82, 0xB9, 0xE3, 0x80, 0x95, 0x49, 0xE3, + 0x80, 0x94, 0xE7, 0x9B, 0x97, 0xE3, 0x80, 0x95, + // Bytes 2880 - 28bf + 0x49, 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0xAB, 0x49, 0xE3, 0x82, 0xA4, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x81, 0x49, 0xE3, 0x82, 0xA6, + 0xE3, 0x82, 0xA9, 0xE3, 0x83, 0xB3, 0x49, 0xE3, + 0x82, 0xAA, 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB9, + 0x49, 0xE3, 0x82, 0xAA, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0xA0, 0x49, 0xE3, 0x82, 0xAB, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAA, 0x49, 0xE3, 0x82, 0xB1, + // Bytes 28c0 - 28ff + 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xB9, 0x49, 0xE3, + 0x82, 0xB3, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x8A, + 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, + 0x83, 0x81, 0x49, 0xE3, 0x82, 0xBB, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x88, 0x49, 0xE3, 0x83, 0x86, + 0xE3, 0x82, 0x99, 0xE3, 0x82, 0xB7, 0x49, 0xE3, + 0x83, 0x88, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, + 0x49, 0xE3, 0x83, 0x8E, 0xE3, 0x83, 0x83, 0xE3, + // Bytes 2900 - 293f + 0x83, 0x88, 0x49, 0xE3, 0x83, 0x8F, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0x84, 0x49, 0xE3, 0x83, 0x92, + 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, 0x49, 0xE3, + 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xB3, + 0x49, 0xE3, 0x83, 0x95, 0xE3, 0x83, 0xA9, 0xE3, + 0x83, 0xB3, 0x49, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x9A, 0xE3, 0x82, 0xBD, 0x49, 0xE3, 0x83, 0x98, + 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x84, 0x49, 0xE3, + // Bytes 2940 - 297f + 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0xAB, + 0x49, 0xE3, 0x83, 0x9B, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0xB3, 0x49, 0xE3, 0x83, 0x9E, 0xE3, 0x82, + 0xA4, 0xE3, 0x83, 0xAB, 0x49, 0xE3, 0x83, 0x9E, + 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x8F, 0x49, 0xE3, + 0x83, 0x9E, 0xE3, 0x83, 0xAB, 0xE3, 0x82, 0xAF, + 0x49, 0xE3, 0x83, 0xA4, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0xAB, 0x49, 0xE3, 0x83, 0xA6, 0xE3, 0x82, + // Bytes 2980 - 29bf + 0xA2, 0xE3, 0x83, 0xB3, 0x49, 0xE3, 0x83, 0xAF, + 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, 0x4C, 0xE2, + 0x80, 0xB2, 0xE2, 0x80, 0xB2, 0xE2, 0x80, 0xB2, + 0xE2, 0x80, 0xB2, 0x4C, 0xE2, 0x88, 0xAB, 0xE2, + 0x88, 0xAB, 0xE2, 0x88, 0xAB, 0xE2, 0x88, 0xAB, + 0x4C, 0xE3, 0x82, 0xA2, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0x95, 0xE3, 0x82, 0xA1, 0x4C, 0xE3, 0x82, + 0xA8, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xAB, 0xE3, + // Bytes 29c0 - 29ff + 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xB3, 0x4C, + 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x9E, 0x4C, 0xE3, 0x82, 0xAB, + 0xE3, 0x83, 0xA9, 0xE3, 0x83, 0x83, 0xE3, 0x83, + 0x88, 0x4C, 0xE3, 0x82, 0xAB, 0xE3, 0x83, 0xAD, + 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, 0x4C, 0xE3, + 0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0x8B, + // Bytes 2a00 - 2a3f + 0xE3, 0x83, 0xBC, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, + 0x83, 0xA5, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xBC, + 0x4C, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, + 0x83, 0xA9, 0xE3, 0x83, 0xA0, 0x4C, 0xE3, 0x82, + 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xBC, 0xE3, + 0x83, 0x8D, 0x4C, 0xE3, 0x82, 0xB5, 0xE3, 0x82, + 0xA4, 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, + 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + // Bytes 2a40 - 2a7f + 0xBC, 0xE3, 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0x84, 0x4C, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x83, 0x95, 0xE3, 0x82, 0xA3, 0xE3, 0x83, 0xBC, + 0xE3, 0x83, 0x88, 0x4C, 0xE3, 0x83, 0x98, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x82, 0xBF, + 0x4C, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, + // Bytes 2a80 - 2abf + 0x83, 0x8B, 0xE3, 0x83, 0x92, 0x4C, 0xE3, 0x83, + 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xB3, 0xE3, + 0x82, 0xB9, 0x4C, 0xE3, 0x83, 0x9B, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xAB, 0xE3, 0x83, 0x88, 0x4C, + 0xE3, 0x83, 0x9E, 0xE3, 0x82, 0xA4, 0xE3, 0x82, + 0xAF, 0xE3, 0x83, 0xAD, 0x4C, 0xE3, 0x83, 0x9F, + 0xE3, 0x82, 0xAF, 0xE3, 0x83, 0xAD, 0xE3, 0x83, + 0xB3, 0x4C, 0xE3, 0x83, 0xA1, 0xE3, 0x83, 0xBC, + // Bytes 2ac0 - 2aff + 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x4C, 0xE3, + 0x83, 0xAA, 0xE3, 0x83, 0x83, 0xE3, 0x83, 0x88, + 0xE3, 0x83, 0xAB, 0x4C, 0xE3, 0x83, 0xAB, 0xE3, + 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0x4C, 0xE6, 0xA0, 0xAA, 0xE5, 0xBC, 0x8F, 0xE4, + 0xBC, 0x9A, 0xE7, 0xA4, 0xBE, 0x4E, 0x28, 0xE1, + 0x84, 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x92, + 0xE1, 0x85, 0xAE, 0x29, 0x4F, 0xD8, 0xAC, 0xD9, + // Bytes 2b00 - 2b3f + 0x84, 0x20, 0xD8, 0xAC, 0xD9, 0x84, 0xD8, 0xA7, + 0xD9, 0x84, 0xD9, 0x87, 0x4F, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xBC, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xA2, + 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x98, 0xE3, 0x82, + 0x9A, 0xE3, 0x82, 0xA2, 0x4F, 0xE3, 0x82, 0xAD, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xAF, 0xE3, 0x83, + 0x83, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x82, 0xB5, + // Bytes 2b40 - 2b7f + 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x81, 0xE3, 0x83, + 0xBC, 0xE3, 0x83, 0xA0, 0x4F, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAC, 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x98, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0xBF, 0xE3, 0x83, + 0xBC, 0xE3, 0x83, 0xAB, 0x4F, 0xE3, 0x83, 0x9B, + 0xE3, 0x82, 0x9A, 0xE3, 0x82, 0xA4, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x88, 0x4F, 0xE3, 0x83, 0x9E, + // Bytes 2b80 - 2bbf + 0xE3, 0x83, 0xB3, 0xE3, 0x82, 0xB7, 0xE3, 0x83, + 0xA7, 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xA1, + 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0x88, 0xE3, 0x83, 0xB3, 0x4F, 0xE3, 0x83, 0xAB, + 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x95, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xAB, 0x51, 0x28, 0xE1, 0x84, + 0x8B, 0xE1, 0x85, 0xA9, 0xE1, 0x84, 0x8C, 0xE1, + 0x85, 0xA5, 0xE1, 0x86, 0xAB, 0x29, 0x52, 0xE3, + // Bytes 2bc0 - 2bff + 0x82, 0xAD, 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xAB, + 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xBC, 0x52, 0xE3, 0x82, 0xAD, 0xE3, 0x83, 0xAD, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + 0xA9, 0xE3, 0x83, 0xA0, 0x52, 0xE3, 0x82, 0xAD, + 0xE3, 0x83, 0xAD, 0xE3, 0x83, 0xA1, 0xE3, 0x83, + 0xBC, 0xE3, 0x83, 0x88, 0xE3, 0x83, 0xAB, 0x52, + 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0xE3, 0x83, + // Bytes 2c00 - 2c3f + 0xA9, 0xE3, 0x83, 0xA0, 0xE3, 0x83, 0x88, 0xE3, + 0x83, 0xB3, 0x52, 0xE3, 0x82, 0xAF, 0xE3, 0x83, + 0xAB, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0xE3, + 0x82, 0xA4, 0xE3, 0x83, 0xAD, 0x52, 0xE3, 0x83, + 0x8F, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, 0xE3, + 0x82, 0xBB, 0xE3, 0x83, 0xB3, 0xE3, 0x83, 0x88, + 0x52, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0xE3, + 0x82, 0xA2, 0xE3, 0x82, 0xB9, 0xE3, 0x83, 0x88, + // Bytes 2c40 - 2c7f + 0xE3, 0x83, 0xAB, 0x52, 0xE3, 0x83, 0x95, 0xE3, + 0x82, 0x99, 0xE3, 0x83, 0x83, 0xE3, 0x82, 0xB7, + 0xE3, 0x82, 0xA7, 0xE3, 0x83, 0xAB, 0x52, 0xE3, + 0x83, 0x9F, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0x8F, + 0xE3, 0x82, 0x99, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + 0xAB, 0x52, 0xE3, 0x83, 0xAC, 0xE3, 0x83, 0xB3, + 0xE3, 0x83, 0x88, 0xE3, 0x82, 0xB1, 0xE3, 0x82, + 0x99, 0xE3, 0x83, 0xB3, 0x61, 0xD8, 0xB5, 0xD9, + // Bytes 2c80 - 2cbf + 0x84, 0xD9, 0x89, 0x20, 0xD8, 0xA7, 0xD9, 0x84, + 0xD9, 0x84, 0xD9, 0x87, 0x20, 0xD8, 0xB9, 0xD9, + 0x84, 0xD9, 0x8A, 0xD9, 0x87, 0x20, 0xD9, 0x88, + 0xD8, 0xB3, 0xD9, 0x84, 0xD9, 0x85, 0x06, 0xE0, + 0xA7, 0x87, 0xE0, 0xA6, 0xBE, 0x01, 0x06, 0xE0, + 0xA7, 0x87, 0xE0, 0xA7, 0x97, 0x01, 0x06, 0xE0, + 0xAD, 0x87, 0xE0, 0xAC, 0xBE, 0x01, 0x06, 0xE0, + 0xAD, 0x87, 0xE0, 0xAD, 0x96, 0x01, 0x06, 0xE0, + // Bytes 2cc0 - 2cff + 0xAD, 0x87, 0xE0, 0xAD, 0x97, 0x01, 0x06, 0xE0, + 0xAE, 0x92, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, + 0xAF, 0x86, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, + 0xAF, 0x86, 0xE0, 0xAF, 0x97, 0x01, 0x06, 0xE0, + 0xAF, 0x87, 0xE0, 0xAE, 0xBE, 0x01, 0x06, 0xE0, + 0xB2, 0xBF, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, + 0xB3, 0x86, 0xE0, 0xB3, 0x95, 0x01, 0x06, 0xE0, + 0xB3, 0x86, 0xE0, 0xB3, 0x96, 0x01, 0x06, 0xE0, + // Bytes 2d00 - 2d3f + 0xB5, 0x86, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, + 0xB5, 0x86, 0xE0, 0xB5, 0x97, 0x01, 0x06, 0xE0, + 0xB5, 0x87, 0xE0, 0xB4, 0xBE, 0x01, 0x06, 0xE0, + 0xB7, 0x99, 0xE0, 0xB7, 0x9F, 0x01, 0x06, 0xE1, + 0x80, 0xA5, 0xE1, 0x80, 0xAE, 0x01, 0x06, 0xE1, + 0xAC, 0x85, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0x87, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0x89, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + // Bytes 2d40 - 2d7f + 0xAC, 0x8B, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0x8D, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0x91, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0xBA, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0xBC, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0xBE, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAC, 0xBF, 0xE1, 0xAC, 0xB5, 0x01, 0x06, 0xE1, + 0xAD, 0x82, 0xE1, 0xAC, 0xB5, 0x01, 0x08, 0xF0, + // Bytes 2d80 - 2dbf + 0x91, 0x84, 0xB1, 0xF0, 0x91, 0x84, 0xA7, 0x01, + 0x08, 0xF0, 0x91, 0x84, 0xB2, 0xF0, 0x91, 0x84, + 0xA7, 0x01, 0x08, 0xF0, 0x91, 0x8D, 0x87, 0xF0, + 0x91, 0x8C, 0xBE, 0x01, 0x08, 0xF0, 0x91, 0x8D, + 0x87, 0xF0, 0x91, 0x8D, 0x97, 0x01, 0x08, 0xF0, + 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, 0xB0, 0x01, + 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, 0x91, 0x92, + 0xBA, 0x01, 0x08, 0xF0, 0x91, 0x92, 0xB9, 0xF0, + // Bytes 2dc0 - 2dff + 0x91, 0x92, 0xBD, 0x01, 0x08, 0xF0, 0x91, 0x96, + 0xB8, 0xF0, 0x91, 0x96, 0xAF, 0x01, 0x08, 0xF0, + 0x91, 0x96, 0xB9, 0xF0, 0x91, 0x96, 0xAF, 0x01, + 0x09, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0xE0, + 0xB3, 0x95, 0x02, 0x09, 0xE0, 0xB7, 0x99, 0xE0, + 0xB7, 0x8F, 0xE0, 0xB7, 0x8A, 0x12, 0x44, 0x44, + 0x5A, 0xCC, 0x8C, 0xC9, 0x44, 0x44, 0x7A, 0xCC, + 0x8C, 0xC9, 0x44, 0x64, 0x7A, 0xCC, 0x8C, 0xC9, + // Bytes 2e00 - 2e3f + 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x93, 0xC9, + 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x94, 0xC9, + 0x46, 0xD9, 0x84, 0xD8, 0xA7, 0xD9, 0x95, 0xB5, + 0x46, 0xE1, 0x84, 0x80, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x82, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x83, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x85, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x86, 0xE1, 0x85, 0xA1, 0x01, + // Bytes 2e40 - 2e7f + 0x46, 0xE1, 0x84, 0x87, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x89, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xAE, 0x01, + 0x46, 0xE1, 0x84, 0x8C, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x8E, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x8F, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x90, 0xE1, 0x85, 0xA1, 0x01, + // Bytes 2e80 - 2ebf + 0x46, 0xE1, 0x84, 0x91, 0xE1, 0x85, 0xA1, 0x01, + 0x46, 0xE1, 0x84, 0x92, 0xE1, 0x85, 0xA1, 0x01, + 0x49, 0xE3, 0x83, 0xA1, 0xE3, 0x82, 0xAB, 0xE3, + 0x82, 0x99, 0x0D, 0x4C, 0xE1, 0x84, 0x8C, 0xE1, + 0x85, 0xAE, 0xE1, 0x84, 0x8B, 0xE1, 0x85, 0xB4, + 0x01, 0x4C, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, + 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x0D, 0x4C, + 0xE3, 0x82, 0xB3, 0xE3, 0x83, 0xBC, 0xE3, 0x83, + // Bytes 2ec0 - 2eff + 0x9B, 0xE3, 0x82, 0x9A, 0x0D, 0x4C, 0xE3, 0x83, + 0xA4, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, 0xE3, + 0x82, 0x99, 0x0D, 0x4F, 0xE1, 0x84, 0x8E, 0xE1, + 0x85, 0xA1, 0xE1, 0x86, 0xB7, 0xE1, 0x84, 0x80, + 0xE1, 0x85, 0xA9, 0x01, 0x4F, 0xE3, 0x82, 0xA4, + 0xE3, 0x83, 0x8B, 0xE3, 0x83, 0xB3, 0xE3, 0x82, + 0xAF, 0xE3, 0x82, 0x99, 0x0D, 0x4F, 0xE3, 0x82, + 0xB7, 0xE3, 0x83, 0xAA, 0xE3, 0x83, 0xB3, 0xE3, + // Bytes 2f00 - 2f3f + 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x0D, 0x4F, 0xE3, + 0x83, 0x98, 0xE3, 0x82, 0x9A, 0xE3, 0x83, 0xBC, + 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x0D, 0x4F, + 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0xE3, 0x83, + 0xB3, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D, + 0x52, 0xE3, 0x82, 0xA8, 0xE3, 0x82, 0xB9, 0xE3, + 0x82, 0xAF, 0xE3, 0x83, 0xBC, 0xE3, 0x83, 0x88, + 0xE3, 0x82, 0x99, 0x0D, 0x52, 0xE3, 0x83, 0x95, + // Bytes 2f40 - 2f7f + 0xE3, 0x82, 0xA1, 0xE3, 0x83, 0xA9, 0xE3, 0x83, + 0x83, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D, + 0x86, 0xE0, 0xB3, 0x86, 0xE0, 0xB3, 0x82, 0x01, + 0x86, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8F, 0x01, + 0x03, 0x3C, 0xCC, 0xB8, 0x05, 0x03, 0x3D, 0xCC, + 0xB8, 0x05, 0x03, 0x3E, 0xCC, 0xB8, 0x05, 0x03, + 0x41, 0xCC, 0x80, 0xC9, 0x03, 0x41, 0xCC, 0x81, + 0xC9, 0x03, 0x41, 0xCC, 0x83, 0xC9, 0x03, 0x41, + // Bytes 2f80 - 2fbf + 0xCC, 0x84, 0xC9, 0x03, 0x41, 0xCC, 0x89, 0xC9, + 0x03, 0x41, 0xCC, 0x8C, 0xC9, 0x03, 0x41, 0xCC, + 0x8F, 0xC9, 0x03, 0x41, 0xCC, 0x91, 0xC9, 0x03, + 0x41, 0xCC, 0xA5, 0xB5, 0x03, 0x41, 0xCC, 0xA8, + 0xA5, 0x03, 0x42, 0xCC, 0x87, 0xC9, 0x03, 0x42, + 0xCC, 0xA3, 0xB5, 0x03, 0x42, 0xCC, 0xB1, 0xB5, + 0x03, 0x43, 0xCC, 0x81, 0xC9, 0x03, 0x43, 0xCC, + 0x82, 0xC9, 0x03, 0x43, 0xCC, 0x87, 0xC9, 0x03, + // Bytes 2fc0 - 2fff + 0x43, 0xCC, 0x8C, 0xC9, 0x03, 0x44, 0xCC, 0x87, + 0xC9, 0x03, 0x44, 0xCC, 0x8C, 0xC9, 0x03, 0x44, + 0xCC, 0xA3, 0xB5, 0x03, 0x44, 0xCC, 0xA7, 0xA5, + 0x03, 0x44, 0xCC, 0xAD, 0xB5, 0x03, 0x44, 0xCC, + 0xB1, 0xB5, 0x03, 0x45, 0xCC, 0x80, 0xC9, 0x03, + 0x45, 0xCC, 0x81, 0xC9, 0x03, 0x45, 0xCC, 0x83, + 0xC9, 0x03, 0x45, 0xCC, 0x86, 0xC9, 0x03, 0x45, + 0xCC, 0x87, 0xC9, 0x03, 0x45, 0xCC, 0x88, 0xC9, + // Bytes 3000 - 303f + 0x03, 0x45, 0xCC, 0x89, 0xC9, 0x03, 0x45, 0xCC, + 0x8C, 0xC9, 0x03, 0x45, 0xCC, 0x8F, 0xC9, 0x03, + 0x45, 0xCC, 0x91, 0xC9, 0x03, 0x45, 0xCC, 0xA8, + 0xA5, 0x03, 0x45, 0xCC, 0xAD, 0xB5, 0x03, 0x45, + 0xCC, 0xB0, 0xB5, 0x03, 0x46, 0xCC, 0x87, 0xC9, + 0x03, 0x47, 0xCC, 0x81, 0xC9, 0x03, 0x47, 0xCC, + 0x82, 0xC9, 0x03, 0x47, 0xCC, 0x84, 0xC9, 0x03, + 0x47, 0xCC, 0x86, 0xC9, 0x03, 0x47, 0xCC, 0x87, + // Bytes 3040 - 307f + 0xC9, 0x03, 0x47, 0xCC, 0x8C, 0xC9, 0x03, 0x47, + 0xCC, 0xA7, 0xA5, 0x03, 0x48, 0xCC, 0x82, 0xC9, + 0x03, 0x48, 0xCC, 0x87, 0xC9, 0x03, 0x48, 0xCC, + 0x88, 0xC9, 0x03, 0x48, 0xCC, 0x8C, 0xC9, 0x03, + 0x48, 0xCC, 0xA3, 0xB5, 0x03, 0x48, 0xCC, 0xA7, + 0xA5, 0x03, 0x48, 0xCC, 0xAE, 0xB5, 0x03, 0x49, + 0xCC, 0x80, 0xC9, 0x03, 0x49, 0xCC, 0x81, 0xC9, + 0x03, 0x49, 0xCC, 0x82, 0xC9, 0x03, 0x49, 0xCC, + // Bytes 3080 - 30bf + 0x83, 0xC9, 0x03, 0x49, 0xCC, 0x84, 0xC9, 0x03, + 0x49, 0xCC, 0x86, 0xC9, 0x03, 0x49, 0xCC, 0x87, + 0xC9, 0x03, 0x49, 0xCC, 0x89, 0xC9, 0x03, 0x49, + 0xCC, 0x8C, 0xC9, 0x03, 0x49, 0xCC, 0x8F, 0xC9, + 0x03, 0x49, 0xCC, 0x91, 0xC9, 0x03, 0x49, 0xCC, + 0xA3, 0xB5, 0x03, 0x49, 0xCC, 0xA8, 0xA5, 0x03, + 0x49, 0xCC, 0xB0, 0xB5, 0x03, 0x4A, 0xCC, 0x82, + 0xC9, 0x03, 0x4B, 0xCC, 0x81, 0xC9, 0x03, 0x4B, + // Bytes 30c0 - 30ff + 0xCC, 0x8C, 0xC9, 0x03, 0x4B, 0xCC, 0xA3, 0xB5, + 0x03, 0x4B, 0xCC, 0xA7, 0xA5, 0x03, 0x4B, 0xCC, + 0xB1, 0xB5, 0x03, 0x4C, 0xCC, 0x81, 0xC9, 0x03, + 0x4C, 0xCC, 0x8C, 0xC9, 0x03, 0x4C, 0xCC, 0xA7, + 0xA5, 0x03, 0x4C, 0xCC, 0xAD, 0xB5, 0x03, 0x4C, + 0xCC, 0xB1, 0xB5, 0x03, 0x4D, 0xCC, 0x81, 0xC9, + 0x03, 0x4D, 0xCC, 0x87, 0xC9, 0x03, 0x4D, 0xCC, + 0xA3, 0xB5, 0x03, 0x4E, 0xCC, 0x80, 0xC9, 0x03, + // Bytes 3100 - 313f + 0x4E, 0xCC, 0x81, 0xC9, 0x03, 0x4E, 0xCC, 0x83, + 0xC9, 0x03, 0x4E, 0xCC, 0x87, 0xC9, 0x03, 0x4E, + 0xCC, 0x8C, 0xC9, 0x03, 0x4E, 0xCC, 0xA3, 0xB5, + 0x03, 0x4E, 0xCC, 0xA7, 0xA5, 0x03, 0x4E, 0xCC, + 0xAD, 0xB5, 0x03, 0x4E, 0xCC, 0xB1, 0xB5, 0x03, + 0x4F, 0xCC, 0x80, 0xC9, 0x03, 0x4F, 0xCC, 0x81, + 0xC9, 0x03, 0x4F, 0xCC, 0x86, 0xC9, 0x03, 0x4F, + 0xCC, 0x89, 0xC9, 0x03, 0x4F, 0xCC, 0x8B, 0xC9, + // Bytes 3140 - 317f + 0x03, 0x4F, 0xCC, 0x8C, 0xC9, 0x03, 0x4F, 0xCC, + 0x8F, 0xC9, 0x03, 0x4F, 0xCC, 0x91, 0xC9, 0x03, + 0x50, 0xCC, 0x81, 0xC9, 0x03, 0x50, 0xCC, 0x87, + 0xC9, 0x03, 0x52, 0xCC, 0x81, 0xC9, 0x03, 0x52, + 0xCC, 0x87, 0xC9, 0x03, 0x52, 0xCC, 0x8C, 0xC9, + 0x03, 0x52, 0xCC, 0x8F, 0xC9, 0x03, 0x52, 0xCC, + 0x91, 0xC9, 0x03, 0x52, 0xCC, 0xA7, 0xA5, 0x03, + 0x52, 0xCC, 0xB1, 0xB5, 0x03, 0x53, 0xCC, 0x82, + // Bytes 3180 - 31bf + 0xC9, 0x03, 0x53, 0xCC, 0x87, 0xC9, 0x03, 0x53, + 0xCC, 0xA6, 0xB5, 0x03, 0x53, 0xCC, 0xA7, 0xA5, + 0x03, 0x54, 0xCC, 0x87, 0xC9, 0x03, 0x54, 0xCC, + 0x8C, 0xC9, 0x03, 0x54, 0xCC, 0xA3, 0xB5, 0x03, + 0x54, 0xCC, 0xA6, 0xB5, 0x03, 0x54, 0xCC, 0xA7, + 0xA5, 0x03, 0x54, 0xCC, 0xAD, 0xB5, 0x03, 0x54, + 0xCC, 0xB1, 0xB5, 0x03, 0x55, 0xCC, 0x80, 0xC9, + 0x03, 0x55, 0xCC, 0x81, 0xC9, 0x03, 0x55, 0xCC, + // Bytes 31c0 - 31ff + 0x82, 0xC9, 0x03, 0x55, 0xCC, 0x86, 0xC9, 0x03, + 0x55, 0xCC, 0x89, 0xC9, 0x03, 0x55, 0xCC, 0x8A, + 0xC9, 0x03, 0x55, 0xCC, 0x8B, 0xC9, 0x03, 0x55, + 0xCC, 0x8C, 0xC9, 0x03, 0x55, 0xCC, 0x8F, 0xC9, + 0x03, 0x55, 0xCC, 0x91, 0xC9, 0x03, 0x55, 0xCC, + 0xA3, 0xB5, 0x03, 0x55, 0xCC, 0xA4, 0xB5, 0x03, + 0x55, 0xCC, 0xA8, 0xA5, 0x03, 0x55, 0xCC, 0xAD, + 0xB5, 0x03, 0x55, 0xCC, 0xB0, 0xB5, 0x03, 0x56, + // Bytes 3200 - 323f + 0xCC, 0x83, 0xC9, 0x03, 0x56, 0xCC, 0xA3, 0xB5, + 0x03, 0x57, 0xCC, 0x80, 0xC9, 0x03, 0x57, 0xCC, + 0x81, 0xC9, 0x03, 0x57, 0xCC, 0x82, 0xC9, 0x03, + 0x57, 0xCC, 0x87, 0xC9, 0x03, 0x57, 0xCC, 0x88, + 0xC9, 0x03, 0x57, 0xCC, 0xA3, 0xB5, 0x03, 0x58, + 0xCC, 0x87, 0xC9, 0x03, 0x58, 0xCC, 0x88, 0xC9, + 0x03, 0x59, 0xCC, 0x80, 0xC9, 0x03, 0x59, 0xCC, + 0x81, 0xC9, 0x03, 0x59, 0xCC, 0x82, 0xC9, 0x03, + // Bytes 3240 - 327f + 0x59, 0xCC, 0x83, 0xC9, 0x03, 0x59, 0xCC, 0x84, + 0xC9, 0x03, 0x59, 0xCC, 0x87, 0xC9, 0x03, 0x59, + 0xCC, 0x88, 0xC9, 0x03, 0x59, 0xCC, 0x89, 0xC9, + 0x03, 0x59, 0xCC, 0xA3, 0xB5, 0x03, 0x5A, 0xCC, + 0x81, 0xC9, 0x03, 0x5A, 0xCC, 0x82, 0xC9, 0x03, + 0x5A, 0xCC, 0x87, 0xC9, 0x03, 0x5A, 0xCC, 0x8C, + 0xC9, 0x03, 0x5A, 0xCC, 0xA3, 0xB5, 0x03, 0x5A, + 0xCC, 0xB1, 0xB5, 0x03, 0x61, 0xCC, 0x80, 0xC9, + // Bytes 3280 - 32bf + 0x03, 0x61, 0xCC, 0x81, 0xC9, 0x03, 0x61, 0xCC, + 0x83, 0xC9, 0x03, 0x61, 0xCC, 0x84, 0xC9, 0x03, + 0x61, 0xCC, 0x89, 0xC9, 0x03, 0x61, 0xCC, 0x8C, + 0xC9, 0x03, 0x61, 0xCC, 0x8F, 0xC9, 0x03, 0x61, + 0xCC, 0x91, 0xC9, 0x03, 0x61, 0xCC, 0xA5, 0xB5, + 0x03, 0x61, 0xCC, 0xA8, 0xA5, 0x03, 0x62, 0xCC, + 0x87, 0xC9, 0x03, 0x62, 0xCC, 0xA3, 0xB5, 0x03, + 0x62, 0xCC, 0xB1, 0xB5, 0x03, 0x63, 0xCC, 0x81, + // Bytes 32c0 - 32ff + 0xC9, 0x03, 0x63, 0xCC, 0x82, 0xC9, 0x03, 0x63, + 0xCC, 0x87, 0xC9, 0x03, 0x63, 0xCC, 0x8C, 0xC9, + 0x03, 0x64, 0xCC, 0x87, 0xC9, 0x03, 0x64, 0xCC, + 0x8C, 0xC9, 0x03, 0x64, 0xCC, 0xA3, 0xB5, 0x03, + 0x64, 0xCC, 0xA7, 0xA5, 0x03, 0x64, 0xCC, 0xAD, + 0xB5, 0x03, 0x64, 0xCC, 0xB1, 0xB5, 0x03, 0x65, + 0xCC, 0x80, 0xC9, 0x03, 0x65, 0xCC, 0x81, 0xC9, + 0x03, 0x65, 0xCC, 0x83, 0xC9, 0x03, 0x65, 0xCC, + // Bytes 3300 - 333f + 0x86, 0xC9, 0x03, 0x65, 0xCC, 0x87, 0xC9, 0x03, + 0x65, 0xCC, 0x88, 0xC9, 0x03, 0x65, 0xCC, 0x89, + 0xC9, 0x03, 0x65, 0xCC, 0x8C, 0xC9, 0x03, 0x65, + 0xCC, 0x8F, 0xC9, 0x03, 0x65, 0xCC, 0x91, 0xC9, + 0x03, 0x65, 0xCC, 0xA8, 0xA5, 0x03, 0x65, 0xCC, + 0xAD, 0xB5, 0x03, 0x65, 0xCC, 0xB0, 0xB5, 0x03, + 0x66, 0xCC, 0x87, 0xC9, 0x03, 0x67, 0xCC, 0x81, + 0xC9, 0x03, 0x67, 0xCC, 0x82, 0xC9, 0x03, 0x67, + // Bytes 3340 - 337f + 0xCC, 0x84, 0xC9, 0x03, 0x67, 0xCC, 0x86, 0xC9, + 0x03, 0x67, 0xCC, 0x87, 0xC9, 0x03, 0x67, 0xCC, + 0x8C, 0xC9, 0x03, 0x67, 0xCC, 0xA7, 0xA5, 0x03, + 0x68, 0xCC, 0x82, 0xC9, 0x03, 0x68, 0xCC, 0x87, + 0xC9, 0x03, 0x68, 0xCC, 0x88, 0xC9, 0x03, 0x68, + 0xCC, 0x8C, 0xC9, 0x03, 0x68, 0xCC, 0xA3, 0xB5, + 0x03, 0x68, 0xCC, 0xA7, 0xA5, 0x03, 0x68, 0xCC, + 0xAE, 0xB5, 0x03, 0x68, 0xCC, 0xB1, 0xB5, 0x03, + // Bytes 3380 - 33bf + 0x69, 0xCC, 0x80, 0xC9, 0x03, 0x69, 0xCC, 0x81, + 0xC9, 0x03, 0x69, 0xCC, 0x82, 0xC9, 0x03, 0x69, + 0xCC, 0x83, 0xC9, 0x03, 0x69, 0xCC, 0x84, 0xC9, + 0x03, 0x69, 0xCC, 0x86, 0xC9, 0x03, 0x69, 0xCC, + 0x89, 0xC9, 0x03, 0x69, 0xCC, 0x8C, 0xC9, 0x03, + 0x69, 0xCC, 0x8F, 0xC9, 0x03, 0x69, 0xCC, 0x91, + 0xC9, 0x03, 0x69, 0xCC, 0xA3, 0xB5, 0x03, 0x69, + 0xCC, 0xA8, 0xA5, 0x03, 0x69, 0xCC, 0xB0, 0xB5, + // Bytes 33c0 - 33ff + 0x03, 0x6A, 0xCC, 0x82, 0xC9, 0x03, 0x6A, 0xCC, + 0x8C, 0xC9, 0x03, 0x6B, 0xCC, 0x81, 0xC9, 0x03, + 0x6B, 0xCC, 0x8C, 0xC9, 0x03, 0x6B, 0xCC, 0xA3, + 0xB5, 0x03, 0x6B, 0xCC, 0xA7, 0xA5, 0x03, 0x6B, + 0xCC, 0xB1, 0xB5, 0x03, 0x6C, 0xCC, 0x81, 0xC9, + 0x03, 0x6C, 0xCC, 0x8C, 0xC9, 0x03, 0x6C, 0xCC, + 0xA7, 0xA5, 0x03, 0x6C, 0xCC, 0xAD, 0xB5, 0x03, + 0x6C, 0xCC, 0xB1, 0xB5, 0x03, 0x6D, 0xCC, 0x81, + // Bytes 3400 - 343f + 0xC9, 0x03, 0x6D, 0xCC, 0x87, 0xC9, 0x03, 0x6D, + 0xCC, 0xA3, 0xB5, 0x03, 0x6E, 0xCC, 0x80, 0xC9, + 0x03, 0x6E, 0xCC, 0x81, 0xC9, 0x03, 0x6E, 0xCC, + 0x83, 0xC9, 0x03, 0x6E, 0xCC, 0x87, 0xC9, 0x03, + 0x6E, 0xCC, 0x8C, 0xC9, 0x03, 0x6E, 0xCC, 0xA3, + 0xB5, 0x03, 0x6E, 0xCC, 0xA7, 0xA5, 0x03, 0x6E, + 0xCC, 0xAD, 0xB5, 0x03, 0x6E, 0xCC, 0xB1, 0xB5, + 0x03, 0x6F, 0xCC, 0x80, 0xC9, 0x03, 0x6F, 0xCC, + // Bytes 3440 - 347f + 0x81, 0xC9, 0x03, 0x6F, 0xCC, 0x86, 0xC9, 0x03, + 0x6F, 0xCC, 0x89, 0xC9, 0x03, 0x6F, 0xCC, 0x8B, + 0xC9, 0x03, 0x6F, 0xCC, 0x8C, 0xC9, 0x03, 0x6F, + 0xCC, 0x8F, 0xC9, 0x03, 0x6F, 0xCC, 0x91, 0xC9, + 0x03, 0x70, 0xCC, 0x81, 0xC9, 0x03, 0x70, 0xCC, + 0x87, 0xC9, 0x03, 0x72, 0xCC, 0x81, 0xC9, 0x03, + 0x72, 0xCC, 0x87, 0xC9, 0x03, 0x72, 0xCC, 0x8C, + 0xC9, 0x03, 0x72, 0xCC, 0x8F, 0xC9, 0x03, 0x72, + // Bytes 3480 - 34bf + 0xCC, 0x91, 0xC9, 0x03, 0x72, 0xCC, 0xA7, 0xA5, + 0x03, 0x72, 0xCC, 0xB1, 0xB5, 0x03, 0x73, 0xCC, + 0x82, 0xC9, 0x03, 0x73, 0xCC, 0x87, 0xC9, 0x03, + 0x73, 0xCC, 0xA6, 0xB5, 0x03, 0x73, 0xCC, 0xA7, + 0xA5, 0x03, 0x74, 0xCC, 0x87, 0xC9, 0x03, 0x74, + 0xCC, 0x88, 0xC9, 0x03, 0x74, 0xCC, 0x8C, 0xC9, + 0x03, 0x74, 0xCC, 0xA3, 0xB5, 0x03, 0x74, 0xCC, + 0xA6, 0xB5, 0x03, 0x74, 0xCC, 0xA7, 0xA5, 0x03, + // Bytes 34c0 - 34ff + 0x74, 0xCC, 0xAD, 0xB5, 0x03, 0x74, 0xCC, 0xB1, + 0xB5, 0x03, 0x75, 0xCC, 0x80, 0xC9, 0x03, 0x75, + 0xCC, 0x81, 0xC9, 0x03, 0x75, 0xCC, 0x82, 0xC9, + 0x03, 0x75, 0xCC, 0x86, 0xC9, 0x03, 0x75, 0xCC, + 0x89, 0xC9, 0x03, 0x75, 0xCC, 0x8A, 0xC9, 0x03, + 0x75, 0xCC, 0x8B, 0xC9, 0x03, 0x75, 0xCC, 0x8C, + 0xC9, 0x03, 0x75, 0xCC, 0x8F, 0xC9, 0x03, 0x75, + 0xCC, 0x91, 0xC9, 0x03, 0x75, 0xCC, 0xA3, 0xB5, + // Bytes 3500 - 353f + 0x03, 0x75, 0xCC, 0xA4, 0xB5, 0x03, 0x75, 0xCC, + 0xA8, 0xA5, 0x03, 0x75, 0xCC, 0xAD, 0xB5, 0x03, + 0x75, 0xCC, 0xB0, 0xB5, 0x03, 0x76, 0xCC, 0x83, + 0xC9, 0x03, 0x76, 0xCC, 0xA3, 0xB5, 0x03, 0x77, + 0xCC, 0x80, 0xC9, 0x03, 0x77, 0xCC, 0x81, 0xC9, + 0x03, 0x77, 0xCC, 0x82, 0xC9, 0x03, 0x77, 0xCC, + 0x87, 0xC9, 0x03, 0x77, 0xCC, 0x88, 0xC9, 0x03, + 0x77, 0xCC, 0x8A, 0xC9, 0x03, 0x77, 0xCC, 0xA3, + // Bytes 3540 - 357f + 0xB5, 0x03, 0x78, 0xCC, 0x87, 0xC9, 0x03, 0x78, + 0xCC, 0x88, 0xC9, 0x03, 0x79, 0xCC, 0x80, 0xC9, + 0x03, 0x79, 0xCC, 0x81, 0xC9, 0x03, 0x79, 0xCC, + 0x82, 0xC9, 0x03, 0x79, 0xCC, 0x83, 0xC9, 0x03, + 0x79, 0xCC, 0x84, 0xC9, 0x03, 0x79, 0xCC, 0x87, + 0xC9, 0x03, 0x79, 0xCC, 0x88, 0xC9, 0x03, 0x79, + 0xCC, 0x89, 0xC9, 0x03, 0x79, 0xCC, 0x8A, 0xC9, + 0x03, 0x79, 0xCC, 0xA3, 0xB5, 0x03, 0x7A, 0xCC, + // Bytes 3580 - 35bf + 0x81, 0xC9, 0x03, 0x7A, 0xCC, 0x82, 0xC9, 0x03, + 0x7A, 0xCC, 0x87, 0xC9, 0x03, 0x7A, 0xCC, 0x8C, + 0xC9, 0x03, 0x7A, 0xCC, 0xA3, 0xB5, 0x03, 0x7A, + 0xCC, 0xB1, 0xB5, 0x04, 0xC2, 0xA8, 0xCC, 0x80, + 0xCA, 0x04, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x04, + 0xC2, 0xA8, 0xCD, 0x82, 0xCA, 0x04, 0xC3, 0x86, + 0xCC, 0x81, 0xC9, 0x04, 0xC3, 0x86, 0xCC, 0x84, + 0xC9, 0x04, 0xC3, 0x98, 0xCC, 0x81, 0xC9, 0x04, + // Bytes 35c0 - 35ff + 0xC3, 0xA6, 0xCC, 0x81, 0xC9, 0x04, 0xC3, 0xA6, + 0xCC, 0x84, 0xC9, 0x04, 0xC3, 0xB8, 0xCC, 0x81, + 0xC9, 0x04, 0xC5, 0xBF, 0xCC, 0x87, 0xC9, 0x04, + 0xC6, 0xB7, 0xCC, 0x8C, 0xC9, 0x04, 0xCA, 0x92, + 0xCC, 0x8C, 0xC9, 0x04, 0xCE, 0x91, 0xCC, 0x80, + 0xC9, 0x04, 0xCE, 0x91, 0xCC, 0x81, 0xC9, 0x04, + 0xCE, 0x91, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0x91, + 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0x91, 0xCD, 0x85, + // Bytes 3600 - 363f + 0xD9, 0x04, 0xCE, 0x95, 0xCC, 0x80, 0xC9, 0x04, + 0xCE, 0x95, 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0x97, + 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x97, 0xCC, 0x81, + 0xC9, 0x04, 0xCE, 0x97, 0xCD, 0x85, 0xD9, 0x04, + 0xCE, 0x99, 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x99, + 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0x99, 0xCC, 0x84, + 0xC9, 0x04, 0xCE, 0x99, 0xCC, 0x86, 0xC9, 0x04, + 0xCE, 0x99, 0xCC, 0x88, 0xC9, 0x04, 0xCE, 0x9F, + // Bytes 3640 - 367f + 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0x9F, 0xCC, 0x81, + 0xC9, 0x04, 0xCE, 0xA1, 0xCC, 0x94, 0xC9, 0x04, + 0xCE, 0xA5, 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0xA5, + 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0xA5, 0xCC, 0x84, + 0xC9, 0x04, 0xCE, 0xA5, 0xCC, 0x86, 0xC9, 0x04, + 0xCE, 0xA5, 0xCC, 0x88, 0xC9, 0x04, 0xCE, 0xA9, + 0xCC, 0x80, 0xC9, 0x04, 0xCE, 0xA9, 0xCC, 0x81, + 0xC9, 0x04, 0xCE, 0xA9, 0xCD, 0x85, 0xD9, 0x04, + // Bytes 3680 - 36bf + 0xCE, 0xB1, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0xB1, + 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0xB1, 0xCD, 0x85, + 0xD9, 0x04, 0xCE, 0xB5, 0xCC, 0x80, 0xC9, 0x04, + 0xCE, 0xB5, 0xCC, 0x81, 0xC9, 0x04, 0xCE, 0xB7, + 0xCD, 0x85, 0xD9, 0x04, 0xCE, 0xB9, 0xCC, 0x80, + 0xC9, 0x04, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x04, + 0xCE, 0xB9, 0xCC, 0x84, 0xC9, 0x04, 0xCE, 0xB9, + 0xCC, 0x86, 0xC9, 0x04, 0xCE, 0xB9, 0xCD, 0x82, + // Bytes 36c0 - 36ff + 0xC9, 0x04, 0xCE, 0xBF, 0xCC, 0x80, 0xC9, 0x04, + 0xCE, 0xBF, 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x81, + 0xCC, 0x93, 0xC9, 0x04, 0xCF, 0x81, 0xCC, 0x94, + 0xC9, 0x04, 0xCF, 0x85, 0xCC, 0x80, 0xC9, 0x04, + 0xCF, 0x85, 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x85, + 0xCC, 0x84, 0xC9, 0x04, 0xCF, 0x85, 0xCC, 0x86, + 0xC9, 0x04, 0xCF, 0x85, 0xCD, 0x82, 0xC9, 0x04, + 0xCF, 0x89, 0xCD, 0x85, 0xD9, 0x04, 0xCF, 0x92, + // Bytes 3700 - 373f + 0xCC, 0x81, 0xC9, 0x04, 0xCF, 0x92, 0xCC, 0x88, + 0xC9, 0x04, 0xD0, 0x86, 0xCC, 0x88, 0xC9, 0x04, + 0xD0, 0x90, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0x90, + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x93, 0xCC, 0x81, + 0xC9, 0x04, 0xD0, 0x95, 0xCC, 0x80, 0xC9, 0x04, + 0xD0, 0x95, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0x95, + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x96, 0xCC, 0x86, + 0xC9, 0x04, 0xD0, 0x96, 0xCC, 0x88, 0xC9, 0x04, + // Bytes 3740 - 377f + 0xD0, 0x97, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x98, + 0xCC, 0x80, 0xC9, 0x04, 0xD0, 0x98, 0xCC, 0x84, + 0xC9, 0x04, 0xD0, 0x98, 0xCC, 0x86, 0xC9, 0x04, + 0xD0, 0x98, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0x9A, + 0xCC, 0x81, 0xC9, 0x04, 0xD0, 0x9E, 0xCC, 0x88, + 0xC9, 0x04, 0xD0, 0xA3, 0xCC, 0x84, 0xC9, 0x04, + 0xD0, 0xA3, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xA3, + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xA3, 0xCC, 0x8B, + // Bytes 3780 - 37bf + 0xC9, 0x04, 0xD0, 0xA7, 0xCC, 0x88, 0xC9, 0x04, + 0xD0, 0xAB, 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xAD, + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xB0, 0xCC, 0x86, + 0xC9, 0x04, 0xD0, 0xB0, 0xCC, 0x88, 0xC9, 0x04, + 0xD0, 0xB3, 0xCC, 0x81, 0xC9, 0x04, 0xD0, 0xB5, + 0xCC, 0x80, 0xC9, 0x04, 0xD0, 0xB5, 0xCC, 0x86, + 0xC9, 0x04, 0xD0, 0xB5, 0xCC, 0x88, 0xC9, 0x04, + 0xD0, 0xB6, 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xB6, + // Bytes 37c0 - 37ff + 0xCC, 0x88, 0xC9, 0x04, 0xD0, 0xB7, 0xCC, 0x88, + 0xC9, 0x04, 0xD0, 0xB8, 0xCC, 0x80, 0xC9, 0x04, + 0xD0, 0xB8, 0xCC, 0x84, 0xC9, 0x04, 0xD0, 0xB8, + 0xCC, 0x86, 0xC9, 0x04, 0xD0, 0xB8, 0xCC, 0x88, + 0xC9, 0x04, 0xD0, 0xBA, 0xCC, 0x81, 0xC9, 0x04, + 0xD0, 0xBE, 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0x83, + 0xCC, 0x84, 0xC9, 0x04, 0xD1, 0x83, 0xCC, 0x86, + 0xC9, 0x04, 0xD1, 0x83, 0xCC, 0x88, 0xC9, 0x04, + // Bytes 3800 - 383f + 0xD1, 0x83, 0xCC, 0x8B, 0xC9, 0x04, 0xD1, 0x87, + 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0x8B, 0xCC, 0x88, + 0xC9, 0x04, 0xD1, 0x8D, 0xCC, 0x88, 0xC9, 0x04, + 0xD1, 0x96, 0xCC, 0x88, 0xC9, 0x04, 0xD1, 0xB4, + 0xCC, 0x8F, 0xC9, 0x04, 0xD1, 0xB5, 0xCC, 0x8F, + 0xC9, 0x04, 0xD3, 0x98, 0xCC, 0x88, 0xC9, 0x04, + 0xD3, 0x99, 0xCC, 0x88, 0xC9, 0x04, 0xD3, 0xA8, + 0xCC, 0x88, 0xC9, 0x04, 0xD3, 0xA9, 0xCC, 0x88, + // Bytes 3840 - 387f + 0xC9, 0x04, 0xD8, 0xA7, 0xD9, 0x93, 0xC9, 0x04, + 0xD8, 0xA7, 0xD9, 0x94, 0xC9, 0x04, 0xD8, 0xA7, + 0xD9, 0x95, 0xB5, 0x04, 0xD9, 0x88, 0xD9, 0x94, + 0xC9, 0x04, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, 0x04, + 0xDB, 0x81, 0xD9, 0x94, 0xC9, 0x04, 0xDB, 0x92, + 0xD9, 0x94, 0xC9, 0x04, 0xDB, 0x95, 0xD9, 0x94, + 0xC9, 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x80, 0xCA, + 0x05, 0x41, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, + // Bytes 3880 - 38bf + 0x41, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x41, + 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x41, 0xCC, + 0x86, 0xCC, 0x80, 0xCA, 0x05, 0x41, 0xCC, 0x86, + 0xCC, 0x81, 0xCA, 0x05, 0x41, 0xCC, 0x86, 0xCC, + 0x83, 0xCA, 0x05, 0x41, 0xCC, 0x86, 0xCC, 0x89, + 0xCA, 0x05, 0x41, 0xCC, 0x87, 0xCC, 0x84, 0xCA, + 0x05, 0x41, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, + 0x41, 0xCC, 0x8A, 0xCC, 0x81, 0xCA, 0x05, 0x41, + // Bytes 38c0 - 38ff + 0xCC, 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x41, 0xCC, + 0xA3, 0xCC, 0x86, 0xCA, 0x05, 0x43, 0xCC, 0xA7, + 0xCC, 0x81, 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, + 0x80, 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x81, + 0xCA, 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x83, 0xCA, + 0x05, 0x45, 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, + 0x45, 0xCC, 0x84, 0xCC, 0x80, 0xCA, 0x05, 0x45, + 0xCC, 0x84, 0xCC, 0x81, 0xCA, 0x05, 0x45, 0xCC, + // Bytes 3900 - 393f + 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x45, 0xCC, 0xA7, + 0xCC, 0x86, 0xCA, 0x05, 0x49, 0xCC, 0x88, 0xCC, + 0x81, 0xCA, 0x05, 0x4C, 0xCC, 0xA3, 0xCC, 0x84, + 0xCA, 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x80, 0xCA, + 0x05, 0x4F, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, + 0x4F, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x4F, + 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x4F, 0xCC, + 0x83, 0xCC, 0x81, 0xCA, 0x05, 0x4F, 0xCC, 0x83, + // Bytes 3940 - 397f + 0xCC, 0x84, 0xCA, 0x05, 0x4F, 0xCC, 0x83, 0xCC, + 0x88, 0xCA, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x80, + 0xCA, 0x05, 0x4F, 0xCC, 0x84, 0xCC, 0x81, 0xCA, + 0x05, 0x4F, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05, + 0x4F, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x4F, + 0xCC, 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x4F, 0xCC, + 0x9B, 0xCC, 0x81, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, + 0xCC, 0x83, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, + // Bytes 3980 - 39bf + 0x89, 0xCA, 0x05, 0x4F, 0xCC, 0x9B, 0xCC, 0xA3, + 0xB6, 0x05, 0x4F, 0xCC, 0xA3, 0xCC, 0x82, 0xCA, + 0x05, 0x4F, 0xCC, 0xA8, 0xCC, 0x84, 0xCA, 0x05, + 0x52, 0xCC, 0xA3, 0xCC, 0x84, 0xCA, 0x05, 0x53, + 0xCC, 0x81, 0xCC, 0x87, 0xCA, 0x05, 0x53, 0xCC, + 0x8C, 0xCC, 0x87, 0xCA, 0x05, 0x53, 0xCC, 0xA3, + 0xCC, 0x87, 0xCA, 0x05, 0x55, 0xCC, 0x83, 0xCC, + 0x81, 0xCA, 0x05, 0x55, 0xCC, 0x84, 0xCC, 0x88, + // Bytes 39c0 - 39ff + 0xCA, 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x80, 0xCA, + 0x05, 0x55, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x05, + 0x55, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x55, + 0xCC, 0x88, 0xCC, 0x8C, 0xCA, 0x05, 0x55, 0xCC, + 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x55, 0xCC, 0x9B, + 0xCC, 0x81, 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, + 0x83, 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0x89, + 0xCA, 0x05, 0x55, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6, + // Bytes 3a00 - 3a3f + 0x05, 0x61, 0xCC, 0x82, 0xCC, 0x80, 0xCA, 0x05, + 0x61, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, 0x61, + 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x61, 0xCC, + 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x61, 0xCC, 0x86, + 0xCC, 0x80, 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, + 0x81, 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x83, + 0xCA, 0x05, 0x61, 0xCC, 0x86, 0xCC, 0x89, 0xCA, + 0x05, 0x61, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05, + // Bytes 3a40 - 3a7f + 0x61, 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x61, + 0xCC, 0x8A, 0xCC, 0x81, 0xCA, 0x05, 0x61, 0xCC, + 0xA3, 0xCC, 0x82, 0xCA, 0x05, 0x61, 0xCC, 0xA3, + 0xCC, 0x86, 0xCA, 0x05, 0x63, 0xCC, 0xA7, 0xCC, + 0x81, 0xCA, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x80, + 0xCA, 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x81, 0xCA, + 0x05, 0x65, 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, + 0x65, 0xCC, 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x65, + // Bytes 3a80 - 3abf + 0xCC, 0x84, 0xCC, 0x80, 0xCA, 0x05, 0x65, 0xCC, + 0x84, 0xCC, 0x81, 0xCA, 0x05, 0x65, 0xCC, 0xA3, + 0xCC, 0x82, 0xCA, 0x05, 0x65, 0xCC, 0xA7, 0xCC, + 0x86, 0xCA, 0x05, 0x69, 0xCC, 0x88, 0xCC, 0x81, + 0xCA, 0x05, 0x6C, 0xCC, 0xA3, 0xCC, 0x84, 0xCA, + 0x05, 0x6F, 0xCC, 0x82, 0xCC, 0x80, 0xCA, 0x05, + 0x6F, 0xCC, 0x82, 0xCC, 0x81, 0xCA, 0x05, 0x6F, + 0xCC, 0x82, 0xCC, 0x83, 0xCA, 0x05, 0x6F, 0xCC, + // Bytes 3ac0 - 3aff + 0x82, 0xCC, 0x89, 0xCA, 0x05, 0x6F, 0xCC, 0x83, + 0xCC, 0x81, 0xCA, 0x05, 0x6F, 0xCC, 0x83, 0xCC, + 0x84, 0xCA, 0x05, 0x6F, 0xCC, 0x83, 0xCC, 0x88, + 0xCA, 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x80, 0xCA, + 0x05, 0x6F, 0xCC, 0x84, 0xCC, 0x81, 0xCA, 0x05, + 0x6F, 0xCC, 0x87, 0xCC, 0x84, 0xCA, 0x05, 0x6F, + 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x6F, 0xCC, + 0x9B, 0xCC, 0x80, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, + // Bytes 3b00 - 3b3f + 0xCC, 0x81, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, + 0x83, 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0x89, + 0xCA, 0x05, 0x6F, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6, + 0x05, 0x6F, 0xCC, 0xA3, 0xCC, 0x82, 0xCA, 0x05, + 0x6F, 0xCC, 0xA8, 0xCC, 0x84, 0xCA, 0x05, 0x72, + 0xCC, 0xA3, 0xCC, 0x84, 0xCA, 0x05, 0x73, 0xCC, + 0x81, 0xCC, 0x87, 0xCA, 0x05, 0x73, 0xCC, 0x8C, + 0xCC, 0x87, 0xCA, 0x05, 0x73, 0xCC, 0xA3, 0xCC, + // Bytes 3b40 - 3b7f + 0x87, 0xCA, 0x05, 0x75, 0xCC, 0x83, 0xCC, 0x81, + 0xCA, 0x05, 0x75, 0xCC, 0x84, 0xCC, 0x88, 0xCA, + 0x05, 0x75, 0xCC, 0x88, 0xCC, 0x80, 0xCA, 0x05, + 0x75, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x05, 0x75, + 0xCC, 0x88, 0xCC, 0x84, 0xCA, 0x05, 0x75, 0xCC, + 0x88, 0xCC, 0x8C, 0xCA, 0x05, 0x75, 0xCC, 0x9B, + 0xCC, 0x80, 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, + 0x81, 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x83, + // Bytes 3b80 - 3bbf + 0xCA, 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0x89, 0xCA, + 0x05, 0x75, 0xCC, 0x9B, 0xCC, 0xA3, 0xB6, 0x05, + 0xE1, 0xBE, 0xBF, 0xCC, 0x80, 0xCA, 0x05, 0xE1, + 0xBE, 0xBF, 0xCC, 0x81, 0xCA, 0x05, 0xE1, 0xBE, + 0xBF, 0xCD, 0x82, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, + 0xCC, 0x80, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, 0xCC, + 0x81, 0xCA, 0x05, 0xE1, 0xBF, 0xBE, 0xCD, 0x82, + 0xCA, 0x05, 0xE2, 0x86, 0x90, 0xCC, 0xB8, 0x05, + // Bytes 3bc0 - 3bff + 0x05, 0xE2, 0x86, 0x92, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x86, 0x94, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x87, 0x90, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, + 0x92, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x87, 0x94, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x83, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x88, 0x88, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x88, 0x8B, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x88, 0xA3, 0xCC, 0xB8, 0x05, 0x05, + // Bytes 3c00 - 3c3f + 0xE2, 0x88, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x88, 0xBC, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x85, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x88, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0x8D, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xA1, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xA4, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x89, 0xA5, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + // Bytes 3c40 - 3c7f + 0x89, 0xB2, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, + 0xB3, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB6, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xB7, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x89, 0xBA, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x89, 0xBB, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x89, 0xBC, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x89, 0xBD, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0x82, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + // Bytes 3c80 - 3cbf + 0x83, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x86, + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x87, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0x91, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0x92, 0xCC, 0xB8, 0x05, + 0x05, 0xE2, 0x8A, 0xA2, 0xCC, 0xB8, 0x05, 0x05, + 0xE2, 0x8A, 0xA8, 0xCC, 0xB8, 0x05, 0x05, 0xE2, + 0x8A, 0xA9, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, + 0xAB, 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB2, + // Bytes 3cc0 - 3cff + 0xCC, 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB3, 0xCC, + 0xB8, 0x05, 0x05, 0xE2, 0x8A, 0xB4, 0xCC, 0xB8, + 0x05, 0x05, 0xE2, 0x8A, 0xB5, 0xCC, 0xB8, 0x05, + 0x06, 0xCE, 0x91, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0x91, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x95, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + // Bytes 3d00 - 3d3f + 0x06, 0xCE, 0x95, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0x97, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0x99, 0xCC, 0x93, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + // Bytes 3d40 - 3d7f + 0x06, 0xCE, 0x99, 0xCC, 0x94, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x9F, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0x9F, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xA5, 0xCC, 0x94, 0xCD, 0x82, 0xCA, + // Bytes 3d80 - 3dbf + 0x06, 0xCE, 0xA9, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCC, 0x80, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCC, 0x81, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB1, 0xCD, 0x82, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + // Bytes 3dc0 - 3dff + 0x06, 0xCE, 0xB5, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xB5, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xB7, 0xCC, 0x80, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB7, 0xCC, 0x81, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB7, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCE, 0xB7, 0xCD, 0x82, 0xCD, 0x85, 0xDA, + // Bytes 3e00 - 3e3f + 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x88, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x93, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + // Bytes 3e40 - 3e7f + 0x06, 0xCE, 0xB9, 0xCC, 0x94, 0xCD, 0x82, 0xCA, + 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xBF, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCE, 0xBF, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x80, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCC, 0x81, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x88, 0xCD, 0x82, 0xCA, + // Bytes 3e80 - 3ebf + 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCC, 0x81, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x93, 0xCD, 0x82, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x80, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCC, 0x81, 0xCA, + 0x06, 0xCF, 0x85, 0xCC, 0x94, 0xCD, 0x82, 0xCA, + 0x06, 0xCF, 0x89, 0xCC, 0x80, 0xCD, 0x85, 0xDA, + 0x06, 0xCF, 0x89, 0xCC, 0x81, 0xCD, 0x85, 0xDA, + // Bytes 3ec0 - 3eff + 0x06, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x85, 0xDA, + 0x06, 0xCF, 0x89, 0xCC, 0x94, 0xCD, 0x85, 0xDA, + 0x06, 0xCF, 0x89, 0xCD, 0x82, 0xCD, 0x85, 0xDA, + 0x06, 0xE0, 0xA4, 0xA8, 0xE0, 0xA4, 0xBC, 0x09, + 0x06, 0xE0, 0xA4, 0xB0, 0xE0, 0xA4, 0xBC, 0x09, + 0x06, 0xE0, 0xA4, 0xB3, 0xE0, 0xA4, 0xBC, 0x09, + 0x06, 0xE0, 0xB1, 0x86, 0xE0, 0xB1, 0x96, 0x85, + 0x06, 0xE0, 0xB7, 0x99, 0xE0, 0xB7, 0x8A, 0x11, + // Bytes 3f00 - 3f3f + 0x06, 0xE3, 0x81, 0x86, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x8B, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x8D, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x8F, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x91, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x93, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x95, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x97, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 3f40 - 3f7f + 0x06, 0xE3, 0x81, 0x99, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x9B, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x9D, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0x9F, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xA1, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xA4, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xA6, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xA8, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 3f80 - 3fbf + 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xAF, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xB2, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xB5, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xB8, 0xE3, 0x82, 0x9A, 0x0D, + // Bytes 3fc0 - 3fff + 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x81, 0xBB, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x82, 0x9D, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xA6, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xAB, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xAD, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xAF, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xB1, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 4000 - 403f + 0x06, 0xE3, 0x82, 0xB3, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xB5, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xB7, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xB9, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xBB, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xBD, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x82, 0xBF, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x81, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 4040 - 407f + 0x06, 0xE3, 0x83, 0x84, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x86, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x88, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x8F, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x92, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 4080 - 40bf + 0x06, 0xE3, 0x83, 0x95, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x98, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0x9B, 0xE3, 0x82, 0x9A, 0x0D, + 0x06, 0xE3, 0x83, 0xAF, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0xB0, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0xB1, 0xE3, 0x82, 0x99, 0x0D, + // Bytes 40c0 - 40ff + 0x06, 0xE3, 0x83, 0xB2, 0xE3, 0x82, 0x99, 0x0D, + 0x06, 0xE3, 0x83, 0xBD, 0xE3, 0x82, 0x99, 0x0D, + 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, 0x93, 0xCC, + 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, + 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCD, + // Bytes 4100 - 413f + 0x85, 0xDB, 0x08, 0xCE, 0x91, 0xCC, 0x94, 0xCD, + 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC, + 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC, 0x94, 0xCC, + 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0x97, 0xCC, + 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + // Bytes 4140 - 417f + 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, 0x93, 0xCC, + 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, + 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xA9, 0xCC, 0x94, 0xCD, + // Bytes 4180 - 41bf + 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC, + 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC, 0x94, 0xCC, + 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB1, 0xCC, + 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB, + // Bytes 41c0 - 41ff + 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, 0x93, 0xCC, + 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, + 0x93, 0xCD, 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCD, 0x85, 0xDB, + 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCD, + 0x85, 0xDB, 0x08, 0xCE, 0xB7, 0xCC, 0x94, 0xCD, + 0x82, 0xCD, 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC, + // Bytes 4200 - 423f + 0x93, 0xCC, 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCF, + 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCD, 0x85, 0xDB, + 0x08, 0xCF, 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCD, + 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC, 0x94, 0xCC, + 0x80, 0xCD, 0x85, 0xDB, 0x08, 0xCF, 0x89, 0xCC, + 0x94, 0xCC, 0x81, 0xCD, 0x85, 0xDB, 0x08, 0xCF, + 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCD, 0x85, 0xDB, + 0x08, 0xF0, 0x91, 0x82, 0x99, 0xF0, 0x91, 0x82, + // Bytes 4240 - 427f + 0xBA, 0x09, 0x08, 0xF0, 0x91, 0x82, 0x9B, 0xF0, + 0x91, 0x82, 0xBA, 0x09, 0x08, 0xF0, 0x91, 0x82, + 0xA5, 0xF0, 0x91, 0x82, 0xBA, 0x09, 0x42, 0xC2, + 0xB4, 0x01, 0x43, 0x20, 0xCC, 0x81, 0xC9, 0x43, + 0x20, 0xCC, 0x83, 0xC9, 0x43, 0x20, 0xCC, 0x84, + 0xC9, 0x43, 0x20, 0xCC, 0x85, 0xC9, 0x43, 0x20, + 0xCC, 0x86, 0xC9, 0x43, 0x20, 0xCC, 0x87, 0xC9, + 0x43, 0x20, 0xCC, 0x88, 0xC9, 0x43, 0x20, 0xCC, + // Bytes 4280 - 42bf + 0x8A, 0xC9, 0x43, 0x20, 0xCC, 0x8B, 0xC9, 0x43, + 0x20, 0xCC, 0x93, 0xC9, 0x43, 0x20, 0xCC, 0x94, + 0xC9, 0x43, 0x20, 0xCC, 0xA7, 0xA5, 0x43, 0x20, + 0xCC, 0xA8, 0xA5, 0x43, 0x20, 0xCC, 0xB3, 0xB5, + 0x43, 0x20, 0xCD, 0x82, 0xC9, 0x43, 0x20, 0xCD, + 0x85, 0xD9, 0x43, 0x20, 0xD9, 0x8B, 0x59, 0x43, + 0x20, 0xD9, 0x8C, 0x5D, 0x43, 0x20, 0xD9, 0x8D, + 0x61, 0x43, 0x20, 0xD9, 0x8E, 0x65, 0x43, 0x20, + // Bytes 42c0 - 42ff + 0xD9, 0x8F, 0x69, 0x43, 0x20, 0xD9, 0x90, 0x6D, + 0x43, 0x20, 0xD9, 0x91, 0x71, 0x43, 0x20, 0xD9, + 0x92, 0x75, 0x43, 0x41, 0xCC, 0x8A, 0xC9, 0x43, + 0x73, 0xCC, 0x87, 0xC9, 0x44, 0x20, 0xE3, 0x82, + 0x99, 0x0D, 0x44, 0x20, 0xE3, 0x82, 0x9A, 0x0D, + 0x44, 0xC2, 0xA8, 0xCC, 0x81, 0xCA, 0x44, 0xCE, + 0x91, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0x95, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0x97, 0xCC, 0x81, 0xC9, + // Bytes 4300 - 433f + 0x44, 0xCE, 0x99, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0x9F, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0xA5, 0xCC, 0x88, 0xC9, + 0x44, 0xCE, 0xA9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0xB1, 0xCC, 0x81, 0xC9, 0x44, 0xCE, 0xB5, 0xCC, + 0x81, 0xC9, 0x44, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, + 0x44, 0xCE, 0xB9, 0xCC, 0x81, 0xC9, 0x44, 0xCE, + 0xBF, 0xCC, 0x81, 0xC9, 0x44, 0xCF, 0x85, 0xCC, + // Bytes 4340 - 437f + 0x81, 0xC9, 0x44, 0xCF, 0x89, 0xCC, 0x81, 0xC9, + 0x44, 0xD7, 0x90, 0xD6, 0xB7, 0x31, 0x44, 0xD7, + 0x90, 0xD6, 0xB8, 0x35, 0x44, 0xD7, 0x90, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x91, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x91, 0xD6, 0xBF, 0x49, 0x44, 0xD7, + 0x92, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x93, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x94, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x95, 0xD6, 0xB9, 0x39, 0x44, 0xD7, + // Bytes 4380 - 43bf + 0x95, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x96, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x98, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x99, 0xD6, 0xB4, 0x25, 0x44, 0xD7, + 0x99, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9A, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0x9B, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0x9B, 0xD6, 0xBF, 0x49, 0x44, 0xD7, + 0x9C, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0x9E, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA0, 0xD6, 0xBC, 0x41, + // Bytes 43c0 - 43ff + 0x44, 0xD7, 0xA1, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xA3, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA4, 0xD6, 0xBF, 0x49, + 0x44, 0xD7, 0xA6, 0xD6, 0xBC, 0x41, 0x44, 0xD7, + 0xA7, 0xD6, 0xBC, 0x41, 0x44, 0xD7, 0xA8, 0xD6, + 0xBC, 0x41, 0x44, 0xD7, 0xA9, 0xD6, 0xBC, 0x41, + 0x44, 0xD7, 0xA9, 0xD7, 0x81, 0x4D, 0x44, 0xD7, + 0xA9, 0xD7, 0x82, 0x51, 0x44, 0xD7, 0xAA, 0xD6, + // Bytes 4400 - 443f + 0xBC, 0x41, 0x44, 0xD7, 0xB2, 0xD6, 0xB7, 0x31, + 0x44, 0xD8, 0xA7, 0xD9, 0x8B, 0x59, 0x44, 0xD8, + 0xA7, 0xD9, 0x93, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, + 0x94, 0xC9, 0x44, 0xD8, 0xA7, 0xD9, 0x95, 0xB5, + 0x44, 0xD8, 0xB0, 0xD9, 0xB0, 0x79, 0x44, 0xD8, + 0xB1, 0xD9, 0xB0, 0x79, 0x44, 0xD9, 0x80, 0xD9, + 0x8B, 0x59, 0x44, 0xD9, 0x80, 0xD9, 0x8E, 0x65, + 0x44, 0xD9, 0x80, 0xD9, 0x8F, 0x69, 0x44, 0xD9, + // Bytes 4440 - 447f + 0x80, 0xD9, 0x90, 0x6D, 0x44, 0xD9, 0x80, 0xD9, + 0x91, 0x71, 0x44, 0xD9, 0x80, 0xD9, 0x92, 0x75, + 0x44, 0xD9, 0x87, 0xD9, 0xB0, 0x79, 0x44, 0xD9, + 0x88, 0xD9, 0x94, 0xC9, 0x44, 0xD9, 0x89, 0xD9, + 0xB0, 0x79, 0x44, 0xD9, 0x8A, 0xD9, 0x94, 0xC9, + 0x44, 0xDB, 0x92, 0xD9, 0x94, 0xC9, 0x44, 0xDB, + 0x95, 0xD9, 0x94, 0xC9, 0x45, 0x20, 0xCC, 0x88, + 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCC, + // Bytes 4480 - 44bf + 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x88, 0xCD, 0x82, + 0xCA, 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x80, 0xCA, + 0x45, 0x20, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x45, + 0x20, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x45, 0x20, + 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x45, 0x20, 0xCC, + 0x94, 0xCC, 0x81, 0xCA, 0x45, 0x20, 0xCC, 0x94, + 0xCD, 0x82, 0xCA, 0x45, 0x20, 0xD9, 0x8C, 0xD9, + 0x91, 0x72, 0x45, 0x20, 0xD9, 0x8D, 0xD9, 0x91, + // Bytes 44c0 - 44ff + 0x72, 0x45, 0x20, 0xD9, 0x8E, 0xD9, 0x91, 0x72, + 0x45, 0x20, 0xD9, 0x8F, 0xD9, 0x91, 0x72, 0x45, + 0x20, 0xD9, 0x90, 0xD9, 0x91, 0x72, 0x45, 0x20, + 0xD9, 0x91, 0xD9, 0xB0, 0x7A, 0x45, 0xE2, 0xAB, + 0x9D, 0xCC, 0xB8, 0x05, 0x46, 0xCE, 0xB9, 0xCC, + 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xCF, 0x85, 0xCC, + 0x88, 0xCC, 0x81, 0xCA, 0x46, 0xD7, 0xA9, 0xD6, + 0xBC, 0xD7, 0x81, 0x4E, 0x46, 0xD7, 0xA9, 0xD6, + // Bytes 4500 - 453f + 0xBC, 0xD7, 0x82, 0x52, 0x46, 0xD9, 0x80, 0xD9, + 0x8E, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, + 0x8F, 0xD9, 0x91, 0x72, 0x46, 0xD9, 0x80, 0xD9, + 0x90, 0xD9, 0x91, 0x72, 0x46, 0xE0, 0xA4, 0x95, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x96, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x97, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0x9C, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA1, + // Bytes 4540 - 457f + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xA2, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAB, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA4, 0xAF, + 0xE0, 0xA4, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA1, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xA2, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA6, 0xAF, + 0xE0, 0xA6, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x96, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x97, + // Bytes 4580 - 45bf + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0x9C, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xAB, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB2, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xA8, 0xB8, + 0xE0, 0xA8, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA1, + 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xAC, 0xA2, + 0xE0, 0xAC, 0xBC, 0x09, 0x46, 0xE0, 0xBE, 0xB2, + 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE0, 0xBE, 0xB3, + // Bytes 45c0 - 45ff + 0xE0, 0xBE, 0x80, 0x9D, 0x46, 0xE3, 0x83, 0x86, + 0xE3, 0x82, 0x99, 0x0D, 0x48, 0xF0, 0x9D, 0x85, + 0x97, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, 0x48, 0xF0, + 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xAD, + 0x48, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, + 0xA5, 0xAD, 0x48, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + 0x9D, 0x85, 0xA5, 0xAD, 0x49, 0xE0, 0xBE, 0xB2, + 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x49, + // Bytes 4600 - 463f + 0xE0, 0xBE, 0xB3, 0xE0, 0xBD, 0xB1, 0xE0, 0xBE, + 0x80, 0x9E, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, + 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, + 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, + 0x9D, 0x85, 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, + 0x9D, 0x85, 0xB0, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, + 0x98, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, + // Bytes 4640 - 467f + 0xB1, 0xAE, 0x4C, 0xF0, 0x9D, 0x85, 0x98, 0xF0, + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xB2, 0xAE, + 0x4C, 0xF0, 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, + 0xA5, 0xF0, 0x9D, 0x85, 0xAE, 0xAE, 0x4C, 0xF0, + 0x9D, 0x86, 0xB9, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, + 0x9D, 0x85, 0xAF, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, + 0xBA, 0xF0, 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, + 0xAE, 0xAE, 0x4C, 0xF0, 0x9D, 0x86, 0xBA, 0xF0, + // Bytes 4680 - 46bf + 0x9D, 0x85, 0xA5, 0xF0, 0x9D, 0x85, 0xAF, 0xAE, + 0x83, 0x41, 0xCC, 0x82, 0xC9, 0x83, 0x41, 0xCC, + 0x86, 0xC9, 0x83, 0x41, 0xCC, 0x87, 0xC9, 0x83, + 0x41, 0xCC, 0x88, 0xC9, 0x83, 0x41, 0xCC, 0x8A, + 0xC9, 0x83, 0x41, 0xCC, 0xA3, 0xB5, 0x83, 0x43, + 0xCC, 0xA7, 0xA5, 0x83, 0x45, 0xCC, 0x82, 0xC9, + 0x83, 0x45, 0xCC, 0x84, 0xC9, 0x83, 0x45, 0xCC, + 0xA3, 0xB5, 0x83, 0x45, 0xCC, 0xA7, 0xA5, 0x83, + // Bytes 46c0 - 46ff + 0x49, 0xCC, 0x88, 0xC9, 0x83, 0x4C, 0xCC, 0xA3, + 0xB5, 0x83, 0x4F, 0xCC, 0x82, 0xC9, 0x83, 0x4F, + 0xCC, 0x83, 0xC9, 0x83, 0x4F, 0xCC, 0x84, 0xC9, + 0x83, 0x4F, 0xCC, 0x87, 0xC9, 0x83, 0x4F, 0xCC, + 0x88, 0xC9, 0x83, 0x4F, 0xCC, 0x9B, 0xAD, 0x83, + 0x4F, 0xCC, 0xA3, 0xB5, 0x83, 0x4F, 0xCC, 0xA8, + 0xA5, 0x83, 0x52, 0xCC, 0xA3, 0xB5, 0x83, 0x53, + 0xCC, 0x81, 0xC9, 0x83, 0x53, 0xCC, 0x8C, 0xC9, + // Bytes 4700 - 473f + 0x83, 0x53, 0xCC, 0xA3, 0xB5, 0x83, 0x55, 0xCC, + 0x83, 0xC9, 0x83, 0x55, 0xCC, 0x84, 0xC9, 0x83, + 0x55, 0xCC, 0x88, 0xC9, 0x83, 0x55, 0xCC, 0x9B, + 0xAD, 0x83, 0x61, 0xCC, 0x82, 0xC9, 0x83, 0x61, + 0xCC, 0x86, 0xC9, 0x83, 0x61, 0xCC, 0x87, 0xC9, + 0x83, 0x61, 0xCC, 0x88, 0xC9, 0x83, 0x61, 0xCC, + 0x8A, 0xC9, 0x83, 0x61, 0xCC, 0xA3, 0xB5, 0x83, + 0x63, 0xCC, 0xA7, 0xA5, 0x83, 0x65, 0xCC, 0x82, + // Bytes 4740 - 477f + 0xC9, 0x83, 0x65, 0xCC, 0x84, 0xC9, 0x83, 0x65, + 0xCC, 0xA3, 0xB5, 0x83, 0x65, 0xCC, 0xA7, 0xA5, + 0x83, 0x69, 0xCC, 0x88, 0xC9, 0x83, 0x6C, 0xCC, + 0xA3, 0xB5, 0x83, 0x6F, 0xCC, 0x82, 0xC9, 0x83, + 0x6F, 0xCC, 0x83, 0xC9, 0x83, 0x6F, 0xCC, 0x84, + 0xC9, 0x83, 0x6F, 0xCC, 0x87, 0xC9, 0x83, 0x6F, + 0xCC, 0x88, 0xC9, 0x83, 0x6F, 0xCC, 0x9B, 0xAD, + 0x83, 0x6F, 0xCC, 0xA3, 0xB5, 0x83, 0x6F, 0xCC, + // Bytes 4780 - 47bf + 0xA8, 0xA5, 0x83, 0x72, 0xCC, 0xA3, 0xB5, 0x83, + 0x73, 0xCC, 0x81, 0xC9, 0x83, 0x73, 0xCC, 0x8C, + 0xC9, 0x83, 0x73, 0xCC, 0xA3, 0xB5, 0x83, 0x75, + 0xCC, 0x83, 0xC9, 0x83, 0x75, 0xCC, 0x84, 0xC9, + 0x83, 0x75, 0xCC, 0x88, 0xC9, 0x83, 0x75, 0xCC, + 0x9B, 0xAD, 0x84, 0xCE, 0x91, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x91, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0x95, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x95, 0xCC, + // Bytes 47c0 - 47ff + 0x94, 0xC9, 0x84, 0xCE, 0x97, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x97, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0x99, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0x99, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0x9F, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0x9F, 0xCC, 0x94, 0xC9, 0x84, 0xCE, + 0xA5, 0xCC, 0x94, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, + 0x93, 0xC9, 0x84, 0xCE, 0xA9, 0xCC, 0x94, 0xC9, + 0x84, 0xCE, 0xB1, 0xCC, 0x80, 0xC9, 0x84, 0xCE, + // Bytes 4800 - 483f + 0xB1, 0xCC, 0x81, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, + 0x93, 0xC9, 0x84, 0xCE, 0xB1, 0xCC, 0x94, 0xC9, + 0x84, 0xCE, 0xB1, 0xCD, 0x82, 0xC9, 0x84, 0xCE, + 0xB5, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB5, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, 0x80, 0xC9, + 0x84, 0xCE, 0xB7, 0xCC, 0x81, 0xC9, 0x84, 0xCE, + 0xB7, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB7, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xB7, 0xCD, 0x82, 0xC9, + // Bytes 4840 - 487f + 0x84, 0xCE, 0xB9, 0xCC, 0x88, 0xC9, 0x84, 0xCE, + 0xB9, 0xCC, 0x93, 0xC9, 0x84, 0xCE, 0xB9, 0xCC, + 0x94, 0xC9, 0x84, 0xCE, 0xBF, 0xCC, 0x93, 0xC9, + 0x84, 0xCE, 0xBF, 0xCC, 0x94, 0xC9, 0x84, 0xCF, + 0x85, 0xCC, 0x88, 0xC9, 0x84, 0xCF, 0x85, 0xCC, + 0x93, 0xC9, 0x84, 0xCF, 0x85, 0xCC, 0x94, 0xC9, + 0x84, 0xCF, 0x89, 0xCC, 0x80, 0xC9, 0x84, 0xCF, + 0x89, 0xCC, 0x81, 0xC9, 0x84, 0xCF, 0x89, 0xCC, + // Bytes 4880 - 48bf + 0x93, 0xC9, 0x84, 0xCF, 0x89, 0xCC, 0x94, 0xC9, + 0x84, 0xCF, 0x89, 0xCD, 0x82, 0xC9, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x91, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + // Bytes 48c0 - 48ff + 0x97, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0x97, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + // Bytes 4900 - 493f + 0xA9, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xA9, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + // Bytes 4940 - 497f + 0xB1, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB1, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCE, + 0xB7, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x86, 0xCF, + // Bytes 4980 - 49bf + 0x89, 0xCC, 0x93, 0xCC, 0x80, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x93, 0xCC, 0x81, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x93, 0xCD, 0x82, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCC, 0x80, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCC, 0x81, 0xCA, 0x86, 0xCF, + 0x89, 0xCC, 0x94, 0xCD, 0x82, 0xCA, 0x42, 0xCC, + 0x80, 0xC9, 0x32, 0x42, 0xCC, 0x81, 0xC9, 0x32, + 0x42, 0xCC, 0x93, 0xC9, 0x32, 0x43, 0xE1, 0x85, + // Bytes 49c0 - 49ff + 0xA1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA2, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xA3, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xA4, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xA5, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xA6, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xA7, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xA8, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xA9, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAA, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xAB, 0x01, 0x00, 0x43, + // Bytes 4a00 - 4a3f + 0xE1, 0x85, 0xAC, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xAE, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xAF, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xB1, 0x01, 0x00, 0x43, 0xE1, 0x85, 0xB2, 0x01, + 0x00, 0x43, 0xE1, 0x85, 0xB3, 0x01, 0x00, 0x43, + 0xE1, 0x85, 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x85, + 0xB5, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xAA, 0x01, + // Bytes 4a40 - 4a7f + 0x00, 0x43, 0xE1, 0x86, 0xAC, 0x01, 0x00, 0x43, + 0xE1, 0x86, 0xAD, 0x01, 0x00, 0x43, 0xE1, 0x86, + 0xB0, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB1, 0x01, + 0x00, 0x43, 0xE1, 0x86, 0xB2, 0x01, 0x00, 0x43, + 0xE1, 0x86, 0xB3, 0x01, 0x00, 0x43, 0xE1, 0x86, + 0xB4, 0x01, 0x00, 0x43, 0xE1, 0x86, 0xB5, 0x01, + 0x00, 0x44, 0xCC, 0x88, 0xCC, 0x81, 0xCA, 0x32, + 0x43, 0xE3, 0x82, 0x99, 0x0D, 0x03, 0x43, 0xE3, + // Bytes 4a80 - 4abf + 0x82, 0x9A, 0x0D, 0x03, 0x46, 0xE0, 0xBD, 0xB1, + 0xE0, 0xBD, 0xB2, 0x9E, 0x26, 0x46, 0xE0, 0xBD, + 0xB1, 0xE0, 0xBD, 0xB4, 0xA2, 0x26, 0x46, 0xE0, + 0xBD, 0xB1, 0xE0, 0xBE, 0x80, 0x9E, 0x26, 0x00, + 0x01, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfcValues[c0] + } + i := nfcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfcTrie. Total size: 10586 bytes (10.34 KiB). Checksum: dd926e82067bee11. +type nfcTrie struct{} + +func newNfcTrie(i int) *nfcTrie { + return &nfcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 46: + return uint16(nfcValues[n<<6+uint32(b)]) + default: + n -= 46 + return uint16(nfcSparse.lookup(n, b)) + } +} + +// nfcValues: 48 blocks, 3072 entries, 6144 bytes +// The third block is the zero block. +var nfcValues = [3072]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c, + 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb, + 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104, + 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd, + 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235, + 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285, + 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3, + 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750, + 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f, + 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, + 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569, + // Block 0x4, offset 0x100 + 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8, + 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6, + 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5, + 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, + 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339, + 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352, + 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e, + 0x12a: 0x3082, 0x12b: 0x3393, 0x12c: 0x3087, 0x12d: 0x3398, 0x12e: 0x30aa, 0x12f: 0x33b6, + 0x130: 0x308c, 0x134: 0x30b4, 0x135: 0x33c0, + 0x136: 0x30c8, 0x137: 0x33d9, 0x139: 0x30d2, 0x13a: 0x33e3, 0x13b: 0x30dc, + 0x13c: 0x33ed, 0x13d: 0x30d7, 0x13e: 0x33e8, + // Block 0x5, offset 0x140 + 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118, + 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, + 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, + 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483, + 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d, + 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba, + 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796, + 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, + 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528, + 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267, + 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0xa000, + // Block 0x6, offset 0x180 + 0x184: 0x8100, 0x185: 0x8100, + 0x186: 0x8100, + 0x18d: 0x2f88, 0x18e: 0x3294, 0x18f: 0x3096, 0x190: 0x33a2, 0x191: 0x3140, + 0x192: 0x3451, 0x193: 0x31d6, 0x194: 0x34ec, 0x195: 0x39cf, 0x196: 0x3b5e, 0x197: 0x39c8, + 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50, + 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5, + 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf, + 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, + 0x1b0: 0x33c5, 0x1b4: 0x3028, 0x1b5: 0x3334, + 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46, + 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x2f8d, 0x1c1: 0x3299, 0x1c2: 0x2f92, 0x1c3: 0x329e, 0x1c4: 0x300a, 0x1c5: 0x3316, + 0x1c6: 0x300f, 0x1c7: 0x331b, 0x1c8: 0x309b, 0x1c9: 0x33a7, 0x1ca: 0x30a0, 0x1cb: 0x33ac, + 0x1cc: 0x3145, 0x1cd: 0x3456, 0x1ce: 0x314a, 0x1cf: 0x345b, 0x1d0: 0x3168, 0x1d1: 0x3479, + 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6, + 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5, + 0x1de: 0x305a, 0x1df: 0x3366, + 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b, + 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769, + 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f, + // Block 0x8, offset 0x200 + 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132, + 0x206: 0x9932, 0x207: 0x9932, 0x208: 0x9932, 0x209: 0x9932, 0x20a: 0x9932, 0x20b: 0x9932, + 0x20c: 0x9932, 0x20d: 0x8132, 0x20e: 0x8132, 0x20f: 0x9932, 0x210: 0x8132, 0x211: 0x9932, + 0x212: 0x8132, 0x213: 0x9932, 0x214: 0x9932, 0x215: 0x8133, 0x216: 0x812d, 0x217: 0x812d, + 0x218: 0x812d, 0x219: 0x812d, 0x21a: 0x8133, 0x21b: 0x992b, 0x21c: 0x812d, 0x21d: 0x812d, + 0x21e: 0x812d, 0x21f: 0x812d, 0x220: 0x812d, 0x221: 0x8129, 0x222: 0x8129, 0x223: 0x992d, + 0x224: 0x992d, 0x225: 0x992d, 0x226: 0x992d, 0x227: 0x9929, 0x228: 0x9929, 0x229: 0x812d, + 0x22a: 0x812d, 0x22b: 0x812d, 0x22c: 0x812d, 0x22d: 0x992d, 0x22e: 0x992d, 0x22f: 0x812d, + 0x230: 0x992d, 0x231: 0x992d, 0x232: 0x812d, 0x233: 0x812d, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d, + 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132, + // Block 0x9, offset 0x240 + 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936, + 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132, + 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132, + 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132, + 0x258: 0x8133, 0x259: 0x812d, 0x25a: 0x812d, 0x25b: 0x8132, 0x25c: 0x8134, 0x25d: 0x8135, + 0x25e: 0x8135, 0x25f: 0x8134, 0x260: 0x8135, 0x261: 0x8135, 0x262: 0x8134, 0x263: 0x8132, + 0x264: 0x8132, 0x265: 0x8132, 0x266: 0x8132, 0x267: 0x8132, 0x268: 0x8132, 0x269: 0x8132, + 0x26a: 0x8132, 0x26b: 0x8132, 0x26c: 0x8132, 0x26d: 0x8132, 0x26e: 0x8132, 0x26f: 0x8132, + 0x274: 0x0170, + 0x27a: 0x8100, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x8100, 0x285: 0x35a1, + 0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625, + 0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9, + 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x3721, 0x2c1: 0x372d, 0x2c3: 0x371b, + 0x2c6: 0xa000, 0x2c7: 0x3709, + 0x2cc: 0x375d, 0x2cd: 0x3745, 0x2ce: 0x376f, 0x2d0: 0xa000, + 0x2d3: 0xa000, 0x2d5: 0xa000, 0x2d6: 0xa000, 0x2d7: 0xa000, + 0x2d8: 0xa000, 0x2d9: 0x3751, 0x2da: 0xa000, + 0x2de: 0xa000, 0x2e3: 0xa000, + 0x2e7: 0xa000, + 0x2eb: 0xa000, 0x2ed: 0xa000, + 0x2f0: 0xa000, 0x2f3: 0xa000, 0x2f5: 0xa000, + 0x2f6: 0xa000, 0x2f7: 0xa000, 0x2f8: 0xa000, 0x2f9: 0x37d5, 0x2fa: 0xa000, + 0x2fe: 0xa000, + // Block 0xc, offset 0x300 + 0x301: 0x3733, 0x302: 0x37b7, + 0x310: 0x370f, 0x311: 0x3793, + 0x312: 0x3715, 0x313: 0x3799, 0x316: 0x3727, 0x317: 0x37ab, + 0x318: 0xa000, 0x319: 0xa000, 0x31a: 0x3829, 0x31b: 0x382f, 0x31c: 0x3739, 0x31d: 0x37bd, + 0x31e: 0x373f, 0x31f: 0x37c3, 0x322: 0x374b, 0x323: 0x37cf, + 0x324: 0x3757, 0x325: 0x37db, 0x326: 0x3763, 0x327: 0x37e7, 0x328: 0xa000, 0x329: 0xa000, + 0x32a: 0x3835, 0x32b: 0x383b, 0x32c: 0x378d, 0x32d: 0x3811, 0x32e: 0x3769, 0x32f: 0x37ed, + 0x330: 0x3775, 0x331: 0x37f9, 0x332: 0x377b, 0x333: 0x37ff, 0x334: 0x3781, 0x335: 0x3805, + 0x338: 0x3787, 0x339: 0x380b, + // Block 0xd, offset 0x340 + 0x351: 0x812d, + 0x352: 0x8132, 0x353: 0x8132, 0x354: 0x8132, 0x355: 0x8132, 0x356: 0x812d, 0x357: 0x8132, + 0x358: 0x8132, 0x359: 0x8132, 0x35a: 0x812e, 0x35b: 0x812d, 0x35c: 0x8132, 0x35d: 0x8132, + 0x35e: 0x8132, 0x35f: 0x8132, 0x360: 0x8132, 0x361: 0x8132, 0x362: 0x812d, 0x363: 0x812d, + 0x364: 0x812d, 0x365: 0x812d, 0x366: 0x812d, 0x367: 0x812d, 0x368: 0x8132, 0x369: 0x8132, + 0x36a: 0x812d, 0x36b: 0x8132, 0x36c: 0x8132, 0x36d: 0x812e, 0x36e: 0x8131, 0x36f: 0x8132, + 0x370: 0x8105, 0x371: 0x8106, 0x372: 0x8107, 0x373: 0x8108, 0x374: 0x8109, 0x375: 0x810a, + 0x376: 0x810b, 0x377: 0x810c, 0x378: 0x810d, 0x379: 0x810e, 0x37a: 0x810e, 0x37b: 0x810f, + 0x37c: 0x8110, 0x37d: 0x8111, 0x37f: 0x8112, + // Block 0xe, offset 0x380 + 0x388: 0xa000, 0x38a: 0xa000, 0x38b: 0x8116, + 0x38c: 0x8117, 0x38d: 0x8118, 0x38e: 0x8119, 0x38f: 0x811a, 0x390: 0x811b, 0x391: 0x811c, + 0x392: 0x811d, 0x393: 0x9932, 0x394: 0x9932, 0x395: 0x992d, 0x396: 0x812d, 0x397: 0x8132, + 0x398: 0x8132, 0x399: 0x8132, 0x39a: 0x8132, 0x39b: 0x8132, 0x39c: 0x812d, 0x39d: 0x8132, + 0x39e: 0x8132, 0x39f: 0x812d, + 0x3b0: 0x811e, + // Block 0xf, offset 0x3c0 + 0x3d3: 0x812d, 0x3d4: 0x8132, 0x3d5: 0x8132, 0x3d6: 0x8132, 0x3d7: 0x8132, + 0x3d8: 0x8132, 0x3d9: 0x8132, 0x3da: 0x8132, 0x3db: 0x8132, 0x3dc: 0x8132, 0x3dd: 0x8132, + 0x3de: 0x8132, 0x3df: 0x8132, 0x3e0: 0x8132, 0x3e1: 0x8132, 0x3e3: 0x812d, + 0x3e4: 0x8132, 0x3e5: 0x8132, 0x3e6: 0x812d, 0x3e7: 0x8132, 0x3e8: 0x8132, 0x3e9: 0x812d, + 0x3ea: 0x8132, 0x3eb: 0x8132, 0x3ec: 0x8132, 0x3ed: 0x812d, 0x3ee: 0x812d, 0x3ef: 0x812d, + 0x3f0: 0x8116, 0x3f1: 0x8117, 0x3f2: 0x8118, 0x3f3: 0x8132, 0x3f4: 0x8132, 0x3f5: 0x8132, + 0x3f6: 0x812d, 0x3f7: 0x8132, 0x3f8: 0x8132, 0x3f9: 0x812d, 0x3fa: 0x812d, 0x3fb: 0x8132, + 0x3fc: 0x8132, 0x3fd: 0x8132, 0x3fe: 0x8132, 0x3ff: 0x8132, + // Block 0x10, offset 0x400 + 0x405: 0xa000, + 0x406: 0x2d26, 0x407: 0xa000, 0x408: 0x2d2e, 0x409: 0xa000, 0x40a: 0x2d36, 0x40b: 0xa000, + 0x40c: 0x2d3e, 0x40d: 0xa000, 0x40e: 0x2d46, 0x411: 0xa000, + 0x412: 0x2d4e, + 0x434: 0x8102, 0x435: 0x9900, + 0x43a: 0xa000, 0x43b: 0x2d56, + 0x43c: 0xa000, 0x43d: 0x2d5e, 0x43e: 0xa000, 0x43f: 0xa000, + // Block 0x11, offset 0x440 + 0x440: 0x8132, 0x441: 0x8132, 0x442: 0x812d, 0x443: 0x8132, 0x444: 0x8132, 0x445: 0x8132, + 0x446: 0x8132, 0x447: 0x8132, 0x448: 0x8132, 0x449: 0x8132, 0x44a: 0x812d, 0x44b: 0x8132, + 0x44c: 0x8132, 0x44d: 0x8135, 0x44e: 0x812a, 0x44f: 0x812d, 0x450: 0x8129, 0x451: 0x8132, + 0x452: 0x8132, 0x453: 0x8132, 0x454: 0x8132, 0x455: 0x8132, 0x456: 0x8132, 0x457: 0x8132, + 0x458: 0x8132, 0x459: 0x8132, 0x45a: 0x8132, 0x45b: 0x8132, 0x45c: 0x8132, 0x45d: 0x8132, + 0x45e: 0x8132, 0x45f: 0x8132, 0x460: 0x8132, 0x461: 0x8132, 0x462: 0x8132, 0x463: 0x8132, + 0x464: 0x8132, 0x465: 0x8132, 0x466: 0x8132, 0x467: 0x8132, 0x468: 0x8132, 0x469: 0x8132, + 0x46a: 0x8132, 0x46b: 0x8132, 0x46c: 0x8132, 0x46d: 0x8132, 0x46e: 0x8132, 0x46f: 0x8132, + 0x470: 0x8132, 0x471: 0x8132, 0x472: 0x8132, 0x473: 0x8132, 0x474: 0x8132, 0x475: 0x8132, + 0x476: 0x8133, 0x477: 0x8131, 0x478: 0x8131, 0x479: 0x812d, 0x47b: 0x8132, + 0x47c: 0x8134, 0x47d: 0x812d, 0x47e: 0x8132, 0x47f: 0x812d, + // Block 0x12, offset 0x480 + 0x480: 0x2f97, 0x481: 0x32a3, 0x482: 0x2fa1, 0x483: 0x32ad, 0x484: 0x2fa6, 0x485: 0x32b2, + 0x486: 0x2fab, 0x487: 0x32b7, 0x488: 0x38cc, 0x489: 0x3a5b, 0x48a: 0x2fc4, 0x48b: 0x32d0, + 0x48c: 0x2fce, 0x48d: 0x32da, 0x48e: 0x2fdd, 0x48f: 0x32e9, 0x490: 0x2fd3, 0x491: 0x32df, + 0x492: 0x2fd8, 0x493: 0x32e4, 0x494: 0x38ef, 0x495: 0x3a7e, 0x496: 0x38f6, 0x497: 0x3a85, + 0x498: 0x3019, 0x499: 0x3325, 0x49a: 0x301e, 0x49b: 0x332a, 0x49c: 0x3904, 0x49d: 0x3a93, + 0x49e: 0x3023, 0x49f: 0x332f, 0x4a0: 0x3032, 0x4a1: 0x333e, 0x4a2: 0x3050, 0x4a3: 0x335c, + 0x4a4: 0x305f, 0x4a5: 0x336b, 0x4a6: 0x3055, 0x4a7: 0x3361, 0x4a8: 0x3064, 0x4a9: 0x3370, + 0x4aa: 0x3069, 0x4ab: 0x3375, 0x4ac: 0x30af, 0x4ad: 0x33bb, 0x4ae: 0x390b, 0x4af: 0x3a9a, + 0x4b0: 0x30b9, 0x4b1: 0x33ca, 0x4b2: 0x30c3, 0x4b3: 0x33d4, 0x4b4: 0x30cd, 0x4b5: 0x33de, + 0x4b6: 0x46c4, 0x4b7: 0x4755, 0x4b8: 0x3912, 0x4b9: 0x3aa1, 0x4ba: 0x30e6, 0x4bb: 0x33f7, + 0x4bc: 0x30e1, 0x4bd: 0x33f2, 0x4be: 0x30eb, 0x4bf: 0x33fc, + // Block 0x13, offset 0x4c0 + 0x4c0: 0x30f0, 0x4c1: 0x3401, 0x4c2: 0x30f5, 0x4c3: 0x3406, 0x4c4: 0x3109, 0x4c5: 0x341a, + 0x4c6: 0x3113, 0x4c7: 0x3424, 0x4c8: 0x3122, 0x4c9: 0x3433, 0x4ca: 0x311d, 0x4cb: 0x342e, + 0x4cc: 0x3935, 0x4cd: 0x3ac4, 0x4ce: 0x3943, 0x4cf: 0x3ad2, 0x4d0: 0x394a, 0x4d1: 0x3ad9, + 0x4d2: 0x3951, 0x4d3: 0x3ae0, 0x4d4: 0x314f, 0x4d5: 0x3460, 0x4d6: 0x3154, 0x4d7: 0x3465, + 0x4d8: 0x315e, 0x4d9: 0x346f, 0x4da: 0x46f1, 0x4db: 0x4782, 0x4dc: 0x3997, 0x4dd: 0x3b26, + 0x4de: 0x3177, 0x4df: 0x3488, 0x4e0: 0x3181, 0x4e1: 0x3492, 0x4e2: 0x4700, 0x4e3: 0x4791, + 0x4e4: 0x399e, 0x4e5: 0x3b2d, 0x4e6: 0x39a5, 0x4e7: 0x3b34, 0x4e8: 0x39ac, 0x4e9: 0x3b3b, + 0x4ea: 0x3190, 0x4eb: 0x34a1, 0x4ec: 0x319a, 0x4ed: 0x34b0, 0x4ee: 0x31ae, 0x4ef: 0x34c4, + 0x4f0: 0x31a9, 0x4f1: 0x34bf, 0x4f2: 0x31ea, 0x4f3: 0x3500, 0x4f4: 0x31f9, 0x4f5: 0x350f, + 0x4f6: 0x31f4, 0x4f7: 0x350a, 0x4f8: 0x39b3, 0x4f9: 0x3b42, 0x4fa: 0x39ba, 0x4fb: 0x3b49, + 0x4fc: 0x31fe, 0x4fd: 0x3514, 0x4fe: 0x3203, 0x4ff: 0x3519, + // Block 0x14, offset 0x500 + 0x500: 0x3208, 0x501: 0x351e, 0x502: 0x320d, 0x503: 0x3523, 0x504: 0x321c, 0x505: 0x3532, + 0x506: 0x3217, 0x507: 0x352d, 0x508: 0x3221, 0x509: 0x353c, 0x50a: 0x3226, 0x50b: 0x3541, + 0x50c: 0x322b, 0x50d: 0x3546, 0x50e: 0x3249, 0x50f: 0x3564, 0x510: 0x3262, 0x511: 0x3582, + 0x512: 0x3271, 0x513: 0x3591, 0x514: 0x3276, 0x515: 0x3596, 0x516: 0x337a, 0x517: 0x34a6, + 0x518: 0x3537, 0x519: 0x3573, 0x51b: 0x35d1, + 0x520: 0x46a1, 0x521: 0x4732, 0x522: 0x2f83, 0x523: 0x328f, + 0x524: 0x3878, 0x525: 0x3a07, 0x526: 0x3871, 0x527: 0x3a00, 0x528: 0x3886, 0x529: 0x3a15, + 0x52a: 0x387f, 0x52b: 0x3a0e, 0x52c: 0x38be, 0x52d: 0x3a4d, 0x52e: 0x3894, 0x52f: 0x3a23, + 0x530: 0x388d, 0x531: 0x3a1c, 0x532: 0x38a2, 0x533: 0x3a31, 0x534: 0x389b, 0x535: 0x3a2a, + 0x536: 0x38c5, 0x537: 0x3a54, 0x538: 0x46b5, 0x539: 0x4746, 0x53a: 0x3000, 0x53b: 0x330c, + 0x53c: 0x2fec, 0x53d: 0x32f8, 0x53e: 0x38da, 0x53f: 0x3a69, + // Block 0x15, offset 0x540 + 0x540: 0x38d3, 0x541: 0x3a62, 0x542: 0x38e8, 0x543: 0x3a77, 0x544: 0x38e1, 0x545: 0x3a70, + 0x546: 0x38fd, 0x547: 0x3a8c, 0x548: 0x3091, 0x549: 0x339d, 0x54a: 0x30a5, 0x54b: 0x33b1, + 0x54c: 0x46e7, 0x54d: 0x4778, 0x54e: 0x3136, 0x54f: 0x3447, 0x550: 0x3920, 0x551: 0x3aaf, + 0x552: 0x3919, 0x553: 0x3aa8, 0x554: 0x392e, 0x555: 0x3abd, 0x556: 0x3927, 0x557: 0x3ab6, + 0x558: 0x3989, 0x559: 0x3b18, 0x55a: 0x396d, 0x55b: 0x3afc, 0x55c: 0x3966, 0x55d: 0x3af5, + 0x55e: 0x397b, 0x55f: 0x3b0a, 0x560: 0x3974, 0x561: 0x3b03, 0x562: 0x3982, 0x563: 0x3b11, + 0x564: 0x31e5, 0x565: 0x34fb, 0x566: 0x31c7, 0x567: 0x34dd, 0x568: 0x39e4, 0x569: 0x3b73, + 0x56a: 0x39dd, 0x56b: 0x3b6c, 0x56c: 0x39f2, 0x56d: 0x3b81, 0x56e: 0x39eb, 0x56f: 0x3b7a, + 0x570: 0x39f9, 0x571: 0x3b88, 0x572: 0x3230, 0x573: 0x354b, 0x574: 0x3258, 0x575: 0x3578, + 0x576: 0x3253, 0x577: 0x356e, 0x578: 0x323f, 0x579: 0x355a, + // Block 0x16, offset 0x580 + 0x580: 0x4804, 0x581: 0x480a, 0x582: 0x491e, 0x583: 0x4936, 0x584: 0x4926, 0x585: 0x493e, + 0x586: 0x492e, 0x587: 0x4946, 0x588: 0x47aa, 0x589: 0x47b0, 0x58a: 0x488e, 0x58b: 0x48a6, + 0x58c: 0x4896, 0x58d: 0x48ae, 0x58e: 0x489e, 0x58f: 0x48b6, 0x590: 0x4816, 0x591: 0x481c, + 0x592: 0x3db8, 0x593: 0x3dc8, 0x594: 0x3dc0, 0x595: 0x3dd0, + 0x598: 0x47b6, 0x599: 0x47bc, 0x59a: 0x3ce8, 0x59b: 0x3cf8, 0x59c: 0x3cf0, 0x59d: 0x3d00, + 0x5a0: 0x482e, 0x5a1: 0x4834, 0x5a2: 0x494e, 0x5a3: 0x4966, + 0x5a4: 0x4956, 0x5a5: 0x496e, 0x5a6: 0x495e, 0x5a7: 0x4976, 0x5a8: 0x47c2, 0x5a9: 0x47c8, + 0x5aa: 0x48be, 0x5ab: 0x48d6, 0x5ac: 0x48c6, 0x5ad: 0x48de, 0x5ae: 0x48ce, 0x5af: 0x48e6, + 0x5b0: 0x4846, 0x5b1: 0x484c, 0x5b2: 0x3e18, 0x5b3: 0x3e30, 0x5b4: 0x3e20, 0x5b5: 0x3e38, + 0x5b6: 0x3e28, 0x5b7: 0x3e40, 0x5b8: 0x47ce, 0x5b9: 0x47d4, 0x5ba: 0x3d18, 0x5bb: 0x3d30, + 0x5bc: 0x3d20, 0x5bd: 0x3d38, 0x5be: 0x3d28, 0x5bf: 0x3d40, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x4852, 0x5c1: 0x4858, 0x5c2: 0x3e48, 0x5c3: 0x3e58, 0x5c4: 0x3e50, 0x5c5: 0x3e60, + 0x5c8: 0x47da, 0x5c9: 0x47e0, 0x5ca: 0x3d48, 0x5cb: 0x3d58, + 0x5cc: 0x3d50, 0x5cd: 0x3d60, 0x5d0: 0x4864, 0x5d1: 0x486a, + 0x5d2: 0x3e80, 0x5d3: 0x3e98, 0x5d4: 0x3e88, 0x5d5: 0x3ea0, 0x5d6: 0x3e90, 0x5d7: 0x3ea8, + 0x5d9: 0x47e6, 0x5db: 0x3d68, 0x5dd: 0x3d70, + 0x5df: 0x3d78, 0x5e0: 0x487c, 0x5e1: 0x4882, 0x5e2: 0x497e, 0x5e3: 0x4996, + 0x5e4: 0x4986, 0x5e5: 0x499e, 0x5e6: 0x498e, 0x5e7: 0x49a6, 0x5e8: 0x47ec, 0x5e9: 0x47f2, + 0x5ea: 0x48ee, 0x5eb: 0x4906, 0x5ec: 0x48f6, 0x5ed: 0x490e, 0x5ee: 0x48fe, 0x5ef: 0x4916, + 0x5f0: 0x47f8, 0x5f1: 0x431e, 0x5f2: 0x3691, 0x5f3: 0x4324, 0x5f4: 0x4822, 0x5f5: 0x432a, + 0x5f6: 0x36a3, 0x5f7: 0x4330, 0x5f8: 0x36c1, 0x5f9: 0x4336, 0x5fa: 0x36d9, 0x5fb: 0x433c, + 0x5fc: 0x4870, 0x5fd: 0x4342, + // Block 0x18, offset 0x600 + 0x600: 0x3da0, 0x601: 0x3da8, 0x602: 0x4184, 0x603: 0x41a2, 0x604: 0x418e, 0x605: 0x41ac, + 0x606: 0x4198, 0x607: 0x41b6, 0x608: 0x3cd8, 0x609: 0x3ce0, 0x60a: 0x40d0, 0x60b: 0x40ee, + 0x60c: 0x40da, 0x60d: 0x40f8, 0x60e: 0x40e4, 0x60f: 0x4102, 0x610: 0x3de8, 0x611: 0x3df0, + 0x612: 0x41c0, 0x613: 0x41de, 0x614: 0x41ca, 0x615: 0x41e8, 0x616: 0x41d4, 0x617: 0x41f2, + 0x618: 0x3d08, 0x619: 0x3d10, 0x61a: 0x410c, 0x61b: 0x412a, 0x61c: 0x4116, 0x61d: 0x4134, + 0x61e: 0x4120, 0x61f: 0x413e, 0x620: 0x3ec0, 0x621: 0x3ec8, 0x622: 0x41fc, 0x623: 0x421a, + 0x624: 0x4206, 0x625: 0x4224, 0x626: 0x4210, 0x627: 0x422e, 0x628: 0x3d80, 0x629: 0x3d88, + 0x62a: 0x4148, 0x62b: 0x4166, 0x62c: 0x4152, 0x62d: 0x4170, 0x62e: 0x415c, 0x62f: 0x417a, + 0x630: 0x3685, 0x631: 0x367f, 0x632: 0x3d90, 0x633: 0x368b, 0x634: 0x3d98, + 0x636: 0x4810, 0x637: 0x3db0, 0x638: 0x35f5, 0x639: 0x35ef, 0x63a: 0x35e3, 0x63b: 0x42ee, + 0x63c: 0x35fb, 0x63d: 0x8100, 0x63e: 0x01d3, 0x63f: 0xa100, + // Block 0x19, offset 0x640 + 0x640: 0x8100, 0x641: 0x35a7, 0x642: 0x3dd8, 0x643: 0x369d, 0x644: 0x3de0, + 0x646: 0x483a, 0x647: 0x3df8, 0x648: 0x3601, 0x649: 0x42f4, 0x64a: 0x360d, 0x64b: 0x42fa, + 0x64c: 0x3619, 0x64d: 0x3b8f, 0x64e: 0x3b96, 0x64f: 0x3b9d, 0x650: 0x36b5, 0x651: 0x36af, + 0x652: 0x3e00, 0x653: 0x44e4, 0x656: 0x36bb, 0x657: 0x3e10, + 0x658: 0x3631, 0x659: 0x362b, 0x65a: 0x361f, 0x65b: 0x4300, 0x65d: 0x3ba4, + 0x65e: 0x3bab, 0x65f: 0x3bb2, 0x660: 0x36eb, 0x661: 0x36e5, 0x662: 0x3e68, 0x663: 0x44ec, + 0x664: 0x36cd, 0x665: 0x36d3, 0x666: 0x36f1, 0x667: 0x3e78, 0x668: 0x3661, 0x669: 0x365b, + 0x66a: 0x364f, 0x66b: 0x430c, 0x66c: 0x3649, 0x66d: 0x359b, 0x66e: 0x42e8, 0x66f: 0x0081, + 0x672: 0x3eb0, 0x673: 0x36f7, 0x674: 0x3eb8, + 0x676: 0x4888, 0x677: 0x3ed0, 0x678: 0x363d, 0x679: 0x4306, 0x67a: 0x366d, 0x67b: 0x4318, + 0x67c: 0x3679, 0x67d: 0x4256, 0x67e: 0xa100, + // Block 0x1a, offset 0x680 + 0x681: 0x3c06, 0x683: 0xa000, 0x684: 0x3c0d, 0x685: 0xa000, + 0x687: 0x3c14, 0x688: 0xa000, 0x689: 0x3c1b, + 0x68d: 0xa000, + 0x6a0: 0x2f65, 0x6a1: 0xa000, 0x6a2: 0x3c29, + 0x6a4: 0xa000, 0x6a5: 0xa000, + 0x6ad: 0x3c22, 0x6ae: 0x2f60, 0x6af: 0x2f6a, + 0x6b0: 0x3c30, 0x6b1: 0x3c37, 0x6b2: 0xa000, 0x6b3: 0xa000, 0x6b4: 0x3c3e, 0x6b5: 0x3c45, + 0x6b6: 0xa000, 0x6b7: 0xa000, 0x6b8: 0x3c4c, 0x6b9: 0x3c53, 0x6ba: 0xa000, 0x6bb: 0xa000, + 0x6bc: 0xa000, 0x6bd: 0xa000, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3c5a, 0x6c1: 0x3c61, 0x6c2: 0xa000, 0x6c3: 0xa000, 0x6c4: 0x3c76, 0x6c5: 0x3c7d, + 0x6c6: 0xa000, 0x6c7: 0xa000, 0x6c8: 0x3c84, 0x6c9: 0x3c8b, + 0x6d1: 0xa000, + 0x6d2: 0xa000, + 0x6e2: 0xa000, + 0x6e8: 0xa000, 0x6e9: 0xa000, + 0x6eb: 0xa000, 0x6ec: 0x3ca0, 0x6ed: 0x3ca7, 0x6ee: 0x3cae, 0x6ef: 0x3cb5, + 0x6f2: 0xa000, 0x6f3: 0xa000, 0x6f4: 0xa000, 0x6f5: 0xa000, + // Block 0x1c, offset 0x700 + 0x706: 0xa000, 0x70b: 0xa000, + 0x70c: 0x3f08, 0x70d: 0xa000, 0x70e: 0x3f10, 0x70f: 0xa000, 0x710: 0x3f18, 0x711: 0xa000, + 0x712: 0x3f20, 0x713: 0xa000, 0x714: 0x3f28, 0x715: 0xa000, 0x716: 0x3f30, 0x717: 0xa000, + 0x718: 0x3f38, 0x719: 0xa000, 0x71a: 0x3f40, 0x71b: 0xa000, 0x71c: 0x3f48, 0x71d: 0xa000, + 0x71e: 0x3f50, 0x71f: 0xa000, 0x720: 0x3f58, 0x721: 0xa000, 0x722: 0x3f60, + 0x724: 0xa000, 0x725: 0x3f68, 0x726: 0xa000, 0x727: 0x3f70, 0x728: 0xa000, 0x729: 0x3f78, + 0x72f: 0xa000, + 0x730: 0x3f80, 0x731: 0x3f88, 0x732: 0xa000, 0x733: 0x3f90, 0x734: 0x3f98, 0x735: 0xa000, + 0x736: 0x3fa0, 0x737: 0x3fa8, 0x738: 0xa000, 0x739: 0x3fb0, 0x73a: 0x3fb8, 0x73b: 0xa000, + 0x73c: 0x3fc0, 0x73d: 0x3fc8, + // Block 0x1d, offset 0x740 + 0x754: 0x3f00, + 0x759: 0x9903, 0x75a: 0x9903, 0x75b: 0x8100, 0x75c: 0x8100, 0x75d: 0xa000, + 0x75e: 0x3fd0, + 0x766: 0xa000, + 0x76b: 0xa000, 0x76c: 0x3fe0, 0x76d: 0xa000, 0x76e: 0x3fe8, 0x76f: 0xa000, + 0x770: 0x3ff0, 0x771: 0xa000, 0x772: 0x3ff8, 0x773: 0xa000, 0x774: 0x4000, 0x775: 0xa000, + 0x776: 0x4008, 0x777: 0xa000, 0x778: 0x4010, 0x779: 0xa000, 0x77a: 0x4018, 0x77b: 0xa000, + 0x77c: 0x4020, 0x77d: 0xa000, 0x77e: 0x4028, 0x77f: 0xa000, + // Block 0x1e, offset 0x780 + 0x780: 0x4030, 0x781: 0xa000, 0x782: 0x4038, 0x784: 0xa000, 0x785: 0x4040, + 0x786: 0xa000, 0x787: 0x4048, 0x788: 0xa000, 0x789: 0x4050, + 0x78f: 0xa000, 0x790: 0x4058, 0x791: 0x4060, + 0x792: 0xa000, 0x793: 0x4068, 0x794: 0x4070, 0x795: 0xa000, 0x796: 0x4078, 0x797: 0x4080, + 0x798: 0xa000, 0x799: 0x4088, 0x79a: 0x4090, 0x79b: 0xa000, 0x79c: 0x4098, 0x79d: 0x40a0, + 0x7af: 0xa000, + 0x7b0: 0xa000, 0x7b1: 0xa000, 0x7b2: 0xa000, 0x7b4: 0x3fd8, + 0x7b7: 0x40a8, 0x7b8: 0x40b0, 0x7b9: 0x40b8, 0x7ba: 0x40c0, + 0x7bd: 0xa000, 0x7be: 0x40c8, + // Block 0x1f, offset 0x7c0 + 0x7c0: 0x1377, 0x7c1: 0x0cfb, 0x7c2: 0x13d3, 0x7c3: 0x139f, 0x7c4: 0x0e57, 0x7c5: 0x06eb, + 0x7c6: 0x08df, 0x7c7: 0x162b, 0x7c8: 0x162b, 0x7c9: 0x0a0b, 0x7ca: 0x145f, 0x7cb: 0x0943, + 0x7cc: 0x0a07, 0x7cd: 0x0bef, 0x7ce: 0x0fcf, 0x7cf: 0x115f, 0x7d0: 0x1297, 0x7d1: 0x12d3, + 0x7d2: 0x1307, 0x7d3: 0x141b, 0x7d4: 0x0d73, 0x7d5: 0x0dff, 0x7d6: 0x0eab, 0x7d7: 0x0f43, + 0x7d8: 0x125f, 0x7d9: 0x1447, 0x7da: 0x1573, 0x7db: 0x070f, 0x7dc: 0x08b3, 0x7dd: 0x0d87, + 0x7de: 0x0ecf, 0x7df: 0x1293, 0x7e0: 0x15c3, 0x7e1: 0x0ab3, 0x7e2: 0x0e77, 0x7e3: 0x1283, + 0x7e4: 0x1317, 0x7e5: 0x0c23, 0x7e6: 0x11bb, 0x7e7: 0x12df, 0x7e8: 0x0b1f, 0x7e9: 0x0d0f, + 0x7ea: 0x0e17, 0x7eb: 0x0f1b, 0x7ec: 0x1427, 0x7ed: 0x074f, 0x7ee: 0x07e7, 0x7ef: 0x0853, + 0x7f0: 0x0c8b, 0x7f1: 0x0d7f, 0x7f2: 0x0ecb, 0x7f3: 0x0fef, 0x7f4: 0x1177, 0x7f5: 0x128b, + 0x7f6: 0x12a3, 0x7f7: 0x13c7, 0x7f8: 0x14ef, 0x7f9: 0x15a3, 0x7fa: 0x15bf, 0x7fb: 0x102b, + 0x7fc: 0x106b, 0x7fd: 0x1123, 0x7fe: 0x1243, 0x7ff: 0x147b, + // Block 0x20, offset 0x800 + 0x800: 0x15cb, 0x801: 0x134b, 0x802: 0x09c7, 0x803: 0x0b3b, 0x804: 0x10db, 0x805: 0x119b, + 0x806: 0x0eff, 0x807: 0x1033, 0x808: 0x1397, 0x809: 0x14e7, 0x80a: 0x09c3, 0x80b: 0x0a8f, + 0x80c: 0x0d77, 0x80d: 0x0e2b, 0x80e: 0x0e5f, 0x80f: 0x1113, 0x810: 0x113b, 0x811: 0x14a7, + 0x812: 0x084f, 0x813: 0x11a7, 0x814: 0x07f3, 0x815: 0x07ef, 0x816: 0x1097, 0x817: 0x1127, + 0x818: 0x125b, 0x819: 0x14af, 0x81a: 0x1367, 0x81b: 0x0c27, 0x81c: 0x0d73, 0x81d: 0x1357, + 0x81e: 0x06f7, 0x81f: 0x0a63, 0x820: 0x0b93, 0x821: 0x0f2f, 0x822: 0x0faf, 0x823: 0x0873, + 0x824: 0x103b, 0x825: 0x075f, 0x826: 0x0b77, 0x827: 0x06d7, 0x828: 0x0deb, 0x829: 0x0ca3, + 0x82a: 0x110f, 0x82b: 0x08c7, 0x82c: 0x09b3, 0x82d: 0x0ffb, 0x82e: 0x1263, 0x82f: 0x133b, + 0x830: 0x0db7, 0x831: 0x13f7, 0x832: 0x0de3, 0x833: 0x0c37, 0x834: 0x121b, 0x835: 0x0c57, + 0x836: 0x0fab, 0x837: 0x072b, 0x838: 0x07a7, 0x839: 0x07eb, 0x83a: 0x0d53, 0x83b: 0x10fb, + 0x83c: 0x11f3, 0x83d: 0x1347, 0x83e: 0x145b, 0x83f: 0x085b, + // Block 0x21, offset 0x840 + 0x840: 0x090f, 0x841: 0x0a17, 0x842: 0x0b2f, 0x843: 0x0cbf, 0x844: 0x0e7b, 0x845: 0x103f, + 0x846: 0x1497, 0x847: 0x157b, 0x848: 0x15cf, 0x849: 0x15e7, 0x84a: 0x0837, 0x84b: 0x0cf3, + 0x84c: 0x0da3, 0x84d: 0x13eb, 0x84e: 0x0afb, 0x84f: 0x0bd7, 0x850: 0x0bf3, 0x851: 0x0c83, + 0x852: 0x0e6b, 0x853: 0x0eb7, 0x854: 0x0f67, 0x855: 0x108b, 0x856: 0x112f, 0x857: 0x1193, + 0x858: 0x13db, 0x859: 0x126b, 0x85a: 0x1403, 0x85b: 0x147f, 0x85c: 0x080f, 0x85d: 0x083b, + 0x85e: 0x0923, 0x85f: 0x0ea7, 0x860: 0x12f3, 0x861: 0x133b, 0x862: 0x0b1b, 0x863: 0x0b8b, + 0x864: 0x0c4f, 0x865: 0x0daf, 0x866: 0x10d7, 0x867: 0x0f23, 0x868: 0x073b, 0x869: 0x097f, + 0x86a: 0x0a63, 0x86b: 0x0ac7, 0x86c: 0x0b97, 0x86d: 0x0f3f, 0x86e: 0x0f5b, 0x86f: 0x116b, + 0x870: 0x118b, 0x871: 0x1463, 0x872: 0x14e3, 0x873: 0x14f3, 0x874: 0x152f, 0x875: 0x0753, + 0x876: 0x107f, 0x877: 0x144f, 0x878: 0x14cb, 0x879: 0x0baf, 0x87a: 0x0717, 0x87b: 0x0777, + 0x87c: 0x0a67, 0x87d: 0x0a87, 0x87e: 0x0caf, 0x87f: 0x0d73, + // Block 0x22, offset 0x880 + 0x880: 0x0ec3, 0x881: 0x0fcb, 0x882: 0x1277, 0x883: 0x1417, 0x884: 0x1623, 0x885: 0x0ce3, + 0x886: 0x14a3, 0x887: 0x0833, 0x888: 0x0d2f, 0x889: 0x0d3b, 0x88a: 0x0e0f, 0x88b: 0x0e47, + 0x88c: 0x0f4b, 0x88d: 0x0fa7, 0x88e: 0x1027, 0x88f: 0x110b, 0x890: 0x153b, 0x891: 0x07af, + 0x892: 0x0c03, 0x893: 0x14b3, 0x894: 0x0767, 0x895: 0x0aab, 0x896: 0x0e2f, 0x897: 0x13df, + 0x898: 0x0b67, 0x899: 0x0bb7, 0x89a: 0x0d43, 0x89b: 0x0f2f, 0x89c: 0x14bb, 0x89d: 0x0817, + 0x89e: 0x08ff, 0x89f: 0x0a97, 0x8a0: 0x0cd3, 0x8a1: 0x0d1f, 0x8a2: 0x0d5f, 0x8a3: 0x0df3, + 0x8a4: 0x0f47, 0x8a5: 0x0fbb, 0x8a6: 0x1157, 0x8a7: 0x12f7, 0x8a8: 0x1303, 0x8a9: 0x1457, + 0x8aa: 0x14d7, 0x8ab: 0x0883, 0x8ac: 0x0e4b, 0x8ad: 0x0903, 0x8ae: 0x0ec7, 0x8af: 0x0f6b, + 0x8b0: 0x1287, 0x8b1: 0x14bf, 0x8b2: 0x15ab, 0x8b3: 0x15d3, 0x8b4: 0x0d37, 0x8b5: 0x0e27, + 0x8b6: 0x11c3, 0x8b7: 0x10b7, 0x8b8: 0x10c3, 0x8b9: 0x10e7, 0x8ba: 0x0f17, 0x8bb: 0x0e9f, + 0x8bc: 0x1363, 0x8bd: 0x0733, 0x8be: 0x122b, 0x8bf: 0x081b, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x080b, 0x8c1: 0x0b0b, 0x8c2: 0x0c2b, 0x8c3: 0x10f3, 0x8c4: 0x0a53, 0x8c5: 0x0e03, + 0x8c6: 0x0cef, 0x8c7: 0x13e7, 0x8c8: 0x12e7, 0x8c9: 0x14ab, 0x8ca: 0x1323, 0x8cb: 0x0b27, + 0x8cc: 0x0787, 0x8cd: 0x095b, 0x8d0: 0x09af, + 0x8d2: 0x0cdf, 0x8d5: 0x07f7, 0x8d6: 0x0f1f, 0x8d7: 0x0fe3, + 0x8d8: 0x1047, 0x8d9: 0x1063, 0x8da: 0x1067, 0x8db: 0x107b, 0x8dc: 0x14fb, 0x8dd: 0x10eb, + 0x8de: 0x116f, 0x8e0: 0x128f, 0x8e2: 0x1353, + 0x8e5: 0x1407, 0x8e6: 0x1433, + 0x8ea: 0x154f, 0x8eb: 0x1553, 0x8ec: 0x1557, 0x8ed: 0x15bb, 0x8ee: 0x142b, 0x8ef: 0x14c7, + 0x8f0: 0x0757, 0x8f1: 0x077b, 0x8f2: 0x078f, 0x8f3: 0x084b, 0x8f4: 0x0857, 0x8f5: 0x0897, + 0x8f6: 0x094b, 0x8f7: 0x0967, 0x8f8: 0x096f, 0x8f9: 0x09ab, 0x8fa: 0x09b7, 0x8fb: 0x0a93, + 0x8fc: 0x0a9b, 0x8fd: 0x0ba3, 0x8fe: 0x0bcb, 0x8ff: 0x0bd3, + // Block 0x24, offset 0x900 + 0x900: 0x0beb, 0x901: 0x0c97, 0x902: 0x0cc7, 0x903: 0x0ce7, 0x904: 0x0d57, 0x905: 0x0e1b, + 0x906: 0x0e37, 0x907: 0x0e67, 0x908: 0x0ebb, 0x909: 0x0edb, 0x90a: 0x0f4f, 0x90b: 0x102f, + 0x90c: 0x104b, 0x90d: 0x1053, 0x90e: 0x104f, 0x90f: 0x1057, 0x910: 0x105b, 0x911: 0x105f, + 0x912: 0x1073, 0x913: 0x1077, 0x914: 0x109b, 0x915: 0x10af, 0x916: 0x10cb, 0x917: 0x112f, + 0x918: 0x1137, 0x919: 0x113f, 0x91a: 0x1153, 0x91b: 0x117b, 0x91c: 0x11cb, 0x91d: 0x11ff, + 0x91e: 0x11ff, 0x91f: 0x1267, 0x920: 0x130f, 0x921: 0x1327, 0x922: 0x135b, 0x923: 0x135f, + 0x924: 0x13a3, 0x925: 0x13a7, 0x926: 0x13ff, 0x927: 0x1407, 0x928: 0x14db, 0x929: 0x151f, + 0x92a: 0x1537, 0x92b: 0x0b9b, 0x92c: 0x171e, 0x92d: 0x11e3, + 0x930: 0x06df, 0x931: 0x07e3, 0x932: 0x07a3, 0x933: 0x074b, 0x934: 0x078b, 0x935: 0x07b7, + 0x936: 0x0847, 0x937: 0x0863, 0x938: 0x094b, 0x939: 0x0937, 0x93a: 0x0947, 0x93b: 0x0963, + 0x93c: 0x09af, 0x93d: 0x09bf, 0x93e: 0x0a03, 0x93f: 0x0a0f, + // Block 0x25, offset 0x940 + 0x940: 0x0a2b, 0x941: 0x0a3b, 0x942: 0x0b23, 0x943: 0x0b2b, 0x944: 0x0b5b, 0x945: 0x0b7b, + 0x946: 0x0bab, 0x947: 0x0bc3, 0x948: 0x0bb3, 0x949: 0x0bd3, 0x94a: 0x0bc7, 0x94b: 0x0beb, + 0x94c: 0x0c07, 0x94d: 0x0c5f, 0x94e: 0x0c6b, 0x94f: 0x0c73, 0x950: 0x0c9b, 0x951: 0x0cdf, + 0x952: 0x0d0f, 0x953: 0x0d13, 0x954: 0x0d27, 0x955: 0x0da7, 0x956: 0x0db7, 0x957: 0x0e0f, + 0x958: 0x0e5b, 0x959: 0x0e53, 0x95a: 0x0e67, 0x95b: 0x0e83, 0x95c: 0x0ebb, 0x95d: 0x1013, + 0x95e: 0x0edf, 0x95f: 0x0f13, 0x960: 0x0f1f, 0x961: 0x0f5f, 0x962: 0x0f7b, 0x963: 0x0f9f, + 0x964: 0x0fc3, 0x965: 0x0fc7, 0x966: 0x0fe3, 0x967: 0x0fe7, 0x968: 0x0ff7, 0x969: 0x100b, + 0x96a: 0x1007, 0x96b: 0x1037, 0x96c: 0x10b3, 0x96d: 0x10cb, 0x96e: 0x10e3, 0x96f: 0x111b, + 0x970: 0x112f, 0x971: 0x114b, 0x972: 0x117b, 0x973: 0x122f, 0x974: 0x1257, 0x975: 0x12cb, + 0x976: 0x1313, 0x977: 0x131f, 0x978: 0x1327, 0x979: 0x133f, 0x97a: 0x1353, 0x97b: 0x1343, + 0x97c: 0x135b, 0x97d: 0x1357, 0x97e: 0x134f, 0x97f: 0x135f, + // Block 0x26, offset 0x980 + 0x980: 0x136b, 0x981: 0x13a7, 0x982: 0x13e3, 0x983: 0x1413, 0x984: 0x144b, 0x985: 0x146b, + 0x986: 0x14b7, 0x987: 0x14db, 0x988: 0x14fb, 0x989: 0x150f, 0x98a: 0x151f, 0x98b: 0x152b, + 0x98c: 0x1537, 0x98d: 0x158b, 0x98e: 0x162b, 0x98f: 0x16b5, 0x990: 0x16b0, 0x991: 0x16e2, + 0x992: 0x0607, 0x993: 0x062f, 0x994: 0x0633, 0x995: 0x1764, 0x996: 0x1791, 0x997: 0x1809, + 0x998: 0x1617, 0x999: 0x1627, + // Block 0x27, offset 0x9c0 + 0x9c0: 0x06fb, 0x9c1: 0x06f3, 0x9c2: 0x0703, 0x9c3: 0x1647, 0x9c4: 0x0747, 0x9c5: 0x0757, + 0x9c6: 0x075b, 0x9c7: 0x0763, 0x9c8: 0x076b, 0x9c9: 0x076f, 0x9ca: 0x077b, 0x9cb: 0x0773, + 0x9cc: 0x05b3, 0x9cd: 0x165b, 0x9ce: 0x078f, 0x9cf: 0x0793, 0x9d0: 0x0797, 0x9d1: 0x07b3, + 0x9d2: 0x164c, 0x9d3: 0x05b7, 0x9d4: 0x079f, 0x9d5: 0x07bf, 0x9d6: 0x1656, 0x9d7: 0x07cf, + 0x9d8: 0x07d7, 0x9d9: 0x0737, 0x9da: 0x07df, 0x9db: 0x07e3, 0x9dc: 0x1831, 0x9dd: 0x07ff, + 0x9de: 0x0807, 0x9df: 0x05bf, 0x9e0: 0x081f, 0x9e1: 0x0823, 0x9e2: 0x082b, 0x9e3: 0x082f, + 0x9e4: 0x05c3, 0x9e5: 0x0847, 0x9e6: 0x084b, 0x9e7: 0x0857, 0x9e8: 0x0863, 0x9e9: 0x0867, + 0x9ea: 0x086b, 0x9eb: 0x0873, 0x9ec: 0x0893, 0x9ed: 0x0897, 0x9ee: 0x089f, 0x9ef: 0x08af, + 0x9f0: 0x08b7, 0x9f1: 0x08bb, 0x9f2: 0x08bb, 0x9f3: 0x08bb, 0x9f4: 0x166a, 0x9f5: 0x0e93, + 0x9f6: 0x08cf, 0x9f7: 0x08d7, 0x9f8: 0x166f, 0x9f9: 0x08e3, 0x9fa: 0x08eb, 0x9fb: 0x08f3, + 0x9fc: 0x091b, 0x9fd: 0x0907, 0x9fe: 0x0913, 0x9ff: 0x0917, + // Block 0x28, offset 0xa00 + 0xa00: 0x091f, 0xa01: 0x0927, 0xa02: 0x092b, 0xa03: 0x0933, 0xa04: 0x093b, 0xa05: 0x093f, + 0xa06: 0x093f, 0xa07: 0x0947, 0xa08: 0x094f, 0xa09: 0x0953, 0xa0a: 0x095f, 0xa0b: 0x0983, + 0xa0c: 0x0967, 0xa0d: 0x0987, 0xa0e: 0x096b, 0xa0f: 0x0973, 0xa10: 0x080b, 0xa11: 0x09cf, + 0xa12: 0x0997, 0xa13: 0x099b, 0xa14: 0x099f, 0xa15: 0x0993, 0xa16: 0x09a7, 0xa17: 0x09a3, + 0xa18: 0x09bb, 0xa19: 0x1674, 0xa1a: 0x09d7, 0xa1b: 0x09db, 0xa1c: 0x09e3, 0xa1d: 0x09ef, + 0xa1e: 0x09f7, 0xa1f: 0x0a13, 0xa20: 0x1679, 0xa21: 0x167e, 0xa22: 0x0a1f, 0xa23: 0x0a23, + 0xa24: 0x0a27, 0xa25: 0x0a1b, 0xa26: 0x0a2f, 0xa27: 0x05c7, 0xa28: 0x05cb, 0xa29: 0x0a37, + 0xa2a: 0x0a3f, 0xa2b: 0x0a3f, 0xa2c: 0x1683, 0xa2d: 0x0a5b, 0xa2e: 0x0a5f, 0xa2f: 0x0a63, + 0xa30: 0x0a6b, 0xa31: 0x1688, 0xa32: 0x0a73, 0xa33: 0x0a77, 0xa34: 0x0b4f, 0xa35: 0x0a7f, + 0xa36: 0x05cf, 0xa37: 0x0a8b, 0xa38: 0x0a9b, 0xa39: 0x0aa7, 0xa3a: 0x0aa3, 0xa3b: 0x1692, + 0xa3c: 0x0aaf, 0xa3d: 0x1697, 0xa3e: 0x0abb, 0xa3f: 0x0ab7, + // Block 0x29, offset 0xa40 + 0xa40: 0x0abf, 0xa41: 0x0acf, 0xa42: 0x0ad3, 0xa43: 0x05d3, 0xa44: 0x0ae3, 0xa45: 0x0aeb, + 0xa46: 0x0aef, 0xa47: 0x0af3, 0xa48: 0x05d7, 0xa49: 0x169c, 0xa4a: 0x05db, 0xa4b: 0x0b0f, + 0xa4c: 0x0b13, 0xa4d: 0x0b17, 0xa4e: 0x0b1f, 0xa4f: 0x1863, 0xa50: 0x0b37, 0xa51: 0x16a6, + 0xa52: 0x16a6, 0xa53: 0x11d7, 0xa54: 0x0b47, 0xa55: 0x0b47, 0xa56: 0x05df, 0xa57: 0x16c9, + 0xa58: 0x179b, 0xa59: 0x0b57, 0xa5a: 0x0b5f, 0xa5b: 0x05e3, 0xa5c: 0x0b73, 0xa5d: 0x0b83, + 0xa5e: 0x0b87, 0xa5f: 0x0b8f, 0xa60: 0x0b9f, 0xa61: 0x05eb, 0xa62: 0x05e7, 0xa63: 0x0ba3, + 0xa64: 0x16ab, 0xa65: 0x0ba7, 0xa66: 0x0bbb, 0xa67: 0x0bbf, 0xa68: 0x0bc3, 0xa69: 0x0bbf, + 0xa6a: 0x0bcf, 0xa6b: 0x0bd3, 0xa6c: 0x0be3, 0xa6d: 0x0bdb, 0xa6e: 0x0bdf, 0xa6f: 0x0be7, + 0xa70: 0x0beb, 0xa71: 0x0bef, 0xa72: 0x0bfb, 0xa73: 0x0bff, 0xa74: 0x0c17, 0xa75: 0x0c1f, + 0xa76: 0x0c2f, 0xa77: 0x0c43, 0xa78: 0x16ba, 0xa79: 0x0c3f, 0xa7a: 0x0c33, 0xa7b: 0x0c4b, + 0xa7c: 0x0c53, 0xa7d: 0x0c67, 0xa7e: 0x16bf, 0xa7f: 0x0c6f, + // Block 0x2a, offset 0xa80 + 0xa80: 0x0c63, 0xa81: 0x0c5b, 0xa82: 0x05ef, 0xa83: 0x0c77, 0xa84: 0x0c7f, 0xa85: 0x0c87, + 0xa86: 0x0c7b, 0xa87: 0x05f3, 0xa88: 0x0c97, 0xa89: 0x0c9f, 0xa8a: 0x16c4, 0xa8b: 0x0ccb, + 0xa8c: 0x0cff, 0xa8d: 0x0cdb, 0xa8e: 0x05ff, 0xa8f: 0x0ce7, 0xa90: 0x05fb, 0xa91: 0x05f7, + 0xa92: 0x07c3, 0xa93: 0x07c7, 0xa94: 0x0d03, 0xa95: 0x0ceb, 0xa96: 0x11ab, 0xa97: 0x0663, + 0xa98: 0x0d0f, 0xa99: 0x0d13, 0xa9a: 0x0d17, 0xa9b: 0x0d2b, 0xa9c: 0x0d23, 0xa9d: 0x16dd, + 0xa9e: 0x0603, 0xa9f: 0x0d3f, 0xaa0: 0x0d33, 0xaa1: 0x0d4f, 0xaa2: 0x0d57, 0xaa3: 0x16e7, + 0xaa4: 0x0d5b, 0xaa5: 0x0d47, 0xaa6: 0x0d63, 0xaa7: 0x0607, 0xaa8: 0x0d67, 0xaa9: 0x0d6b, + 0xaaa: 0x0d6f, 0xaab: 0x0d7b, 0xaac: 0x16ec, 0xaad: 0x0d83, 0xaae: 0x060b, 0xaaf: 0x0d8f, + 0xab0: 0x16f1, 0xab1: 0x0d93, 0xab2: 0x060f, 0xab3: 0x0d9f, 0xab4: 0x0dab, 0xab5: 0x0db7, + 0xab6: 0x0dbb, 0xab7: 0x16f6, 0xab8: 0x168d, 0xab9: 0x16fb, 0xaba: 0x0ddb, 0xabb: 0x1700, + 0xabc: 0x0de7, 0xabd: 0x0def, 0xabe: 0x0ddf, 0xabf: 0x0dfb, + // Block 0x2b, offset 0xac0 + 0xac0: 0x0e0b, 0xac1: 0x0e1b, 0xac2: 0x0e0f, 0xac3: 0x0e13, 0xac4: 0x0e1f, 0xac5: 0x0e23, + 0xac6: 0x1705, 0xac7: 0x0e07, 0xac8: 0x0e3b, 0xac9: 0x0e3f, 0xaca: 0x0613, 0xacb: 0x0e53, + 0xacc: 0x0e4f, 0xacd: 0x170a, 0xace: 0x0e33, 0xacf: 0x0e6f, 0xad0: 0x170f, 0xad1: 0x1714, + 0xad2: 0x0e73, 0xad3: 0x0e87, 0xad4: 0x0e83, 0xad5: 0x0e7f, 0xad6: 0x0617, 0xad7: 0x0e8b, + 0xad8: 0x0e9b, 0xad9: 0x0e97, 0xada: 0x0ea3, 0xadb: 0x1651, 0xadc: 0x0eb3, 0xadd: 0x1719, + 0xade: 0x0ebf, 0xadf: 0x1723, 0xae0: 0x0ed3, 0xae1: 0x0edf, 0xae2: 0x0ef3, 0xae3: 0x1728, + 0xae4: 0x0f07, 0xae5: 0x0f0b, 0xae6: 0x172d, 0xae7: 0x1732, 0xae8: 0x0f27, 0xae9: 0x0f37, + 0xaea: 0x061b, 0xaeb: 0x0f3b, 0xaec: 0x061f, 0xaed: 0x061f, 0xaee: 0x0f53, 0xaef: 0x0f57, + 0xaf0: 0x0f5f, 0xaf1: 0x0f63, 0xaf2: 0x0f6f, 0xaf3: 0x0623, 0xaf4: 0x0f87, 0xaf5: 0x1737, + 0xaf6: 0x0fa3, 0xaf7: 0x173c, 0xaf8: 0x0faf, 0xaf9: 0x16a1, 0xafa: 0x0fbf, 0xafb: 0x1741, + 0xafc: 0x1746, 0xafd: 0x174b, 0xafe: 0x0627, 0xaff: 0x062b, + // Block 0x2c, offset 0xb00 + 0xb00: 0x0ff7, 0xb01: 0x1755, 0xb02: 0x1750, 0xb03: 0x175a, 0xb04: 0x175f, 0xb05: 0x0fff, + 0xb06: 0x1003, 0xb07: 0x1003, 0xb08: 0x100b, 0xb09: 0x0633, 0xb0a: 0x100f, 0xb0b: 0x0637, + 0xb0c: 0x063b, 0xb0d: 0x1769, 0xb0e: 0x1023, 0xb0f: 0x102b, 0xb10: 0x1037, 0xb11: 0x063f, + 0xb12: 0x176e, 0xb13: 0x105b, 0xb14: 0x1773, 0xb15: 0x1778, 0xb16: 0x107b, 0xb17: 0x1093, + 0xb18: 0x0643, 0xb19: 0x109b, 0xb1a: 0x109f, 0xb1b: 0x10a3, 0xb1c: 0x177d, 0xb1d: 0x1782, + 0xb1e: 0x1782, 0xb1f: 0x10bb, 0xb20: 0x0647, 0xb21: 0x1787, 0xb22: 0x10cf, 0xb23: 0x10d3, + 0xb24: 0x064b, 0xb25: 0x178c, 0xb26: 0x10ef, 0xb27: 0x064f, 0xb28: 0x10ff, 0xb29: 0x10f7, + 0xb2a: 0x1107, 0xb2b: 0x1796, 0xb2c: 0x111f, 0xb2d: 0x0653, 0xb2e: 0x112b, 0xb2f: 0x1133, + 0xb30: 0x1143, 0xb31: 0x0657, 0xb32: 0x17a0, 0xb33: 0x17a5, 0xb34: 0x065b, 0xb35: 0x17aa, + 0xb36: 0x115b, 0xb37: 0x17af, 0xb38: 0x1167, 0xb39: 0x1173, 0xb3a: 0x117b, 0xb3b: 0x17b4, + 0xb3c: 0x17b9, 0xb3d: 0x118f, 0xb3e: 0x17be, 0xb3f: 0x1197, + // Block 0x2d, offset 0xb40 + 0xb40: 0x16ce, 0xb41: 0x065f, 0xb42: 0x11af, 0xb43: 0x11b3, 0xb44: 0x0667, 0xb45: 0x11b7, + 0xb46: 0x0a33, 0xb47: 0x17c3, 0xb48: 0x17c8, 0xb49: 0x16d3, 0xb4a: 0x16d8, 0xb4b: 0x11d7, + 0xb4c: 0x11db, 0xb4d: 0x13f3, 0xb4e: 0x066b, 0xb4f: 0x1207, 0xb50: 0x1203, 0xb51: 0x120b, + 0xb52: 0x083f, 0xb53: 0x120f, 0xb54: 0x1213, 0xb55: 0x1217, 0xb56: 0x121f, 0xb57: 0x17cd, + 0xb58: 0x121b, 0xb59: 0x1223, 0xb5a: 0x1237, 0xb5b: 0x123b, 0xb5c: 0x1227, 0xb5d: 0x123f, + 0xb5e: 0x1253, 0xb5f: 0x1267, 0xb60: 0x1233, 0xb61: 0x1247, 0xb62: 0x124b, 0xb63: 0x124f, + 0xb64: 0x17d2, 0xb65: 0x17dc, 0xb66: 0x17d7, 0xb67: 0x066f, 0xb68: 0x126f, 0xb69: 0x1273, + 0xb6a: 0x127b, 0xb6b: 0x17f0, 0xb6c: 0x127f, 0xb6d: 0x17e1, 0xb6e: 0x0673, 0xb6f: 0x0677, + 0xb70: 0x17e6, 0xb71: 0x17eb, 0xb72: 0x067b, 0xb73: 0x129f, 0xb74: 0x12a3, 0xb75: 0x12a7, + 0xb76: 0x12ab, 0xb77: 0x12b7, 0xb78: 0x12b3, 0xb79: 0x12bf, 0xb7a: 0x12bb, 0xb7b: 0x12cb, + 0xb7c: 0x12c3, 0xb7d: 0x12c7, 0xb7e: 0x12cf, 0xb7f: 0x067f, + // Block 0x2e, offset 0xb80 + 0xb80: 0x12d7, 0xb81: 0x12db, 0xb82: 0x0683, 0xb83: 0x12eb, 0xb84: 0x12ef, 0xb85: 0x17f5, + 0xb86: 0x12fb, 0xb87: 0x12ff, 0xb88: 0x0687, 0xb89: 0x130b, 0xb8a: 0x05bb, 0xb8b: 0x17fa, + 0xb8c: 0x17ff, 0xb8d: 0x068b, 0xb8e: 0x068f, 0xb8f: 0x1337, 0xb90: 0x134f, 0xb91: 0x136b, + 0xb92: 0x137b, 0xb93: 0x1804, 0xb94: 0x138f, 0xb95: 0x1393, 0xb96: 0x13ab, 0xb97: 0x13b7, + 0xb98: 0x180e, 0xb99: 0x1660, 0xb9a: 0x13c3, 0xb9b: 0x13bf, 0xb9c: 0x13cb, 0xb9d: 0x1665, + 0xb9e: 0x13d7, 0xb9f: 0x13e3, 0xba0: 0x1813, 0xba1: 0x1818, 0xba2: 0x1423, 0xba3: 0x142f, + 0xba4: 0x1437, 0xba5: 0x181d, 0xba6: 0x143b, 0xba7: 0x1467, 0xba8: 0x1473, 0xba9: 0x1477, + 0xbaa: 0x146f, 0xbab: 0x1483, 0xbac: 0x1487, 0xbad: 0x1822, 0xbae: 0x1493, 0xbaf: 0x0693, + 0xbb0: 0x149b, 0xbb1: 0x1827, 0xbb2: 0x0697, 0xbb3: 0x14d3, 0xbb4: 0x0ac3, 0xbb5: 0x14eb, + 0xbb6: 0x182c, 0xbb7: 0x1836, 0xbb8: 0x069b, 0xbb9: 0x069f, 0xbba: 0x1513, 0xbbb: 0x183b, + 0xbbc: 0x06a3, 0xbbd: 0x1840, 0xbbe: 0x152b, 0xbbf: 0x152b, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x1533, 0xbc1: 0x1845, 0xbc2: 0x154b, 0xbc3: 0x06a7, 0xbc4: 0x155b, 0xbc5: 0x1567, + 0xbc6: 0x156f, 0xbc7: 0x1577, 0xbc8: 0x06ab, 0xbc9: 0x184a, 0xbca: 0x158b, 0xbcb: 0x15a7, + 0xbcc: 0x15b3, 0xbcd: 0x06af, 0xbce: 0x06b3, 0xbcf: 0x15b7, 0xbd0: 0x184f, 0xbd1: 0x06b7, + 0xbd2: 0x1854, 0xbd3: 0x1859, 0xbd4: 0x185e, 0xbd5: 0x15db, 0xbd6: 0x06bb, 0xbd7: 0x15ef, + 0xbd8: 0x15f7, 0xbd9: 0x15fb, 0xbda: 0x1603, 0xbdb: 0x160b, 0xbdc: 0x1613, 0xbdd: 0x1868, +} + +// nfcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x2e, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x2f, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x30, 0xcb: 0x31, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x32, + 0xd0: 0x09, 0xd1: 0x33, 0xd2: 0x34, 0xd3: 0x0a, 0xd6: 0x0b, 0xd7: 0x35, + 0xd8: 0x36, 0xd9: 0x0c, 0xdb: 0x37, 0xdc: 0x38, 0xdd: 0x39, 0xdf: 0x3a, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x3b, 0x121: 0x3c, 0x123: 0x0d, 0x124: 0x3d, 0x125: 0x3e, 0x126: 0x3f, 0x127: 0x40, + 0x128: 0x41, 0x129: 0x42, 0x12a: 0x43, 0x12b: 0x44, 0x12c: 0x3f, 0x12d: 0x45, 0x12e: 0x46, 0x12f: 0x47, + 0x131: 0x48, 0x132: 0x49, 0x133: 0x4a, 0x134: 0x4b, 0x135: 0x4c, 0x137: 0x4d, + 0x138: 0x4e, 0x139: 0x4f, 0x13a: 0x50, 0x13b: 0x51, 0x13c: 0x52, 0x13d: 0x53, 0x13e: 0x54, 0x13f: 0x55, + // Block 0x5, offset 0x140 + 0x140: 0x56, 0x142: 0x57, 0x144: 0x58, 0x145: 0x59, 0x146: 0x5a, 0x147: 0x5b, + 0x14d: 0x5c, + 0x15c: 0x5d, 0x15f: 0x5e, + 0x162: 0x5f, 0x164: 0x60, + 0x168: 0x61, 0x169: 0x62, 0x16a: 0x63, 0x16c: 0x0e, 0x16d: 0x64, 0x16e: 0x65, 0x16f: 0x66, + 0x170: 0x67, 0x173: 0x68, 0x177: 0x0f, + 0x178: 0x10, 0x179: 0x11, 0x17a: 0x12, 0x17b: 0x13, 0x17c: 0x14, 0x17d: 0x15, 0x17e: 0x16, 0x17f: 0x17, + // Block 0x6, offset 0x180 + 0x180: 0x69, 0x183: 0x6a, 0x184: 0x6b, 0x186: 0x6c, 0x187: 0x6d, + 0x188: 0x6e, 0x189: 0x18, 0x18a: 0x19, 0x18b: 0x6f, 0x18c: 0x70, + 0x1ab: 0x71, + 0x1b3: 0x72, 0x1b5: 0x73, 0x1b7: 0x74, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x75, 0x1c1: 0x1a, 0x1c2: 0x1b, 0x1c3: 0x1c, 0x1c4: 0x76, 0x1c5: 0x77, + 0x1c9: 0x78, 0x1cc: 0x79, 0x1cd: 0x7a, + // Block 0x8, offset 0x200 + 0x219: 0x7b, 0x21a: 0x7c, 0x21b: 0x7d, + 0x220: 0x7e, 0x223: 0x7f, 0x224: 0x80, 0x225: 0x81, 0x226: 0x82, 0x227: 0x83, + 0x22a: 0x84, 0x22b: 0x85, 0x22f: 0x86, + 0x230: 0x87, 0x231: 0x88, 0x232: 0x89, 0x233: 0x8a, 0x234: 0x8b, 0x235: 0x8c, 0x236: 0x8d, 0x237: 0x87, + 0x238: 0x88, 0x239: 0x89, 0x23a: 0x8a, 0x23b: 0x8b, 0x23c: 0x8c, 0x23d: 0x8d, 0x23e: 0x87, 0x23f: 0x88, + // Block 0x9, offset 0x240 + 0x240: 0x89, 0x241: 0x8a, 0x242: 0x8b, 0x243: 0x8c, 0x244: 0x8d, 0x245: 0x87, 0x246: 0x88, 0x247: 0x89, + 0x248: 0x8a, 0x249: 0x8b, 0x24a: 0x8c, 0x24b: 0x8d, 0x24c: 0x87, 0x24d: 0x88, 0x24e: 0x89, 0x24f: 0x8a, + 0x250: 0x8b, 0x251: 0x8c, 0x252: 0x8d, 0x253: 0x87, 0x254: 0x88, 0x255: 0x89, 0x256: 0x8a, 0x257: 0x8b, + 0x258: 0x8c, 0x259: 0x8d, 0x25a: 0x87, 0x25b: 0x88, 0x25c: 0x89, 0x25d: 0x8a, 0x25e: 0x8b, 0x25f: 0x8c, + 0x260: 0x8d, 0x261: 0x87, 0x262: 0x88, 0x263: 0x89, 0x264: 0x8a, 0x265: 0x8b, 0x266: 0x8c, 0x267: 0x8d, + 0x268: 0x87, 0x269: 0x88, 0x26a: 0x89, 0x26b: 0x8a, 0x26c: 0x8b, 0x26d: 0x8c, 0x26e: 0x8d, 0x26f: 0x87, + 0x270: 0x88, 0x271: 0x89, 0x272: 0x8a, 0x273: 0x8b, 0x274: 0x8c, 0x275: 0x8d, 0x276: 0x87, 0x277: 0x88, + 0x278: 0x89, 0x279: 0x8a, 0x27a: 0x8b, 0x27b: 0x8c, 0x27c: 0x8d, 0x27d: 0x87, 0x27e: 0x88, 0x27f: 0x89, + // Block 0xa, offset 0x280 + 0x280: 0x8a, 0x281: 0x8b, 0x282: 0x8c, 0x283: 0x8d, 0x284: 0x87, 0x285: 0x88, 0x286: 0x89, 0x287: 0x8a, + 0x288: 0x8b, 0x289: 0x8c, 0x28a: 0x8d, 0x28b: 0x87, 0x28c: 0x88, 0x28d: 0x89, 0x28e: 0x8a, 0x28f: 0x8b, + 0x290: 0x8c, 0x291: 0x8d, 0x292: 0x87, 0x293: 0x88, 0x294: 0x89, 0x295: 0x8a, 0x296: 0x8b, 0x297: 0x8c, + 0x298: 0x8d, 0x299: 0x87, 0x29a: 0x88, 0x29b: 0x89, 0x29c: 0x8a, 0x29d: 0x8b, 0x29e: 0x8c, 0x29f: 0x8d, + 0x2a0: 0x87, 0x2a1: 0x88, 0x2a2: 0x89, 0x2a3: 0x8a, 0x2a4: 0x8b, 0x2a5: 0x8c, 0x2a6: 0x8d, 0x2a7: 0x87, + 0x2a8: 0x88, 0x2a9: 0x89, 0x2aa: 0x8a, 0x2ab: 0x8b, 0x2ac: 0x8c, 0x2ad: 0x8d, 0x2ae: 0x87, 0x2af: 0x88, + 0x2b0: 0x89, 0x2b1: 0x8a, 0x2b2: 0x8b, 0x2b3: 0x8c, 0x2b4: 0x8d, 0x2b5: 0x87, 0x2b6: 0x88, 0x2b7: 0x89, + 0x2b8: 0x8a, 0x2b9: 0x8b, 0x2ba: 0x8c, 0x2bb: 0x8d, 0x2bc: 0x87, 0x2bd: 0x88, 0x2be: 0x89, 0x2bf: 0x8a, + // Block 0xb, offset 0x2c0 + 0x2c0: 0x8b, 0x2c1: 0x8c, 0x2c2: 0x8d, 0x2c3: 0x87, 0x2c4: 0x88, 0x2c5: 0x89, 0x2c6: 0x8a, 0x2c7: 0x8b, + 0x2c8: 0x8c, 0x2c9: 0x8d, 0x2ca: 0x87, 0x2cb: 0x88, 0x2cc: 0x89, 0x2cd: 0x8a, 0x2ce: 0x8b, 0x2cf: 0x8c, + 0x2d0: 0x8d, 0x2d1: 0x87, 0x2d2: 0x88, 0x2d3: 0x89, 0x2d4: 0x8a, 0x2d5: 0x8b, 0x2d6: 0x8c, 0x2d7: 0x8d, + 0x2d8: 0x87, 0x2d9: 0x88, 0x2da: 0x89, 0x2db: 0x8a, 0x2dc: 0x8b, 0x2dd: 0x8c, 0x2de: 0x8e, + // Block 0xc, offset 0x300 + 0x324: 0x1d, 0x325: 0x1e, 0x326: 0x1f, 0x327: 0x20, + 0x328: 0x21, 0x329: 0x22, 0x32a: 0x23, 0x32b: 0x24, 0x32c: 0x8f, 0x32d: 0x90, 0x32e: 0x91, + 0x331: 0x92, 0x332: 0x93, 0x333: 0x94, 0x334: 0x95, + 0x338: 0x96, 0x339: 0x97, 0x33a: 0x98, 0x33b: 0x99, 0x33e: 0x9a, 0x33f: 0x9b, + // Block 0xd, offset 0x340 + 0x347: 0x9c, + 0x34b: 0x9d, 0x34d: 0x9e, + 0x368: 0x9f, 0x36b: 0xa0, + 0x374: 0xa1, + 0x37d: 0xa2, + // Block 0xe, offset 0x380 + 0x381: 0xa3, 0x382: 0xa4, 0x384: 0xa5, 0x385: 0x82, 0x387: 0xa6, + 0x388: 0xa7, 0x38b: 0xa8, 0x38c: 0xa9, 0x38d: 0xaa, + 0x391: 0xab, 0x392: 0xac, 0x393: 0xad, 0x396: 0xae, 0x397: 0xaf, + 0x398: 0x73, 0x39a: 0xb0, 0x39c: 0xb1, + 0x3a0: 0xb2, + 0x3a8: 0xb3, 0x3a9: 0xb4, 0x3aa: 0xb5, + 0x3b0: 0x73, 0x3b5: 0xb6, 0x3b6: 0xb7, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xb8, 0x3ec: 0xb9, + // Block 0x10, offset 0x400 + 0x432: 0xba, + // Block 0x11, offset 0x440 + 0x445: 0xbb, 0x446: 0xbc, 0x447: 0xbd, + 0x449: 0xbe, + // Block 0x12, offset 0x480 + 0x480: 0xbf, + 0x4a3: 0xc0, 0x4a5: 0xc1, + // Block 0x13, offset 0x4c0 + 0x4c8: 0xc2, + // Block 0x14, offset 0x500 + 0x520: 0x25, 0x521: 0x26, 0x522: 0x27, 0x523: 0x28, 0x524: 0x29, 0x525: 0x2a, 0x526: 0x2b, 0x527: 0x2c, + 0x528: 0x2d, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfcSparseOffset: 149 entries, 298 bytes +var nfcSparseOffset = []uint16{0x0, 0x5, 0x9, 0xb, 0xd, 0x18, 0x28, 0x2a, 0x2f, 0x3a, 0x49, 0x56, 0x5e, 0x63, 0x68, 0x6a, 0x72, 0x79, 0x7c, 0x84, 0x88, 0x8c, 0x8e, 0x90, 0x99, 0x9d, 0xa4, 0xa9, 0xac, 0xb6, 0xb9, 0xc0, 0xc8, 0xcb, 0xcd, 0xcf, 0xd1, 0xd6, 0xe7, 0xf3, 0xf5, 0xfb, 0xfd, 0xff, 0x101, 0x103, 0x105, 0x107, 0x10a, 0x10d, 0x10f, 0x112, 0x115, 0x119, 0x11e, 0x127, 0x129, 0x12c, 0x12e, 0x139, 0x13d, 0x14b, 0x14e, 0x154, 0x15a, 0x165, 0x169, 0x16b, 0x16d, 0x16f, 0x171, 0x173, 0x179, 0x17d, 0x17f, 0x181, 0x189, 0x18d, 0x190, 0x192, 0x194, 0x196, 0x199, 0x19b, 0x19d, 0x19f, 0x1a1, 0x1a7, 0x1aa, 0x1ac, 0x1b3, 0x1b9, 0x1bf, 0x1c7, 0x1cd, 0x1d3, 0x1d9, 0x1dd, 0x1eb, 0x1f4, 0x1f7, 0x1fa, 0x1fc, 0x1ff, 0x201, 0x205, 0x20a, 0x20c, 0x20e, 0x213, 0x219, 0x21b, 0x21d, 0x21f, 0x225, 0x228, 0x22a, 0x230, 0x233, 0x23b, 0x242, 0x245, 0x248, 0x24a, 0x24d, 0x255, 0x259, 0x260, 0x263, 0x269, 0x26b, 0x26e, 0x270, 0x273, 0x275, 0x277, 0x279, 0x27c, 0x27e, 0x280, 0x282, 0x284, 0x291, 0x29b, 0x29d, 0x29f, 0x2a5, 0x2a7, 0x2aa} + +// nfcSparseValues: 684 entries, 2736 bytes +var nfcSparseValues = [684]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0000, lo: 0x04}, + {value: 0xa100, lo: 0xa8, hi: 0xa8}, + {value: 0x8100, lo: 0xaf, hi: 0xaf}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb8, hi: 0xb8}, + // Block 0x1, offset 0x5 + {value: 0x0091, lo: 0x03}, + {value: 0x46e2, lo: 0xa0, hi: 0xa1}, + {value: 0x4714, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x9 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + // Block 0x3, offset 0xb + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x98, hi: 0x9d}, + // Block 0x4, offset 0xd + {value: 0x0006, lo: 0x0a}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x85, hi: 0x85}, + {value: 0xa000, lo: 0x89, hi: 0x89}, + {value: 0x4840, lo: 0x8a, hi: 0x8a}, + {value: 0x485e, lo: 0x8b, hi: 0x8b}, + {value: 0x36c7, lo: 0x8c, hi: 0x8c}, + {value: 0x36df, lo: 0x8d, hi: 0x8d}, + {value: 0x4876, lo: 0x8e, hi: 0x8e}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x36fd, lo: 0x93, hi: 0x94}, + // Block 0x5, offset 0x18 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x37a5, lo: 0x90, hi: 0x90}, + {value: 0x37b1, lo: 0x91, hi: 0x91}, + {value: 0x379f, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3817, lo: 0x97, hi: 0x97}, + {value: 0x37e1, lo: 0x9c, hi: 0x9c}, + {value: 0x37c9, lo: 0x9d, hi: 0x9d}, + {value: 0x37f3, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x381d, lo: 0xb6, hi: 0xb6}, + {value: 0x3823, lo: 0xb7, hi: 0xb7}, + // Block 0x6, offset 0x28 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x83, hi: 0x87}, + // Block 0x7, offset 0x2a + {value: 0x0001, lo: 0x04}, + {value: 0x8113, lo: 0x81, hi: 0x82}, + {value: 0x8132, lo: 0x84, hi: 0x84}, + {value: 0x812d, lo: 0x85, hi: 0x85}, + {value: 0x810d, lo: 0x87, hi: 0x87}, + // Block 0x8, offset 0x2f + {value: 0x0000, lo: 0x0a}, + {value: 0x8132, lo: 0x90, hi: 0x97}, + {value: 0x8119, lo: 0x98, hi: 0x98}, + {value: 0x811a, lo: 0x99, hi: 0x99}, + {value: 0x811b, lo: 0x9a, hi: 0x9a}, + {value: 0x3841, lo: 0xa2, hi: 0xa2}, + {value: 0x3847, lo: 0xa3, hi: 0xa3}, + {value: 0x3853, lo: 0xa4, hi: 0xa4}, + {value: 0x384d, lo: 0xa5, hi: 0xa5}, + {value: 0x3859, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x9, offset 0x3a + {value: 0x0000, lo: 0x0e}, + {value: 0x386b, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x385f, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x3865, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8132, lo: 0x96, hi: 0x9c}, + {value: 0x8132, lo: 0x9f, hi: 0xa2}, + {value: 0x812d, lo: 0xa3, hi: 0xa3}, + {value: 0x8132, lo: 0xa4, hi: 0xa4}, + {value: 0x8132, lo: 0xa7, hi: 0xa8}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xac}, + {value: 0x812d, lo: 0xad, hi: 0xad}, + // Block 0xa, offset 0x49 + {value: 0x0000, lo: 0x0c}, + {value: 0x811f, lo: 0x91, hi: 0x91}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + {value: 0x812d, lo: 0xb1, hi: 0xb1}, + {value: 0x8132, lo: 0xb2, hi: 0xb3}, + {value: 0x812d, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb5, hi: 0xb6}, + {value: 0x812d, lo: 0xb7, hi: 0xb9}, + {value: 0x8132, lo: 0xba, hi: 0xba}, + {value: 0x812d, lo: 0xbb, hi: 0xbc}, + {value: 0x8132, lo: 0xbd, hi: 0xbd}, + {value: 0x812d, lo: 0xbe, hi: 0xbe}, + {value: 0x8132, lo: 0xbf, hi: 0xbf}, + // Block 0xb, offset 0x56 + {value: 0x0005, lo: 0x07}, + {value: 0x8132, lo: 0x80, hi: 0x80}, + {value: 0x8132, lo: 0x81, hi: 0x81}, + {value: 0x812d, lo: 0x82, hi: 0x83}, + {value: 0x812d, lo: 0x84, hi: 0x85}, + {value: 0x812d, lo: 0x86, hi: 0x87}, + {value: 0x812d, lo: 0x88, hi: 0x89}, + {value: 0x8132, lo: 0x8a, hi: 0x8a}, + // Block 0xc, offset 0x5e + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0xab, hi: 0xb1}, + {value: 0x812d, lo: 0xb2, hi: 0xb2}, + {value: 0x8132, lo: 0xb3, hi: 0xb3}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0xd, offset 0x63 + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0x96, hi: 0x99}, + {value: 0x8132, lo: 0x9b, hi: 0xa3}, + {value: 0x8132, lo: 0xa5, hi: 0xa7}, + {value: 0x8132, lo: 0xa9, hi: 0xad}, + // Block 0xe, offset 0x68 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x99, hi: 0x9b}, + // Block 0xf, offset 0x6a + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x3ed8, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x3ee0, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x3ee8, lo: 0xb4, hi: 0xb4}, + {value: 0x9902, lo: 0xbc, hi: 0xbc}, + // Block 0x10, offset 0x72 + {value: 0x0008, lo: 0x06}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x8132, lo: 0x91, hi: 0x91}, + {value: 0x812d, lo: 0x92, hi: 0x92}, + {value: 0x8132, lo: 0x93, hi: 0x93}, + {value: 0x8132, lo: 0x94, hi: 0x94}, + {value: 0x451c, lo: 0x98, hi: 0x9f}, + // Block 0x11, offset 0x79 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x7c + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2c9e, lo: 0x8b, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x455c, lo: 0x9c, hi: 0x9d}, + {value: 0x456c, lo: 0x9f, hi: 0x9f}, + {value: 0x8132, lo: 0xbe, hi: 0xbe}, + // Block 0x13, offset 0x84 + {value: 0x0000, lo: 0x03}, + {value: 0x4594, lo: 0xb3, hi: 0xb3}, + {value: 0x459c, lo: 0xb6, hi: 0xb6}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + // Block 0x14, offset 0x88 + {value: 0x0008, lo: 0x03}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x4574, lo: 0x99, hi: 0x9b}, + {value: 0x458c, lo: 0x9e, hi: 0x9e}, + // Block 0x15, offset 0x8c + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + // Block 0x16, offset 0x8e + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + // Block 0x17, offset 0x90 + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2cb6, lo: 0x88, hi: 0x88}, + {value: 0x2cae, lo: 0x8b, hi: 0x8b}, + {value: 0x2cbe, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x45a4, lo: 0x9c, hi: 0x9c}, + {value: 0x45ac, lo: 0x9d, hi: 0x9d}, + // Block 0x18, offset 0x99 + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2cc6, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x19, offset 0x9d + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2cce, lo: 0x8a, hi: 0x8a}, + {value: 0x2cde, lo: 0x8b, hi: 0x8b}, + {value: 0x2cd6, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1a, offset 0xa4 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x3ef0, lo: 0x88, hi: 0x88}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x8120, lo: 0x95, hi: 0x96}, + // Block 0x1b, offset 0xa9 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1c, offset 0xac + {value: 0x0000, lo: 0x09}, + {value: 0x2ce6, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2cee, lo: 0x87, hi: 0x87}, + {value: 0x2cf6, lo: 0x88, hi: 0x88}, + {value: 0x2f50, lo: 0x8a, hi: 0x8a}, + {value: 0x2dd8, lo: 0x8b, hi: 0x8b}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1d, offset 0xb6 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1e, offset 0xb9 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2cfe, lo: 0x8a, hi: 0x8a}, + {value: 0x2d0e, lo: 0x8b, hi: 0x8b}, + {value: 0x2d06, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1f, offset 0xc0 + {value: 0x6bea, lo: 0x07}, + {value: 0x9904, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x3ef8, lo: 0x9a, hi: 0x9a}, + {value: 0x2f58, lo: 0x9c, hi: 0x9c}, + {value: 0x2de3, lo: 0x9d, hi: 0x9d}, + {value: 0x2d16, lo: 0x9e, hi: 0x9f}, + // Block 0x20, offset 0xc8 + {value: 0x0000, lo: 0x02}, + {value: 0x8122, lo: 0xb8, hi: 0xb9}, + {value: 0x8104, lo: 0xba, hi: 0xba}, + // Block 0x21, offset 0xcb + {value: 0x0000, lo: 0x01}, + {value: 0x8123, lo: 0x88, hi: 0x8b}, + // Block 0x22, offset 0xcd + {value: 0x0000, lo: 0x01}, + {value: 0x8124, lo: 0xb8, hi: 0xb9}, + // Block 0x23, offset 0xcf + {value: 0x0000, lo: 0x01}, + {value: 0x8125, lo: 0x88, hi: 0x8b}, + // Block 0x24, offset 0xd1 + {value: 0x0000, lo: 0x04}, + {value: 0x812d, lo: 0x98, hi: 0x99}, + {value: 0x812d, lo: 0xb5, hi: 0xb5}, + {value: 0x812d, lo: 0xb7, hi: 0xb7}, + {value: 0x812b, lo: 0xb9, hi: 0xb9}, + // Block 0x25, offset 0xd6 + {value: 0x0000, lo: 0x10}, + {value: 0x2644, lo: 0x83, hi: 0x83}, + {value: 0x264b, lo: 0x8d, hi: 0x8d}, + {value: 0x2652, lo: 0x92, hi: 0x92}, + {value: 0x2659, lo: 0x97, hi: 0x97}, + {value: 0x2660, lo: 0x9c, hi: 0x9c}, + {value: 0x263d, lo: 0xa9, hi: 0xa9}, + {value: 0x8126, lo: 0xb1, hi: 0xb1}, + {value: 0x8127, lo: 0xb2, hi: 0xb2}, + {value: 0x4a84, lo: 0xb3, hi: 0xb3}, + {value: 0x8128, lo: 0xb4, hi: 0xb4}, + {value: 0x4a8d, lo: 0xb5, hi: 0xb5}, + {value: 0x45b4, lo: 0xb6, hi: 0xb6}, + {value: 0x8200, lo: 0xb7, hi: 0xb7}, + {value: 0x45bc, lo: 0xb8, hi: 0xb8}, + {value: 0x8200, lo: 0xb9, hi: 0xb9}, + {value: 0x8127, lo: 0xba, hi: 0xbd}, + // Block 0x26, offset 0xe7 + {value: 0x0000, lo: 0x0b}, + {value: 0x8127, lo: 0x80, hi: 0x80}, + {value: 0x4a96, lo: 0x81, hi: 0x81}, + {value: 0x8132, lo: 0x82, hi: 0x83}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0x86, hi: 0x87}, + {value: 0x266e, lo: 0x93, hi: 0x93}, + {value: 0x2675, lo: 0x9d, hi: 0x9d}, + {value: 0x267c, lo: 0xa2, hi: 0xa2}, + {value: 0x2683, lo: 0xa7, hi: 0xa7}, + {value: 0x268a, lo: 0xac, hi: 0xac}, + {value: 0x2667, lo: 0xb9, hi: 0xb9}, + // Block 0x27, offset 0xf3 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x86, hi: 0x86}, + // Block 0x28, offset 0xf5 + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2d1e, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + {value: 0x8104, lo: 0xb9, hi: 0xba}, + // Block 0x29, offset 0xfb + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x8d, hi: 0x8d}, + // Block 0x2a, offset 0xfd + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2b, offset 0xff + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2c, offset 0x101 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2d, offset 0x103 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2e, offset 0x105 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x9d, hi: 0x9f}, + // Block 0x2f, offset 0x107 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x94, hi: 0x94}, + {value: 0x8104, lo: 0xb4, hi: 0xb4}, + // Block 0x30, offset 0x10a + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x92, hi: 0x92}, + {value: 0x8132, lo: 0x9d, hi: 0x9d}, + // Block 0x31, offset 0x10d + {value: 0x0000, lo: 0x01}, + {value: 0x8131, lo: 0xa9, hi: 0xa9}, + // Block 0x32, offset 0x10f + {value: 0x0004, lo: 0x02}, + {value: 0x812e, lo: 0xb9, hi: 0xba}, + {value: 0x812d, lo: 0xbb, hi: 0xbb}, + // Block 0x33, offset 0x112 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x97, hi: 0x97}, + {value: 0x812d, lo: 0x98, hi: 0x98}, + // Block 0x34, offset 0x115 + {value: 0x0000, lo: 0x03}, + {value: 0x8104, lo: 0xa0, hi: 0xa0}, + {value: 0x8132, lo: 0xb5, hi: 0xbc}, + {value: 0x812d, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x119 + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0xb0, hi: 0xb4}, + {value: 0x812d, lo: 0xb5, hi: 0xba}, + {value: 0x8132, lo: 0xbb, hi: 0xbc}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0x36, offset 0x11e + {value: 0x0000, lo: 0x08}, + {value: 0x2d66, lo: 0x80, hi: 0x80}, + {value: 0x2d6e, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2d76, lo: 0x83, hi: 0x83}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x812d, lo: 0xac, hi: 0xac}, + {value: 0x8132, lo: 0xad, hi: 0xb3}, + // Block 0x37, offset 0x127 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xaa, hi: 0xab}, + // Block 0x38, offset 0x129 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xa6, hi: 0xa6}, + {value: 0x8104, lo: 0xb2, hi: 0xb3}, + // Block 0x39, offset 0x12c + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + // Block 0x3a, offset 0x12e + {value: 0x0000, lo: 0x0a}, + {value: 0x8132, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812d, lo: 0x95, hi: 0x99}, + {value: 0x8132, lo: 0x9a, hi: 0x9b}, + {value: 0x812d, lo: 0x9c, hi: 0x9f}, + {value: 0x8132, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812d, lo: 0xad, hi: 0xad}, + {value: 0x8132, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb8, hi: 0xb9}, + // Block 0x3b, offset 0x139 + {value: 0x0004, lo: 0x03}, + {value: 0x0433, lo: 0x80, hi: 0x81}, + {value: 0x8100, lo: 0x97, hi: 0x97}, + {value: 0x8100, lo: 0xbe, hi: 0xbe}, + // Block 0x3c, offset 0x13d + {value: 0x0000, lo: 0x0d}, + {value: 0x8132, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8132, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8132, lo: 0x9b, hi: 0x9c}, + {value: 0x8132, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8132, lo: 0xa7, hi: 0xa7}, + {value: 0x812d, lo: 0xa8, hi: 0xa8}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812d, lo: 0xac, hi: 0xaf}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + // Block 0x3d, offset 0x14b + {value: 0x427b, lo: 0x02}, + {value: 0x01b8, lo: 0xa6, hi: 0xa6}, + {value: 0x0057, lo: 0xaa, hi: 0xab}, + // Block 0x3e, offset 0x14e + {value: 0x0007, lo: 0x05}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3bb9, lo: 0x9a, hi: 0x9b}, + {value: 0x3bc7, lo: 0xae, hi: 0xae}, + // Block 0x3f, offset 0x154 + {value: 0x000e, lo: 0x05}, + {value: 0x3bce, lo: 0x8d, hi: 0x8e}, + {value: 0x3bd5, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x40, offset 0x15a + {value: 0x6408, lo: 0x0a}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3be3, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3bea, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3bf1, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3bf8, lo: 0xa4, hi: 0xa5}, + {value: 0x3bff, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x41, offset 0x165 + {value: 0x0007, lo: 0x03}, + {value: 0x3c68, lo: 0xa0, hi: 0xa1}, + {value: 0x3c92, lo: 0xa2, hi: 0xa3}, + {value: 0x3cbc, lo: 0xaa, hi: 0xad}, + // Block 0x42, offset 0x169 + {value: 0x0004, lo: 0x01}, + {value: 0x048b, lo: 0xa9, hi: 0xaa}, + // Block 0x43, offset 0x16b + {value: 0x0000, lo: 0x01}, + {value: 0x44dd, lo: 0x9c, hi: 0x9c}, + // Block 0x44, offset 0x16d + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xaf, hi: 0xb1}, + // Block 0x45, offset 0x16f + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x46, offset 0x171 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa0, hi: 0xbf}, + // Block 0x47, offset 0x173 + {value: 0x0000, lo: 0x05}, + {value: 0x812c, lo: 0xaa, hi: 0xaa}, + {value: 0x8131, lo: 0xab, hi: 0xab}, + {value: 0x8133, lo: 0xac, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x812f, lo: 0xae, hi: 0xaf}, + // Block 0x48, offset 0x179 + {value: 0x0000, lo: 0x03}, + {value: 0x4a9f, lo: 0xb3, hi: 0xb3}, + {value: 0x4a9f, lo: 0xb5, hi: 0xb6}, + {value: 0x4a9f, lo: 0xba, hi: 0xbf}, + // Block 0x49, offset 0x17d + {value: 0x0000, lo: 0x01}, + {value: 0x4a9f, lo: 0x8f, hi: 0xa3}, + // Block 0x4a, offset 0x17f + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xae, hi: 0xbe}, + // Block 0x4b, offset 0x181 + {value: 0x0000, lo: 0x07}, + {value: 0x8100, lo: 0x84, hi: 0x84}, + {value: 0x8100, lo: 0x87, hi: 0x87}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + {value: 0x8100, lo: 0x9e, hi: 0x9e}, + {value: 0x8100, lo: 0xa1, hi: 0xa1}, + {value: 0x8100, lo: 0xb2, hi: 0xb2}, + {value: 0x8100, lo: 0xbb, hi: 0xbb}, + // Block 0x4c, offset 0x189 + {value: 0x0000, lo: 0x03}, + {value: 0x8100, lo: 0x80, hi: 0x80}, + {value: 0x8100, lo: 0x8b, hi: 0x8b}, + {value: 0x8100, lo: 0x8e, hi: 0x8e}, + // Block 0x4d, offset 0x18d + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0xaf, hi: 0xaf}, + {value: 0x8132, lo: 0xb4, hi: 0xbd}, + // Block 0x4e, offset 0x190 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x9e, hi: 0x9f}, + // Block 0x4f, offset 0x192 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb0, hi: 0xb1}, + // Block 0x50, offset 0x194 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x86, hi: 0x86}, + // Block 0x51, offset 0x196 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0xa0, hi: 0xb1}, + // Block 0x52, offset 0x199 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xab, hi: 0xad}, + // Block 0x53, offset 0x19b + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x93, hi: 0x93}, + // Block 0x54, offset 0x19d + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb3, hi: 0xb3}, + // Block 0x55, offset 0x19f + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x80, hi: 0x80}, + // Block 0x56, offset 0x1a1 + {value: 0x0000, lo: 0x05}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + {value: 0x8132, lo: 0xb2, hi: 0xb3}, + {value: 0x812d, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb7, hi: 0xb8}, + {value: 0x8132, lo: 0xbe, hi: 0xbf}, + // Block 0x57, offset 0x1a7 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x81, hi: 0x81}, + {value: 0x8104, lo: 0xb6, hi: 0xb6}, + // Block 0x58, offset 0x1aa + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xad, hi: 0xad}, + // Block 0x59, offset 0x1ac + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x5a, offset 0x1b3 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x5b, offset 0x1b9 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x5c, offset 0x1bf + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x5d, offset 0x1c7 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x5e, offset 0x1cd + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x5f, offset 0x1d3 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x60, offset 0x1d9 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x61, offset 0x1dd + {value: 0x0006, lo: 0x0d}, + {value: 0x4390, lo: 0x9d, hi: 0x9d}, + {value: 0x8115, lo: 0x9e, hi: 0x9e}, + {value: 0x4402, lo: 0x9f, hi: 0x9f}, + {value: 0x43f0, lo: 0xaa, hi: 0xab}, + {value: 0x44f4, lo: 0xac, hi: 0xac}, + {value: 0x44fc, lo: 0xad, hi: 0xad}, + {value: 0x4348, lo: 0xae, hi: 0xb1}, + {value: 0x4366, lo: 0xb2, hi: 0xb4}, + {value: 0x437e, lo: 0xb5, hi: 0xb6}, + {value: 0x438a, lo: 0xb8, hi: 0xb8}, + {value: 0x4396, lo: 0xb9, hi: 0xbb}, + {value: 0x43ae, lo: 0xbc, hi: 0xbc}, + {value: 0x43b4, lo: 0xbe, hi: 0xbe}, + // Block 0x62, offset 0x1eb + {value: 0x0006, lo: 0x08}, + {value: 0x43ba, lo: 0x80, hi: 0x81}, + {value: 0x43c6, lo: 0x83, hi: 0x84}, + {value: 0x43d8, lo: 0x86, hi: 0x89}, + {value: 0x43fc, lo: 0x8a, hi: 0x8a}, + {value: 0x4378, lo: 0x8b, hi: 0x8b}, + {value: 0x4360, lo: 0x8c, hi: 0x8c}, + {value: 0x43a8, lo: 0x8d, hi: 0x8d}, + {value: 0x43d2, lo: 0x8e, hi: 0x8e}, + // Block 0x63, offset 0x1f4 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0xa4, hi: 0xa5}, + {value: 0x8100, lo: 0xb0, hi: 0xb1}, + // Block 0x64, offset 0x1f7 + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x9b, hi: 0x9d}, + {value: 0x8200, lo: 0x9e, hi: 0xa3}, + // Block 0x65, offset 0x1fa + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x90, hi: 0x90}, + // Block 0x66, offset 0x1fc + {value: 0x0000, lo: 0x02}, + {value: 0x8100, lo: 0x99, hi: 0x99}, + {value: 0x8200, lo: 0xb2, hi: 0xb4}, + // Block 0x67, offset 0x1ff + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xbc, hi: 0xbd}, + // Block 0x68, offset 0x201 + {value: 0x0000, lo: 0x03}, + {value: 0x8132, lo: 0xa0, hi: 0xa6}, + {value: 0x812d, lo: 0xa7, hi: 0xad}, + {value: 0x8132, lo: 0xae, hi: 0xaf}, + // Block 0x69, offset 0x205 + {value: 0x0000, lo: 0x04}, + {value: 0x8100, lo: 0x89, hi: 0x8c}, + {value: 0x8100, lo: 0xb0, hi: 0xb2}, + {value: 0x8100, lo: 0xb4, hi: 0xb4}, + {value: 0x8100, lo: 0xb6, hi: 0xbf}, + // Block 0x6a, offset 0x20a + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x81, hi: 0x8c}, + // Block 0x6b, offset 0x20c + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0xb5, hi: 0xba}, + // Block 0x6c, offset 0x20e + {value: 0x0000, lo: 0x04}, + {value: 0x4a9f, lo: 0x9e, hi: 0x9f}, + {value: 0x4a9f, lo: 0xa3, hi: 0xa3}, + {value: 0x4a9f, lo: 0xa5, hi: 0xa6}, + {value: 0x4a9f, lo: 0xaa, hi: 0xaf}, + // Block 0x6d, offset 0x213 + {value: 0x0000, lo: 0x05}, + {value: 0x4a9f, lo: 0x82, hi: 0x87}, + {value: 0x4a9f, lo: 0x8a, hi: 0x8f}, + {value: 0x4a9f, lo: 0x92, hi: 0x97}, + {value: 0x4a9f, lo: 0x9a, hi: 0x9c}, + {value: 0x8100, lo: 0xa3, hi: 0xa3}, + // Block 0x6e, offset 0x219 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0x6f, offset 0x21b + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xa0, hi: 0xa0}, + // Block 0x70, offset 0x21d + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb6, hi: 0xba}, + // Block 0x71, offset 0x21f + {value: 0x002c, lo: 0x05}, + {value: 0x812d, lo: 0x8d, hi: 0x8d}, + {value: 0x8132, lo: 0x8f, hi: 0x8f}, + {value: 0x8132, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x72, offset 0x225 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0xa5, hi: 0xa5}, + {value: 0x812d, lo: 0xa6, hi: 0xa6}, + // Block 0x73, offset 0x228 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa4, hi: 0xa7}, + // Block 0x74, offset 0x22a + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0x86, hi: 0x87}, + {value: 0x8132, lo: 0x88, hi: 0x8a}, + {value: 0x812d, lo: 0x8b, hi: 0x8b}, + {value: 0x8132, lo: 0x8c, hi: 0x8c}, + {value: 0x812d, lo: 0x8d, hi: 0x90}, + // Block 0x75, offset 0x230 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x86, hi: 0x86}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x76, offset 0x233 + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4238, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4242, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x424c, lo: 0xab, hi: 0xab}, + {value: 0x8104, lo: 0xb9, hi: 0xba}, + // Block 0x77, offset 0x23b + {value: 0x0000, lo: 0x06}, + {value: 0x8132, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2d7e, lo: 0xae, hi: 0xae}, + {value: 0x2d88, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8104, lo: 0xb3, hi: 0xb4}, + // Block 0x78, offset 0x242 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x80, hi: 0x80}, + {value: 0x8102, lo: 0x8a, hi: 0x8a}, + // Block 0x79, offset 0x245 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb5, hi: 0xb5}, + {value: 0x8102, lo: 0xb6, hi: 0xb6}, + // Block 0x7a, offset 0x248 + {value: 0x0002, lo: 0x01}, + {value: 0x8102, lo: 0xa9, hi: 0xaa}, + // Block 0x7b, offset 0x24a + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x7c, offset 0x24d + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2d92, lo: 0x8b, hi: 0x8b}, + {value: 0x2d9c, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8132, lo: 0xa6, hi: 0xac}, + {value: 0x8132, lo: 0xb0, hi: 0xb4}, + // Block 0x7d, offset 0x255 + {value: 0x0000, lo: 0x03}, + {value: 0x8104, lo: 0x82, hi: 0x82}, + {value: 0x8102, lo: 0x86, hi: 0x86}, + {value: 0x8132, lo: 0x9e, hi: 0x9e}, + // Block 0x7e, offset 0x259 + {value: 0x6b5a, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2db0, lo: 0xbb, hi: 0xbb}, + {value: 0x2da6, lo: 0xbc, hi: 0xbd}, + {value: 0x2dba, lo: 0xbe, hi: 0xbe}, + // Block 0x7f, offset 0x260 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x82, hi: 0x82}, + {value: 0x8102, lo: 0x83, hi: 0x83}, + // Block 0x80, offset 0x263 + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2dc4, lo: 0xba, hi: 0xba}, + {value: 0x2dce, lo: 0xbb, hi: 0xbb}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x81, offset 0x269 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0x80, hi: 0x80}, + // Block 0x82, offset 0x26b + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb6, hi: 0xb6}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + // Block 0x83, offset 0x26e + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xab, hi: 0xab}, + // Block 0x84, offset 0x270 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb9, hi: 0xb9}, + {value: 0x8102, lo: 0xba, hi: 0xba}, + // Block 0x85, offset 0x273 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xb4, hi: 0xb4}, + // Block 0x86, offset 0x275 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x87, hi: 0x87}, + // Block 0x87, offset 0x277 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x99, hi: 0x99}, + // Block 0x88, offset 0x279 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0x82, hi: 0x82}, + {value: 0x8104, lo: 0x84, hi: 0x85}, + // Block 0x89, offset 0x27c + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x97, hi: 0x97}, + // Block 0x8a, offset 0x27e + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x8b, offset 0x280 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb0, hi: 0xb6}, + // Block 0x8c, offset 0x282 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x8d, offset 0x284 + {value: 0x0000, lo: 0x0c}, + {value: 0x45cc, lo: 0x9e, hi: 0x9e}, + {value: 0x45d6, lo: 0x9f, hi: 0x9f}, + {value: 0x460a, lo: 0xa0, hi: 0xa0}, + {value: 0x4618, lo: 0xa1, hi: 0xa1}, + {value: 0x4626, lo: 0xa2, hi: 0xa2}, + {value: 0x4634, lo: 0xa3, hi: 0xa3}, + {value: 0x4642, lo: 0xa4, hi: 0xa4}, + {value: 0x812b, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8130, lo: 0xad, hi: 0xad}, + {value: 0x812b, lo: 0xae, hi: 0xb2}, + {value: 0x812d, lo: 0xbb, hi: 0xbf}, + // Block 0x8e, offset 0x291 + {value: 0x0000, lo: 0x09}, + {value: 0x812d, lo: 0x80, hi: 0x82}, + {value: 0x8132, lo: 0x85, hi: 0x89}, + {value: 0x812d, lo: 0x8a, hi: 0x8b}, + {value: 0x8132, lo: 0xaa, hi: 0xad}, + {value: 0x45e0, lo: 0xbb, hi: 0xbb}, + {value: 0x45ea, lo: 0xbc, hi: 0xbc}, + {value: 0x4650, lo: 0xbd, hi: 0xbd}, + {value: 0x466c, lo: 0xbe, hi: 0xbe}, + {value: 0x465e, lo: 0xbf, hi: 0xbf}, + // Block 0x8f, offset 0x29b + {value: 0x0000, lo: 0x01}, + {value: 0x467a, lo: 0x80, hi: 0x80}, + // Block 0x90, offset 0x29d + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x82, hi: 0x84}, + // Block 0x91, offset 0x29f + {value: 0x0000, lo: 0x05}, + {value: 0x8132, lo: 0x80, hi: 0x86}, + {value: 0x8132, lo: 0x88, hi: 0x98}, + {value: 0x8132, lo: 0x9b, hi: 0xa1}, + {value: 0x8132, lo: 0xa3, hi: 0xa4}, + {value: 0x8132, lo: 0xa6, hi: 0xaa}, + // Block 0x92, offset 0x2a5 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x90, hi: 0x96}, + // Block 0x93, offset 0x2a7 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x84, hi: 0x89}, + {value: 0x8102, lo: 0x8a, hi: 0x8a}, + // Block 0x94, offset 0x2aa + {value: 0x0000, lo: 0x01}, + {value: 0x8100, lo: 0x93, hi: 0x93}, +} + +// lookup returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookup(s []byte) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupUnsafe(s []byte) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// lookupString returns the trie value for the first UTF-8 encoding in s and +// the width in bytes of this encoding. The size will be 0 if s does not +// hold enough bytes to complete the encoding. len(s) must be greater than 0. +func (t *nfkcTrie) lookupString(s string) (v uint16, sz int) { + c0 := s[0] + switch { + case c0 < 0x80: // is ASCII + return nfkcValues[c0], 1 + case c0 < 0xC2: + return 0, 1 // Illegal UTF-8: not a starter, not ASCII. + case c0 < 0xE0: // 2-byte UTF-8 + if len(s) < 2 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c1), 2 + case c0 < 0xF0: // 3-byte UTF-8 + if len(s) < 3 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c2), 3 + case c0 < 0xF8: // 4-byte UTF-8 + if len(s) < 4 { + return 0, 0 + } + i := nfkcIndex[c0] + c1 := s[1] + if c1 < 0x80 || 0xC0 <= c1 { + return 0, 1 // Illegal UTF-8: not a continuation byte. + } + o := uint32(i)<<6 + uint32(c1) + i = nfkcIndex[o] + c2 := s[2] + if c2 < 0x80 || 0xC0 <= c2 { + return 0, 2 // Illegal UTF-8: not a continuation byte. + } + o = uint32(i)<<6 + uint32(c2) + i = nfkcIndex[o] + c3 := s[3] + if c3 < 0x80 || 0xC0 <= c3 { + return 0, 3 // Illegal UTF-8: not a continuation byte. + } + return t.lookupValue(uint32(i), c3), 4 + } + // Illegal rune + return 0, 1 +} + +// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. +// s must start with a full and valid UTF-8 encoded rune. +func (t *nfkcTrie) lookupStringUnsafe(s string) uint16 { + c0 := s[0] + if c0 < 0x80 { // is ASCII + return nfkcValues[c0] + } + i := nfkcIndex[c0] + if c0 < 0xE0 { // 2-byte UTF-8 + return t.lookupValue(uint32(i), s[1]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[1])] + if c0 < 0xF0 { // 3-byte UTF-8 + return t.lookupValue(uint32(i), s[2]) + } + i = nfkcIndex[uint32(i)<<6+uint32(s[2])] + if c0 < 0xF8 { // 4-byte UTF-8 + return t.lookupValue(uint32(i), s[3]) + } + return 0 +} + +// nfkcTrie. Total size: 17248 bytes (16.84 KiB). Checksum: 4fb368372b6b1b27. +type nfkcTrie struct{} + +func newNfkcTrie(i int) *nfkcTrie { + return &nfkcTrie{} +} + +// lookupValue determines the type of block n and looks up the value for b. +func (t *nfkcTrie) lookupValue(n uint32, b byte) uint16 { + switch { + case n < 92: + return uint16(nfkcValues[n<<6+uint32(b)]) + default: + n -= 92 + return uint16(nfkcSparse.lookup(n, b)) + } +} + +// nfkcValues: 94 blocks, 6016 entries, 12032 bytes +// The third block is the zero block. +var nfkcValues = [6016]uint16{ + // Block 0x0, offset 0x0 + 0x3c: 0xa000, 0x3d: 0xa000, 0x3e: 0xa000, + // Block 0x1, offset 0x40 + 0x41: 0xa000, 0x42: 0xa000, 0x43: 0xa000, 0x44: 0xa000, 0x45: 0xa000, + 0x46: 0xa000, 0x47: 0xa000, 0x48: 0xa000, 0x49: 0xa000, 0x4a: 0xa000, 0x4b: 0xa000, + 0x4c: 0xa000, 0x4d: 0xa000, 0x4e: 0xa000, 0x4f: 0xa000, 0x50: 0xa000, + 0x52: 0xa000, 0x53: 0xa000, 0x54: 0xa000, 0x55: 0xa000, 0x56: 0xa000, 0x57: 0xa000, + 0x58: 0xa000, 0x59: 0xa000, 0x5a: 0xa000, + 0x61: 0xa000, 0x62: 0xa000, 0x63: 0xa000, + 0x64: 0xa000, 0x65: 0xa000, 0x66: 0xa000, 0x67: 0xa000, 0x68: 0xa000, 0x69: 0xa000, + 0x6a: 0xa000, 0x6b: 0xa000, 0x6c: 0xa000, 0x6d: 0xa000, 0x6e: 0xa000, 0x6f: 0xa000, + 0x70: 0xa000, 0x72: 0xa000, 0x73: 0xa000, 0x74: 0xa000, 0x75: 0xa000, + 0x76: 0xa000, 0x77: 0xa000, 0x78: 0xa000, 0x79: 0xa000, 0x7a: 0xa000, + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc0: 0x2f6f, 0xc1: 0x2f74, 0xc2: 0x4688, 0xc3: 0x2f79, 0xc4: 0x4697, 0xc5: 0x469c, + 0xc6: 0xa000, 0xc7: 0x46a6, 0xc8: 0x2fe2, 0xc9: 0x2fe7, 0xca: 0x46ab, 0xcb: 0x2ffb, + 0xcc: 0x306e, 0xcd: 0x3073, 0xce: 0x3078, 0xcf: 0x46bf, 0xd1: 0x3104, + 0xd2: 0x3127, 0xd3: 0x312c, 0xd4: 0x46c9, 0xd5: 0x46ce, 0xd6: 0x46dd, + 0xd8: 0xa000, 0xd9: 0x31b3, 0xda: 0x31b8, 0xdb: 0x31bd, 0xdc: 0x470f, 0xdd: 0x3235, + 0xe0: 0x327b, 0xe1: 0x3280, 0xe2: 0x4719, 0xe3: 0x3285, + 0xe4: 0x4728, 0xe5: 0x472d, 0xe6: 0xa000, 0xe7: 0x4737, 0xe8: 0x32ee, 0xe9: 0x32f3, + 0xea: 0x473c, 0xeb: 0x3307, 0xec: 0x337f, 0xed: 0x3384, 0xee: 0x3389, 0xef: 0x4750, + 0xf1: 0x3415, 0xf2: 0x3438, 0xf3: 0x343d, 0xf4: 0x475a, 0xf5: 0x475f, + 0xf6: 0x476e, 0xf8: 0xa000, 0xf9: 0x34c9, 0xfa: 0x34ce, 0xfb: 0x34d3, + 0xfc: 0x47a0, 0xfd: 0x3550, 0xff: 0x3569, + // Block 0x4, offset 0x100 + 0x100: 0x2f7e, 0x101: 0x328a, 0x102: 0x468d, 0x103: 0x471e, 0x104: 0x2f9c, 0x105: 0x32a8, + 0x106: 0x2fb0, 0x107: 0x32bc, 0x108: 0x2fb5, 0x109: 0x32c1, 0x10a: 0x2fba, 0x10b: 0x32c6, + 0x10c: 0x2fbf, 0x10d: 0x32cb, 0x10e: 0x2fc9, 0x10f: 0x32d5, + 0x112: 0x46b0, 0x113: 0x4741, 0x114: 0x2ff1, 0x115: 0x32fd, 0x116: 0x2ff6, 0x117: 0x3302, + 0x118: 0x3014, 0x119: 0x3320, 0x11a: 0x3005, 0x11b: 0x3311, 0x11c: 0x302d, 0x11d: 0x3339, + 0x11e: 0x3037, 0x11f: 0x3343, 0x120: 0x303c, 0x121: 0x3348, 0x122: 0x3046, 0x123: 0x3352, + 0x124: 0x304b, 0x125: 0x3357, 0x128: 0x307d, 0x129: 0x338e, + 0x12a: 0x3082, 0x12b: 0x3393, 0x12c: 0x3087, 0x12d: 0x3398, 0x12e: 0x30aa, 0x12f: 0x33b6, + 0x130: 0x308c, 0x132: 0x195d, 0x133: 0x19e7, 0x134: 0x30b4, 0x135: 0x33c0, + 0x136: 0x30c8, 0x137: 0x33d9, 0x139: 0x30d2, 0x13a: 0x33e3, 0x13b: 0x30dc, + 0x13c: 0x33ed, 0x13d: 0x30d7, 0x13e: 0x33e8, 0x13f: 0x1bac, + // Block 0x5, offset 0x140 + 0x140: 0x1c34, 0x143: 0x30ff, 0x144: 0x3410, 0x145: 0x3118, + 0x146: 0x3429, 0x147: 0x310e, 0x148: 0x341f, 0x149: 0x1c5c, + 0x14c: 0x46d3, 0x14d: 0x4764, 0x14e: 0x3131, 0x14f: 0x3442, 0x150: 0x313b, 0x151: 0x344c, + 0x154: 0x3159, 0x155: 0x346a, 0x156: 0x3172, 0x157: 0x3483, + 0x158: 0x3163, 0x159: 0x3474, 0x15a: 0x46f6, 0x15b: 0x4787, 0x15c: 0x317c, 0x15d: 0x348d, + 0x15e: 0x318b, 0x15f: 0x349c, 0x160: 0x46fb, 0x161: 0x478c, 0x162: 0x31a4, 0x163: 0x34ba, + 0x164: 0x3195, 0x165: 0x34ab, 0x168: 0x4705, 0x169: 0x4796, + 0x16a: 0x470a, 0x16b: 0x479b, 0x16c: 0x31c2, 0x16d: 0x34d8, 0x16e: 0x31cc, 0x16f: 0x34e2, + 0x170: 0x31d1, 0x171: 0x34e7, 0x172: 0x31ef, 0x173: 0x3505, 0x174: 0x3212, 0x175: 0x3528, + 0x176: 0x323a, 0x177: 0x3555, 0x178: 0x324e, 0x179: 0x325d, 0x17a: 0x357d, 0x17b: 0x3267, + 0x17c: 0x3587, 0x17d: 0x326c, 0x17e: 0x358c, 0x17f: 0x00a7, + // Block 0x6, offset 0x180 + 0x184: 0x2dee, 0x185: 0x2df4, + 0x186: 0x2dfa, 0x187: 0x1972, 0x188: 0x1975, 0x189: 0x1a08, 0x18a: 0x1987, 0x18b: 0x198a, + 0x18c: 0x1a3e, 0x18d: 0x2f88, 0x18e: 0x3294, 0x18f: 0x3096, 0x190: 0x33a2, 0x191: 0x3140, + 0x192: 0x3451, 0x193: 0x31d6, 0x194: 0x34ec, 0x195: 0x39cf, 0x196: 0x3b5e, 0x197: 0x39c8, + 0x198: 0x3b57, 0x199: 0x39d6, 0x19a: 0x3b65, 0x19b: 0x39c1, 0x19c: 0x3b50, + 0x19e: 0x38b0, 0x19f: 0x3a3f, 0x1a0: 0x38a9, 0x1a1: 0x3a38, 0x1a2: 0x35b3, 0x1a3: 0x35c5, + 0x1a6: 0x3041, 0x1a7: 0x334d, 0x1a8: 0x30be, 0x1a9: 0x33cf, + 0x1aa: 0x46ec, 0x1ab: 0x477d, 0x1ac: 0x3990, 0x1ad: 0x3b1f, 0x1ae: 0x35d7, 0x1af: 0x35dd, + 0x1b0: 0x33c5, 0x1b1: 0x1942, 0x1b2: 0x1945, 0x1b3: 0x19cf, 0x1b4: 0x3028, 0x1b5: 0x3334, + 0x1b8: 0x30fa, 0x1b9: 0x340b, 0x1ba: 0x38b7, 0x1bb: 0x3a46, + 0x1bc: 0x35ad, 0x1bd: 0x35bf, 0x1be: 0x35b9, 0x1bf: 0x35cb, + // Block 0x7, offset 0x1c0 + 0x1c0: 0x2f8d, 0x1c1: 0x3299, 0x1c2: 0x2f92, 0x1c3: 0x329e, 0x1c4: 0x300a, 0x1c5: 0x3316, + 0x1c6: 0x300f, 0x1c7: 0x331b, 0x1c8: 0x309b, 0x1c9: 0x33a7, 0x1ca: 0x30a0, 0x1cb: 0x33ac, + 0x1cc: 0x3145, 0x1cd: 0x3456, 0x1ce: 0x314a, 0x1cf: 0x345b, 0x1d0: 0x3168, 0x1d1: 0x3479, + 0x1d2: 0x316d, 0x1d3: 0x347e, 0x1d4: 0x31db, 0x1d5: 0x34f1, 0x1d6: 0x31e0, 0x1d7: 0x34f6, + 0x1d8: 0x3186, 0x1d9: 0x3497, 0x1da: 0x319f, 0x1db: 0x34b5, + 0x1de: 0x305a, 0x1df: 0x3366, + 0x1e6: 0x4692, 0x1e7: 0x4723, 0x1e8: 0x46ba, 0x1e9: 0x474b, + 0x1ea: 0x395f, 0x1eb: 0x3aee, 0x1ec: 0x393c, 0x1ed: 0x3acb, 0x1ee: 0x46d8, 0x1ef: 0x4769, + 0x1f0: 0x3958, 0x1f1: 0x3ae7, 0x1f2: 0x3244, 0x1f3: 0x355f, + // Block 0x8, offset 0x200 + 0x200: 0x9932, 0x201: 0x9932, 0x202: 0x9932, 0x203: 0x9932, 0x204: 0x9932, 0x205: 0x8132, + 0x206: 0x9932, 0x207: 0x9932, 0x208: 0x9932, 0x209: 0x9932, 0x20a: 0x9932, 0x20b: 0x9932, + 0x20c: 0x9932, 0x20d: 0x8132, 0x20e: 0x8132, 0x20f: 0x9932, 0x210: 0x8132, 0x211: 0x9932, + 0x212: 0x8132, 0x213: 0x9932, 0x214: 0x9932, 0x215: 0x8133, 0x216: 0x812d, 0x217: 0x812d, + 0x218: 0x812d, 0x219: 0x812d, 0x21a: 0x8133, 0x21b: 0x992b, 0x21c: 0x812d, 0x21d: 0x812d, + 0x21e: 0x812d, 0x21f: 0x812d, 0x220: 0x812d, 0x221: 0x8129, 0x222: 0x8129, 0x223: 0x992d, + 0x224: 0x992d, 0x225: 0x992d, 0x226: 0x992d, 0x227: 0x9929, 0x228: 0x9929, 0x229: 0x812d, + 0x22a: 0x812d, 0x22b: 0x812d, 0x22c: 0x812d, 0x22d: 0x992d, 0x22e: 0x992d, 0x22f: 0x812d, + 0x230: 0x992d, 0x231: 0x992d, 0x232: 0x812d, 0x233: 0x812d, 0x234: 0x8101, 0x235: 0x8101, + 0x236: 0x8101, 0x237: 0x8101, 0x238: 0x9901, 0x239: 0x812d, 0x23a: 0x812d, 0x23b: 0x812d, + 0x23c: 0x812d, 0x23d: 0x8132, 0x23e: 0x8132, 0x23f: 0x8132, + // Block 0x9, offset 0x240 + 0x240: 0x49ae, 0x241: 0x49b3, 0x242: 0x9932, 0x243: 0x49b8, 0x244: 0x4a71, 0x245: 0x9936, + 0x246: 0x8132, 0x247: 0x812d, 0x248: 0x812d, 0x249: 0x812d, 0x24a: 0x8132, 0x24b: 0x8132, + 0x24c: 0x8132, 0x24d: 0x812d, 0x24e: 0x812d, 0x250: 0x8132, 0x251: 0x8132, + 0x252: 0x8132, 0x253: 0x812d, 0x254: 0x812d, 0x255: 0x812d, 0x256: 0x812d, 0x257: 0x8132, + 0x258: 0x8133, 0x259: 0x812d, 0x25a: 0x812d, 0x25b: 0x8132, 0x25c: 0x8134, 0x25d: 0x8135, + 0x25e: 0x8135, 0x25f: 0x8134, 0x260: 0x8135, 0x261: 0x8135, 0x262: 0x8134, 0x263: 0x8132, + 0x264: 0x8132, 0x265: 0x8132, 0x266: 0x8132, 0x267: 0x8132, 0x268: 0x8132, 0x269: 0x8132, + 0x26a: 0x8132, 0x26b: 0x8132, 0x26c: 0x8132, 0x26d: 0x8132, 0x26e: 0x8132, 0x26f: 0x8132, + 0x274: 0x0170, + 0x27a: 0x42a5, + 0x27e: 0x0037, + // Block 0xa, offset 0x280 + 0x284: 0x425a, 0x285: 0x447b, + 0x286: 0x35e9, 0x287: 0x00ce, 0x288: 0x3607, 0x289: 0x3613, 0x28a: 0x3625, + 0x28c: 0x3643, 0x28e: 0x3655, 0x28f: 0x3673, 0x290: 0x3e08, 0x291: 0xa000, + 0x295: 0xa000, 0x297: 0xa000, + 0x299: 0xa000, + 0x29f: 0xa000, 0x2a1: 0xa000, + 0x2a5: 0xa000, 0x2a9: 0xa000, + 0x2aa: 0x3637, 0x2ab: 0x3667, 0x2ac: 0x47fe, 0x2ad: 0x3697, 0x2ae: 0x4828, 0x2af: 0x36a9, + 0x2b0: 0x3e70, 0x2b1: 0xa000, 0x2b5: 0xa000, + 0x2b7: 0xa000, 0x2b9: 0xa000, + 0x2bf: 0xa000, + // Block 0xb, offset 0x2c0 + 0x2c1: 0xa000, 0x2c5: 0xa000, + 0x2c9: 0xa000, 0x2ca: 0x4840, 0x2cb: 0x485e, + 0x2cc: 0x36c7, 0x2cd: 0x36df, 0x2ce: 0x4876, 0x2d0: 0x01be, 0x2d1: 0x01d0, + 0x2d2: 0x01ac, 0x2d3: 0x430c, 0x2d4: 0x4312, 0x2d5: 0x01fa, 0x2d6: 0x01e8, + 0x2f0: 0x01d6, 0x2f1: 0x01eb, 0x2f2: 0x01ee, 0x2f4: 0x0188, 0x2f5: 0x01c7, + 0x2f9: 0x01a6, + // Block 0xc, offset 0x300 + 0x300: 0x3721, 0x301: 0x372d, 0x303: 0x371b, + 0x306: 0xa000, 0x307: 0x3709, + 0x30c: 0x375d, 0x30d: 0x3745, 0x30e: 0x376f, 0x310: 0xa000, + 0x313: 0xa000, 0x315: 0xa000, 0x316: 0xa000, 0x317: 0xa000, + 0x318: 0xa000, 0x319: 0x3751, 0x31a: 0xa000, + 0x31e: 0xa000, 0x323: 0xa000, + 0x327: 0xa000, + 0x32b: 0xa000, 0x32d: 0xa000, + 0x330: 0xa000, 0x333: 0xa000, 0x335: 0xa000, + 0x336: 0xa000, 0x337: 0xa000, 0x338: 0xa000, 0x339: 0x37d5, 0x33a: 0xa000, + 0x33e: 0xa000, + // Block 0xd, offset 0x340 + 0x341: 0x3733, 0x342: 0x37b7, + 0x350: 0x370f, 0x351: 0x3793, + 0x352: 0x3715, 0x353: 0x3799, 0x356: 0x3727, 0x357: 0x37ab, + 0x358: 0xa000, 0x359: 0xa000, 0x35a: 0x3829, 0x35b: 0x382f, 0x35c: 0x3739, 0x35d: 0x37bd, + 0x35e: 0x373f, 0x35f: 0x37c3, 0x362: 0x374b, 0x363: 0x37cf, + 0x364: 0x3757, 0x365: 0x37db, 0x366: 0x3763, 0x367: 0x37e7, 0x368: 0xa000, 0x369: 0xa000, + 0x36a: 0x3835, 0x36b: 0x383b, 0x36c: 0x378d, 0x36d: 0x3811, 0x36e: 0x3769, 0x36f: 0x37ed, + 0x370: 0x3775, 0x371: 0x37f9, 0x372: 0x377b, 0x373: 0x37ff, 0x374: 0x3781, 0x375: 0x3805, + 0x378: 0x3787, 0x379: 0x380b, + // Block 0xe, offset 0x380 + 0x387: 0x1d61, + 0x391: 0x812d, + 0x392: 0x8132, 0x393: 0x8132, 0x394: 0x8132, 0x395: 0x8132, 0x396: 0x812d, 0x397: 0x8132, + 0x398: 0x8132, 0x399: 0x8132, 0x39a: 0x812e, 0x39b: 0x812d, 0x39c: 0x8132, 0x39d: 0x8132, + 0x39e: 0x8132, 0x39f: 0x8132, 0x3a0: 0x8132, 0x3a1: 0x8132, 0x3a2: 0x812d, 0x3a3: 0x812d, + 0x3a4: 0x812d, 0x3a5: 0x812d, 0x3a6: 0x812d, 0x3a7: 0x812d, 0x3a8: 0x8132, 0x3a9: 0x8132, + 0x3aa: 0x812d, 0x3ab: 0x8132, 0x3ac: 0x8132, 0x3ad: 0x812e, 0x3ae: 0x8131, 0x3af: 0x8132, + 0x3b0: 0x8105, 0x3b1: 0x8106, 0x3b2: 0x8107, 0x3b3: 0x8108, 0x3b4: 0x8109, 0x3b5: 0x810a, + 0x3b6: 0x810b, 0x3b7: 0x810c, 0x3b8: 0x810d, 0x3b9: 0x810e, 0x3ba: 0x810e, 0x3bb: 0x810f, + 0x3bc: 0x8110, 0x3bd: 0x8111, 0x3bf: 0x8112, + // Block 0xf, offset 0x3c0 + 0x3c8: 0xa000, 0x3ca: 0xa000, 0x3cb: 0x8116, + 0x3cc: 0x8117, 0x3cd: 0x8118, 0x3ce: 0x8119, 0x3cf: 0x811a, 0x3d0: 0x811b, 0x3d1: 0x811c, + 0x3d2: 0x811d, 0x3d3: 0x9932, 0x3d4: 0x9932, 0x3d5: 0x992d, 0x3d6: 0x812d, 0x3d7: 0x8132, + 0x3d8: 0x8132, 0x3d9: 0x8132, 0x3da: 0x8132, 0x3db: 0x8132, 0x3dc: 0x812d, 0x3dd: 0x8132, + 0x3de: 0x8132, 0x3df: 0x812d, + 0x3f0: 0x811e, 0x3f5: 0x1d84, + 0x3f6: 0x2013, 0x3f7: 0x204f, 0x3f8: 0x204a, + // Block 0x10, offset 0x400 + 0x413: 0x812d, 0x414: 0x8132, 0x415: 0x8132, 0x416: 0x8132, 0x417: 0x8132, + 0x418: 0x8132, 0x419: 0x8132, 0x41a: 0x8132, 0x41b: 0x8132, 0x41c: 0x8132, 0x41d: 0x8132, + 0x41e: 0x8132, 0x41f: 0x8132, 0x420: 0x8132, 0x421: 0x8132, 0x423: 0x812d, + 0x424: 0x8132, 0x425: 0x8132, 0x426: 0x812d, 0x427: 0x8132, 0x428: 0x8132, 0x429: 0x812d, + 0x42a: 0x8132, 0x42b: 0x8132, 0x42c: 0x8132, 0x42d: 0x812d, 0x42e: 0x812d, 0x42f: 0x812d, + 0x430: 0x8116, 0x431: 0x8117, 0x432: 0x8118, 0x433: 0x8132, 0x434: 0x8132, 0x435: 0x8132, + 0x436: 0x812d, 0x437: 0x8132, 0x438: 0x8132, 0x439: 0x812d, 0x43a: 0x812d, 0x43b: 0x8132, + 0x43c: 0x8132, 0x43d: 0x8132, 0x43e: 0x8132, 0x43f: 0x8132, + // Block 0x11, offset 0x440 + 0x445: 0xa000, + 0x446: 0x2d26, 0x447: 0xa000, 0x448: 0x2d2e, 0x449: 0xa000, 0x44a: 0x2d36, 0x44b: 0xa000, + 0x44c: 0x2d3e, 0x44d: 0xa000, 0x44e: 0x2d46, 0x451: 0xa000, + 0x452: 0x2d4e, + 0x474: 0x8102, 0x475: 0x9900, + 0x47a: 0xa000, 0x47b: 0x2d56, + 0x47c: 0xa000, 0x47d: 0x2d5e, 0x47e: 0xa000, 0x47f: 0xa000, + // Block 0x12, offset 0x480 + 0x480: 0x0069, 0x481: 0x006b, 0x482: 0x006f, 0x483: 0x0083, 0x484: 0x00f5, 0x485: 0x00f8, + 0x486: 0x0413, 0x487: 0x0085, 0x488: 0x0089, 0x489: 0x008b, 0x48a: 0x0104, 0x48b: 0x0107, + 0x48c: 0x010a, 0x48d: 0x008f, 0x48f: 0x0097, 0x490: 0x009b, 0x491: 0x00e0, + 0x492: 0x009f, 0x493: 0x00fe, 0x494: 0x0417, 0x495: 0x041b, 0x496: 0x00a1, 0x497: 0x00a9, + 0x498: 0x00ab, 0x499: 0x0423, 0x49a: 0x012b, 0x49b: 0x00ad, 0x49c: 0x0427, 0x49d: 0x01be, + 0x49e: 0x01c1, 0x49f: 0x01c4, 0x4a0: 0x01fa, 0x4a1: 0x01fd, 0x4a2: 0x0093, 0x4a3: 0x00a5, + 0x4a4: 0x00ab, 0x4a5: 0x00ad, 0x4a6: 0x01be, 0x4a7: 0x01c1, 0x4a8: 0x01eb, 0x4a9: 0x01fa, + 0x4aa: 0x01fd, + 0x4b8: 0x020c, + // Block 0x13, offset 0x4c0 + 0x4db: 0x00fb, 0x4dc: 0x0087, 0x4dd: 0x0101, + 0x4de: 0x00d4, 0x4df: 0x010a, 0x4e0: 0x008d, 0x4e1: 0x010d, 0x4e2: 0x0110, 0x4e3: 0x0116, + 0x4e4: 0x011c, 0x4e5: 0x011f, 0x4e6: 0x0122, 0x4e7: 0x042b, 0x4e8: 0x016a, 0x4e9: 0x0128, + 0x4ea: 0x042f, 0x4eb: 0x016d, 0x4ec: 0x0131, 0x4ed: 0x012e, 0x4ee: 0x0134, 0x4ef: 0x0137, + 0x4f0: 0x013a, 0x4f1: 0x013d, 0x4f2: 0x0140, 0x4f3: 0x014c, 0x4f4: 0x014f, 0x4f5: 0x00ec, + 0x4f6: 0x0152, 0x4f7: 0x0155, 0x4f8: 0x041f, 0x4f9: 0x0158, 0x4fa: 0x015b, 0x4fb: 0x00b5, + 0x4fc: 0x015e, 0x4fd: 0x0161, 0x4fe: 0x0164, 0x4ff: 0x01d0, + // Block 0x14, offset 0x500 + 0x500: 0x8132, 0x501: 0x8132, 0x502: 0x812d, 0x503: 0x8132, 0x504: 0x8132, 0x505: 0x8132, + 0x506: 0x8132, 0x507: 0x8132, 0x508: 0x8132, 0x509: 0x8132, 0x50a: 0x812d, 0x50b: 0x8132, + 0x50c: 0x8132, 0x50d: 0x8135, 0x50e: 0x812a, 0x50f: 0x812d, 0x510: 0x8129, 0x511: 0x8132, + 0x512: 0x8132, 0x513: 0x8132, 0x514: 0x8132, 0x515: 0x8132, 0x516: 0x8132, 0x517: 0x8132, + 0x518: 0x8132, 0x519: 0x8132, 0x51a: 0x8132, 0x51b: 0x8132, 0x51c: 0x8132, 0x51d: 0x8132, + 0x51e: 0x8132, 0x51f: 0x8132, 0x520: 0x8132, 0x521: 0x8132, 0x522: 0x8132, 0x523: 0x8132, + 0x524: 0x8132, 0x525: 0x8132, 0x526: 0x8132, 0x527: 0x8132, 0x528: 0x8132, 0x529: 0x8132, + 0x52a: 0x8132, 0x52b: 0x8132, 0x52c: 0x8132, 0x52d: 0x8132, 0x52e: 0x8132, 0x52f: 0x8132, + 0x530: 0x8132, 0x531: 0x8132, 0x532: 0x8132, 0x533: 0x8132, 0x534: 0x8132, 0x535: 0x8132, + 0x536: 0x8133, 0x537: 0x8131, 0x538: 0x8131, 0x539: 0x812d, 0x53b: 0x8132, + 0x53c: 0x8134, 0x53d: 0x812d, 0x53e: 0x8132, 0x53f: 0x812d, + // Block 0x15, offset 0x540 + 0x540: 0x2f97, 0x541: 0x32a3, 0x542: 0x2fa1, 0x543: 0x32ad, 0x544: 0x2fa6, 0x545: 0x32b2, + 0x546: 0x2fab, 0x547: 0x32b7, 0x548: 0x38cc, 0x549: 0x3a5b, 0x54a: 0x2fc4, 0x54b: 0x32d0, + 0x54c: 0x2fce, 0x54d: 0x32da, 0x54e: 0x2fdd, 0x54f: 0x32e9, 0x550: 0x2fd3, 0x551: 0x32df, + 0x552: 0x2fd8, 0x553: 0x32e4, 0x554: 0x38ef, 0x555: 0x3a7e, 0x556: 0x38f6, 0x557: 0x3a85, + 0x558: 0x3019, 0x559: 0x3325, 0x55a: 0x301e, 0x55b: 0x332a, 0x55c: 0x3904, 0x55d: 0x3a93, + 0x55e: 0x3023, 0x55f: 0x332f, 0x560: 0x3032, 0x561: 0x333e, 0x562: 0x3050, 0x563: 0x335c, + 0x564: 0x305f, 0x565: 0x336b, 0x566: 0x3055, 0x567: 0x3361, 0x568: 0x3064, 0x569: 0x3370, + 0x56a: 0x3069, 0x56b: 0x3375, 0x56c: 0x30af, 0x56d: 0x33bb, 0x56e: 0x390b, 0x56f: 0x3a9a, + 0x570: 0x30b9, 0x571: 0x33ca, 0x572: 0x30c3, 0x573: 0x33d4, 0x574: 0x30cd, 0x575: 0x33de, + 0x576: 0x46c4, 0x577: 0x4755, 0x578: 0x3912, 0x579: 0x3aa1, 0x57a: 0x30e6, 0x57b: 0x33f7, + 0x57c: 0x30e1, 0x57d: 0x33f2, 0x57e: 0x30eb, 0x57f: 0x33fc, + // Block 0x16, offset 0x580 + 0x580: 0x30f0, 0x581: 0x3401, 0x582: 0x30f5, 0x583: 0x3406, 0x584: 0x3109, 0x585: 0x341a, + 0x586: 0x3113, 0x587: 0x3424, 0x588: 0x3122, 0x589: 0x3433, 0x58a: 0x311d, 0x58b: 0x342e, + 0x58c: 0x3935, 0x58d: 0x3ac4, 0x58e: 0x3943, 0x58f: 0x3ad2, 0x590: 0x394a, 0x591: 0x3ad9, + 0x592: 0x3951, 0x593: 0x3ae0, 0x594: 0x314f, 0x595: 0x3460, 0x596: 0x3154, 0x597: 0x3465, + 0x598: 0x315e, 0x599: 0x346f, 0x59a: 0x46f1, 0x59b: 0x4782, 0x59c: 0x3997, 0x59d: 0x3b26, + 0x59e: 0x3177, 0x59f: 0x3488, 0x5a0: 0x3181, 0x5a1: 0x3492, 0x5a2: 0x4700, 0x5a3: 0x4791, + 0x5a4: 0x399e, 0x5a5: 0x3b2d, 0x5a6: 0x39a5, 0x5a7: 0x3b34, 0x5a8: 0x39ac, 0x5a9: 0x3b3b, + 0x5aa: 0x3190, 0x5ab: 0x34a1, 0x5ac: 0x319a, 0x5ad: 0x34b0, 0x5ae: 0x31ae, 0x5af: 0x34c4, + 0x5b0: 0x31a9, 0x5b1: 0x34bf, 0x5b2: 0x31ea, 0x5b3: 0x3500, 0x5b4: 0x31f9, 0x5b5: 0x350f, + 0x5b6: 0x31f4, 0x5b7: 0x350a, 0x5b8: 0x39b3, 0x5b9: 0x3b42, 0x5ba: 0x39ba, 0x5bb: 0x3b49, + 0x5bc: 0x31fe, 0x5bd: 0x3514, 0x5be: 0x3203, 0x5bf: 0x3519, + // Block 0x17, offset 0x5c0 + 0x5c0: 0x3208, 0x5c1: 0x351e, 0x5c2: 0x320d, 0x5c3: 0x3523, 0x5c4: 0x321c, 0x5c5: 0x3532, + 0x5c6: 0x3217, 0x5c7: 0x352d, 0x5c8: 0x3221, 0x5c9: 0x353c, 0x5ca: 0x3226, 0x5cb: 0x3541, + 0x5cc: 0x322b, 0x5cd: 0x3546, 0x5ce: 0x3249, 0x5cf: 0x3564, 0x5d0: 0x3262, 0x5d1: 0x3582, + 0x5d2: 0x3271, 0x5d3: 0x3591, 0x5d4: 0x3276, 0x5d5: 0x3596, 0x5d6: 0x337a, 0x5d7: 0x34a6, + 0x5d8: 0x3537, 0x5d9: 0x3573, 0x5da: 0x1be0, 0x5db: 0x42d7, + 0x5e0: 0x46a1, 0x5e1: 0x4732, 0x5e2: 0x2f83, 0x5e3: 0x328f, + 0x5e4: 0x3878, 0x5e5: 0x3a07, 0x5e6: 0x3871, 0x5e7: 0x3a00, 0x5e8: 0x3886, 0x5e9: 0x3a15, + 0x5ea: 0x387f, 0x5eb: 0x3a0e, 0x5ec: 0x38be, 0x5ed: 0x3a4d, 0x5ee: 0x3894, 0x5ef: 0x3a23, + 0x5f0: 0x388d, 0x5f1: 0x3a1c, 0x5f2: 0x38a2, 0x5f3: 0x3a31, 0x5f4: 0x389b, 0x5f5: 0x3a2a, + 0x5f6: 0x38c5, 0x5f7: 0x3a54, 0x5f8: 0x46b5, 0x5f9: 0x4746, 0x5fa: 0x3000, 0x5fb: 0x330c, + 0x5fc: 0x2fec, 0x5fd: 0x32f8, 0x5fe: 0x38da, 0x5ff: 0x3a69, + // Block 0x18, offset 0x600 + 0x600: 0x38d3, 0x601: 0x3a62, 0x602: 0x38e8, 0x603: 0x3a77, 0x604: 0x38e1, 0x605: 0x3a70, + 0x606: 0x38fd, 0x607: 0x3a8c, 0x608: 0x3091, 0x609: 0x339d, 0x60a: 0x30a5, 0x60b: 0x33b1, + 0x60c: 0x46e7, 0x60d: 0x4778, 0x60e: 0x3136, 0x60f: 0x3447, 0x610: 0x3920, 0x611: 0x3aaf, + 0x612: 0x3919, 0x613: 0x3aa8, 0x614: 0x392e, 0x615: 0x3abd, 0x616: 0x3927, 0x617: 0x3ab6, + 0x618: 0x3989, 0x619: 0x3b18, 0x61a: 0x396d, 0x61b: 0x3afc, 0x61c: 0x3966, 0x61d: 0x3af5, + 0x61e: 0x397b, 0x61f: 0x3b0a, 0x620: 0x3974, 0x621: 0x3b03, 0x622: 0x3982, 0x623: 0x3b11, + 0x624: 0x31e5, 0x625: 0x34fb, 0x626: 0x31c7, 0x627: 0x34dd, 0x628: 0x39e4, 0x629: 0x3b73, + 0x62a: 0x39dd, 0x62b: 0x3b6c, 0x62c: 0x39f2, 0x62d: 0x3b81, 0x62e: 0x39eb, 0x62f: 0x3b7a, + 0x630: 0x39f9, 0x631: 0x3b88, 0x632: 0x3230, 0x633: 0x354b, 0x634: 0x3258, 0x635: 0x3578, + 0x636: 0x3253, 0x637: 0x356e, 0x638: 0x323f, 0x639: 0x355a, + // Block 0x19, offset 0x640 + 0x640: 0x4804, 0x641: 0x480a, 0x642: 0x491e, 0x643: 0x4936, 0x644: 0x4926, 0x645: 0x493e, + 0x646: 0x492e, 0x647: 0x4946, 0x648: 0x47aa, 0x649: 0x47b0, 0x64a: 0x488e, 0x64b: 0x48a6, + 0x64c: 0x4896, 0x64d: 0x48ae, 0x64e: 0x489e, 0x64f: 0x48b6, 0x650: 0x4816, 0x651: 0x481c, + 0x652: 0x3db8, 0x653: 0x3dc8, 0x654: 0x3dc0, 0x655: 0x3dd0, + 0x658: 0x47b6, 0x659: 0x47bc, 0x65a: 0x3ce8, 0x65b: 0x3cf8, 0x65c: 0x3cf0, 0x65d: 0x3d00, + 0x660: 0x482e, 0x661: 0x4834, 0x662: 0x494e, 0x663: 0x4966, + 0x664: 0x4956, 0x665: 0x496e, 0x666: 0x495e, 0x667: 0x4976, 0x668: 0x47c2, 0x669: 0x47c8, + 0x66a: 0x48be, 0x66b: 0x48d6, 0x66c: 0x48c6, 0x66d: 0x48de, 0x66e: 0x48ce, 0x66f: 0x48e6, + 0x670: 0x4846, 0x671: 0x484c, 0x672: 0x3e18, 0x673: 0x3e30, 0x674: 0x3e20, 0x675: 0x3e38, + 0x676: 0x3e28, 0x677: 0x3e40, 0x678: 0x47ce, 0x679: 0x47d4, 0x67a: 0x3d18, 0x67b: 0x3d30, + 0x67c: 0x3d20, 0x67d: 0x3d38, 0x67e: 0x3d28, 0x67f: 0x3d40, + // Block 0x1a, offset 0x680 + 0x680: 0x4852, 0x681: 0x4858, 0x682: 0x3e48, 0x683: 0x3e58, 0x684: 0x3e50, 0x685: 0x3e60, + 0x688: 0x47da, 0x689: 0x47e0, 0x68a: 0x3d48, 0x68b: 0x3d58, + 0x68c: 0x3d50, 0x68d: 0x3d60, 0x690: 0x4864, 0x691: 0x486a, + 0x692: 0x3e80, 0x693: 0x3e98, 0x694: 0x3e88, 0x695: 0x3ea0, 0x696: 0x3e90, 0x697: 0x3ea8, + 0x699: 0x47e6, 0x69b: 0x3d68, 0x69d: 0x3d70, + 0x69f: 0x3d78, 0x6a0: 0x487c, 0x6a1: 0x4882, 0x6a2: 0x497e, 0x6a3: 0x4996, + 0x6a4: 0x4986, 0x6a5: 0x499e, 0x6a6: 0x498e, 0x6a7: 0x49a6, 0x6a8: 0x47ec, 0x6a9: 0x47f2, + 0x6aa: 0x48ee, 0x6ab: 0x4906, 0x6ac: 0x48f6, 0x6ad: 0x490e, 0x6ae: 0x48fe, 0x6af: 0x4916, + 0x6b0: 0x47f8, 0x6b1: 0x431e, 0x6b2: 0x3691, 0x6b3: 0x4324, 0x6b4: 0x4822, 0x6b5: 0x432a, + 0x6b6: 0x36a3, 0x6b7: 0x4330, 0x6b8: 0x36c1, 0x6b9: 0x4336, 0x6ba: 0x36d9, 0x6bb: 0x433c, + 0x6bc: 0x4870, 0x6bd: 0x4342, + // Block 0x1b, offset 0x6c0 + 0x6c0: 0x3da0, 0x6c1: 0x3da8, 0x6c2: 0x4184, 0x6c3: 0x41a2, 0x6c4: 0x418e, 0x6c5: 0x41ac, + 0x6c6: 0x4198, 0x6c7: 0x41b6, 0x6c8: 0x3cd8, 0x6c9: 0x3ce0, 0x6ca: 0x40d0, 0x6cb: 0x40ee, + 0x6cc: 0x40da, 0x6cd: 0x40f8, 0x6ce: 0x40e4, 0x6cf: 0x4102, 0x6d0: 0x3de8, 0x6d1: 0x3df0, + 0x6d2: 0x41c0, 0x6d3: 0x41de, 0x6d4: 0x41ca, 0x6d5: 0x41e8, 0x6d6: 0x41d4, 0x6d7: 0x41f2, + 0x6d8: 0x3d08, 0x6d9: 0x3d10, 0x6da: 0x410c, 0x6db: 0x412a, 0x6dc: 0x4116, 0x6dd: 0x4134, + 0x6de: 0x4120, 0x6df: 0x413e, 0x6e0: 0x3ec0, 0x6e1: 0x3ec8, 0x6e2: 0x41fc, 0x6e3: 0x421a, + 0x6e4: 0x4206, 0x6e5: 0x4224, 0x6e6: 0x4210, 0x6e7: 0x422e, 0x6e8: 0x3d80, 0x6e9: 0x3d88, + 0x6ea: 0x4148, 0x6eb: 0x4166, 0x6ec: 0x4152, 0x6ed: 0x4170, 0x6ee: 0x415c, 0x6ef: 0x417a, + 0x6f0: 0x3685, 0x6f1: 0x367f, 0x6f2: 0x3d90, 0x6f3: 0x368b, 0x6f4: 0x3d98, + 0x6f6: 0x4810, 0x6f7: 0x3db0, 0x6f8: 0x35f5, 0x6f9: 0x35ef, 0x6fa: 0x35e3, 0x6fb: 0x42ee, + 0x6fc: 0x35fb, 0x6fd: 0x4287, 0x6fe: 0x01d3, 0x6ff: 0x4287, + // Block 0x1c, offset 0x700 + 0x700: 0x42a0, 0x701: 0x4482, 0x702: 0x3dd8, 0x703: 0x369d, 0x704: 0x3de0, + 0x706: 0x483a, 0x707: 0x3df8, 0x708: 0x3601, 0x709: 0x42f4, 0x70a: 0x360d, 0x70b: 0x42fa, + 0x70c: 0x3619, 0x70d: 0x4489, 0x70e: 0x4490, 0x70f: 0x4497, 0x710: 0x36b5, 0x711: 0x36af, + 0x712: 0x3e00, 0x713: 0x44e4, 0x716: 0x36bb, 0x717: 0x3e10, + 0x718: 0x3631, 0x719: 0x362b, 0x71a: 0x361f, 0x71b: 0x4300, 0x71d: 0x449e, + 0x71e: 0x44a5, 0x71f: 0x44ac, 0x720: 0x36eb, 0x721: 0x36e5, 0x722: 0x3e68, 0x723: 0x44ec, + 0x724: 0x36cd, 0x725: 0x36d3, 0x726: 0x36f1, 0x727: 0x3e78, 0x728: 0x3661, 0x729: 0x365b, + 0x72a: 0x364f, 0x72b: 0x430c, 0x72c: 0x3649, 0x72d: 0x4474, 0x72e: 0x447b, 0x72f: 0x0081, + 0x732: 0x3eb0, 0x733: 0x36f7, 0x734: 0x3eb8, + 0x736: 0x4888, 0x737: 0x3ed0, 0x738: 0x363d, 0x739: 0x4306, 0x73a: 0x366d, 0x73b: 0x4318, + 0x73c: 0x3679, 0x73d: 0x425a, 0x73e: 0x428c, + // Block 0x1d, offset 0x740 + 0x740: 0x1bd8, 0x741: 0x1bdc, 0x742: 0x0047, 0x743: 0x1c54, 0x745: 0x1be8, + 0x746: 0x1bec, 0x747: 0x00e9, 0x749: 0x1c58, 0x74a: 0x008f, 0x74b: 0x0051, + 0x74c: 0x0051, 0x74d: 0x0051, 0x74e: 0x0091, 0x74f: 0x00da, 0x750: 0x0053, 0x751: 0x0053, + 0x752: 0x0059, 0x753: 0x0099, 0x755: 0x005d, 0x756: 0x198d, + 0x759: 0x0061, 0x75a: 0x0063, 0x75b: 0x0065, 0x75c: 0x0065, 0x75d: 0x0065, + 0x760: 0x199f, 0x761: 0x1bc8, 0x762: 0x19a8, + 0x764: 0x0075, 0x766: 0x01b8, 0x768: 0x0075, + 0x76a: 0x0057, 0x76b: 0x42d2, 0x76c: 0x0045, 0x76d: 0x0047, 0x76f: 0x008b, + 0x770: 0x004b, 0x771: 0x004d, 0x773: 0x005b, 0x774: 0x009f, 0x775: 0x0215, + 0x776: 0x0218, 0x777: 0x021b, 0x778: 0x021e, 0x779: 0x0093, 0x77b: 0x1b98, + 0x77c: 0x01e8, 0x77d: 0x01c1, 0x77e: 0x0179, 0x77f: 0x01a0, + // Block 0x1e, offset 0x780 + 0x780: 0x0463, 0x785: 0x0049, + 0x786: 0x0089, 0x787: 0x008b, 0x788: 0x0093, 0x789: 0x0095, + 0x790: 0x222e, 0x791: 0x223a, + 0x792: 0x22ee, 0x793: 0x2216, 0x794: 0x229a, 0x795: 0x2222, 0x796: 0x22a0, 0x797: 0x22b8, + 0x798: 0x22c4, 0x799: 0x2228, 0x79a: 0x22ca, 0x79b: 0x2234, 0x79c: 0x22be, 0x79d: 0x22d0, + 0x79e: 0x22d6, 0x79f: 0x1cbc, 0x7a0: 0x0053, 0x7a1: 0x195a, 0x7a2: 0x1ba4, 0x7a3: 0x1963, + 0x7a4: 0x006d, 0x7a5: 0x19ab, 0x7a6: 0x1bd0, 0x7a7: 0x1d48, 0x7a8: 0x1966, 0x7a9: 0x0071, + 0x7aa: 0x19b7, 0x7ab: 0x1bd4, 0x7ac: 0x0059, 0x7ad: 0x0047, 0x7ae: 0x0049, 0x7af: 0x005b, + 0x7b0: 0x0093, 0x7b1: 0x19e4, 0x7b2: 0x1c18, 0x7b3: 0x19ed, 0x7b4: 0x00ad, 0x7b5: 0x1a62, + 0x7b6: 0x1c4c, 0x7b7: 0x1d5c, 0x7b8: 0x19f0, 0x7b9: 0x00b1, 0x7ba: 0x1a65, 0x7bb: 0x1c50, + 0x7bc: 0x0099, 0x7bd: 0x0087, 0x7be: 0x0089, 0x7bf: 0x009b, + // Block 0x1f, offset 0x7c0 + 0x7c1: 0x3c06, 0x7c3: 0xa000, 0x7c4: 0x3c0d, 0x7c5: 0xa000, + 0x7c7: 0x3c14, 0x7c8: 0xa000, 0x7c9: 0x3c1b, + 0x7cd: 0xa000, + 0x7e0: 0x2f65, 0x7e1: 0xa000, 0x7e2: 0x3c29, + 0x7e4: 0xa000, 0x7e5: 0xa000, + 0x7ed: 0x3c22, 0x7ee: 0x2f60, 0x7ef: 0x2f6a, + 0x7f0: 0x3c30, 0x7f1: 0x3c37, 0x7f2: 0xa000, 0x7f3: 0xa000, 0x7f4: 0x3c3e, 0x7f5: 0x3c45, + 0x7f6: 0xa000, 0x7f7: 0xa000, 0x7f8: 0x3c4c, 0x7f9: 0x3c53, 0x7fa: 0xa000, 0x7fb: 0xa000, + 0x7fc: 0xa000, 0x7fd: 0xa000, + // Block 0x20, offset 0x800 + 0x800: 0x3c5a, 0x801: 0x3c61, 0x802: 0xa000, 0x803: 0xa000, 0x804: 0x3c76, 0x805: 0x3c7d, + 0x806: 0xa000, 0x807: 0xa000, 0x808: 0x3c84, 0x809: 0x3c8b, + 0x811: 0xa000, + 0x812: 0xa000, + 0x822: 0xa000, + 0x828: 0xa000, 0x829: 0xa000, + 0x82b: 0xa000, 0x82c: 0x3ca0, 0x82d: 0x3ca7, 0x82e: 0x3cae, 0x82f: 0x3cb5, + 0x832: 0xa000, 0x833: 0xa000, 0x834: 0xa000, 0x835: 0xa000, + // Block 0x21, offset 0x840 + 0x860: 0x0023, 0x861: 0x0025, 0x862: 0x0027, 0x863: 0x0029, + 0x864: 0x002b, 0x865: 0x002d, 0x866: 0x002f, 0x867: 0x0031, 0x868: 0x0033, 0x869: 0x1882, + 0x86a: 0x1885, 0x86b: 0x1888, 0x86c: 0x188b, 0x86d: 0x188e, 0x86e: 0x1891, 0x86f: 0x1894, + 0x870: 0x1897, 0x871: 0x189a, 0x872: 0x189d, 0x873: 0x18a6, 0x874: 0x1a68, 0x875: 0x1a6c, + 0x876: 0x1a70, 0x877: 0x1a74, 0x878: 0x1a78, 0x879: 0x1a7c, 0x87a: 0x1a80, 0x87b: 0x1a84, + 0x87c: 0x1a88, 0x87d: 0x1c80, 0x87e: 0x1c85, 0x87f: 0x1c8a, + // Block 0x22, offset 0x880 + 0x880: 0x1c8f, 0x881: 0x1c94, 0x882: 0x1c99, 0x883: 0x1c9e, 0x884: 0x1ca3, 0x885: 0x1ca8, + 0x886: 0x1cad, 0x887: 0x1cb2, 0x888: 0x187f, 0x889: 0x18a3, 0x88a: 0x18c7, 0x88b: 0x18eb, + 0x88c: 0x190f, 0x88d: 0x1918, 0x88e: 0x191e, 0x88f: 0x1924, 0x890: 0x192a, 0x891: 0x1b60, + 0x892: 0x1b64, 0x893: 0x1b68, 0x894: 0x1b6c, 0x895: 0x1b70, 0x896: 0x1b74, 0x897: 0x1b78, + 0x898: 0x1b7c, 0x899: 0x1b80, 0x89a: 0x1b84, 0x89b: 0x1b88, 0x89c: 0x1af4, 0x89d: 0x1af8, + 0x89e: 0x1afc, 0x89f: 0x1b00, 0x8a0: 0x1b04, 0x8a1: 0x1b08, 0x8a2: 0x1b0c, 0x8a3: 0x1b10, + 0x8a4: 0x1b14, 0x8a5: 0x1b18, 0x8a6: 0x1b1c, 0x8a7: 0x1b20, 0x8a8: 0x1b24, 0x8a9: 0x1b28, + 0x8aa: 0x1b2c, 0x8ab: 0x1b30, 0x8ac: 0x1b34, 0x8ad: 0x1b38, 0x8ae: 0x1b3c, 0x8af: 0x1b40, + 0x8b0: 0x1b44, 0x8b1: 0x1b48, 0x8b2: 0x1b4c, 0x8b3: 0x1b50, 0x8b4: 0x1b54, 0x8b5: 0x1b58, + 0x8b6: 0x0043, 0x8b7: 0x0045, 0x8b8: 0x0047, 0x8b9: 0x0049, 0x8ba: 0x004b, 0x8bb: 0x004d, + 0x8bc: 0x004f, 0x8bd: 0x0051, 0x8be: 0x0053, 0x8bf: 0x0055, + // Block 0x23, offset 0x8c0 + 0x8c0: 0x06bf, 0x8c1: 0x06e3, 0x8c2: 0x06ef, 0x8c3: 0x06ff, 0x8c4: 0x0707, 0x8c5: 0x0713, + 0x8c6: 0x071b, 0x8c7: 0x0723, 0x8c8: 0x072f, 0x8c9: 0x0783, 0x8ca: 0x079b, 0x8cb: 0x07ab, + 0x8cc: 0x07bb, 0x8cd: 0x07cb, 0x8ce: 0x07db, 0x8cf: 0x07fb, 0x8d0: 0x07ff, 0x8d1: 0x0803, + 0x8d2: 0x0837, 0x8d3: 0x085f, 0x8d4: 0x086f, 0x8d5: 0x0877, 0x8d6: 0x087b, 0x8d7: 0x0887, + 0x8d8: 0x08a3, 0x8d9: 0x08a7, 0x8da: 0x08bf, 0x8db: 0x08c3, 0x8dc: 0x08cb, 0x8dd: 0x08db, + 0x8de: 0x0977, 0x8df: 0x098b, 0x8e0: 0x09cb, 0x8e1: 0x09df, 0x8e2: 0x09e7, 0x8e3: 0x09eb, + 0x8e4: 0x09fb, 0x8e5: 0x0a17, 0x8e6: 0x0a43, 0x8e7: 0x0a4f, 0x8e8: 0x0a6f, 0x8e9: 0x0a7b, + 0x8ea: 0x0a7f, 0x8eb: 0x0a83, 0x8ec: 0x0a9b, 0x8ed: 0x0a9f, 0x8ee: 0x0acb, 0x8ef: 0x0ad7, + 0x8f0: 0x0adf, 0x8f1: 0x0ae7, 0x8f2: 0x0af7, 0x8f3: 0x0aff, 0x8f4: 0x0b07, 0x8f5: 0x0b33, + 0x8f6: 0x0b37, 0x8f7: 0x0b3f, 0x8f8: 0x0b43, 0x8f9: 0x0b4b, 0x8fa: 0x0b53, 0x8fb: 0x0b63, + 0x8fc: 0x0b7f, 0x8fd: 0x0bf7, 0x8fe: 0x0c0b, 0x8ff: 0x0c0f, + // Block 0x24, offset 0x900 + 0x900: 0x0c8f, 0x901: 0x0c93, 0x902: 0x0ca7, 0x903: 0x0cab, 0x904: 0x0cb3, 0x905: 0x0cbb, + 0x906: 0x0cc3, 0x907: 0x0ccf, 0x908: 0x0cf7, 0x909: 0x0d07, 0x90a: 0x0d1b, 0x90b: 0x0d8b, + 0x90c: 0x0d97, 0x90d: 0x0da7, 0x90e: 0x0db3, 0x90f: 0x0dbf, 0x910: 0x0dc7, 0x911: 0x0dcb, + 0x912: 0x0dcf, 0x913: 0x0dd3, 0x914: 0x0dd7, 0x915: 0x0e8f, 0x916: 0x0ed7, 0x917: 0x0ee3, + 0x918: 0x0ee7, 0x919: 0x0eeb, 0x91a: 0x0eef, 0x91b: 0x0ef7, 0x91c: 0x0efb, 0x91d: 0x0f0f, + 0x91e: 0x0f2b, 0x91f: 0x0f33, 0x920: 0x0f73, 0x921: 0x0f77, 0x922: 0x0f7f, 0x923: 0x0f83, + 0x924: 0x0f8b, 0x925: 0x0f8f, 0x926: 0x0fb3, 0x927: 0x0fb7, 0x928: 0x0fd3, 0x929: 0x0fd7, + 0x92a: 0x0fdb, 0x92b: 0x0fdf, 0x92c: 0x0ff3, 0x92d: 0x1017, 0x92e: 0x101b, 0x92f: 0x101f, + 0x930: 0x1043, 0x931: 0x1083, 0x932: 0x1087, 0x933: 0x10a7, 0x934: 0x10b7, 0x935: 0x10bf, + 0x936: 0x10df, 0x937: 0x1103, 0x938: 0x1147, 0x939: 0x114f, 0x93a: 0x1163, 0x93b: 0x116f, + 0x93c: 0x1177, 0x93d: 0x117f, 0x93e: 0x1183, 0x93f: 0x1187, + // Block 0x25, offset 0x940 + 0x940: 0x119f, 0x941: 0x11a3, 0x942: 0x11bf, 0x943: 0x11c7, 0x944: 0x11cf, 0x945: 0x11d3, + 0x946: 0x11df, 0x947: 0x11e7, 0x948: 0x11eb, 0x949: 0x11ef, 0x94a: 0x11f7, 0x94b: 0x11fb, + 0x94c: 0x129b, 0x94d: 0x12af, 0x94e: 0x12e3, 0x94f: 0x12e7, 0x950: 0x12ef, 0x951: 0x131b, + 0x952: 0x1323, 0x953: 0x132b, 0x954: 0x1333, 0x955: 0x136f, 0x956: 0x1373, 0x957: 0x137b, + 0x958: 0x137f, 0x959: 0x1383, 0x95a: 0x13af, 0x95b: 0x13b3, 0x95c: 0x13bb, 0x95d: 0x13cf, + 0x95e: 0x13d3, 0x95f: 0x13ef, 0x960: 0x13f7, 0x961: 0x13fb, 0x962: 0x141f, 0x963: 0x143f, + 0x964: 0x1453, 0x965: 0x1457, 0x966: 0x145f, 0x967: 0x148b, 0x968: 0x148f, 0x969: 0x149f, + 0x96a: 0x14c3, 0x96b: 0x14cf, 0x96c: 0x14df, 0x96d: 0x14f7, 0x96e: 0x14ff, 0x96f: 0x1503, + 0x970: 0x1507, 0x971: 0x150b, 0x972: 0x1517, 0x973: 0x151b, 0x974: 0x1523, 0x975: 0x153f, + 0x976: 0x1543, 0x977: 0x1547, 0x978: 0x155f, 0x979: 0x1563, 0x97a: 0x156b, 0x97b: 0x157f, + 0x97c: 0x1583, 0x97d: 0x1587, 0x97e: 0x158f, 0x97f: 0x1593, + // Block 0x26, offset 0x980 + 0x986: 0xa000, 0x98b: 0xa000, + 0x98c: 0x3f08, 0x98d: 0xa000, 0x98e: 0x3f10, 0x98f: 0xa000, 0x990: 0x3f18, 0x991: 0xa000, + 0x992: 0x3f20, 0x993: 0xa000, 0x994: 0x3f28, 0x995: 0xa000, 0x996: 0x3f30, 0x997: 0xa000, + 0x998: 0x3f38, 0x999: 0xa000, 0x99a: 0x3f40, 0x99b: 0xa000, 0x99c: 0x3f48, 0x99d: 0xa000, + 0x99e: 0x3f50, 0x99f: 0xa000, 0x9a0: 0x3f58, 0x9a1: 0xa000, 0x9a2: 0x3f60, + 0x9a4: 0xa000, 0x9a5: 0x3f68, 0x9a6: 0xa000, 0x9a7: 0x3f70, 0x9a8: 0xa000, 0x9a9: 0x3f78, + 0x9af: 0xa000, + 0x9b0: 0x3f80, 0x9b1: 0x3f88, 0x9b2: 0xa000, 0x9b3: 0x3f90, 0x9b4: 0x3f98, 0x9b5: 0xa000, + 0x9b6: 0x3fa0, 0x9b7: 0x3fa8, 0x9b8: 0xa000, 0x9b9: 0x3fb0, 0x9ba: 0x3fb8, 0x9bb: 0xa000, + 0x9bc: 0x3fc0, 0x9bd: 0x3fc8, + // Block 0x27, offset 0x9c0 + 0x9d4: 0x3f00, + 0x9d9: 0x9903, 0x9da: 0x9903, 0x9db: 0x42dc, 0x9dc: 0x42e2, 0x9dd: 0xa000, + 0x9de: 0x3fd0, 0x9df: 0x26b4, + 0x9e6: 0xa000, + 0x9eb: 0xa000, 0x9ec: 0x3fe0, 0x9ed: 0xa000, 0x9ee: 0x3fe8, 0x9ef: 0xa000, + 0x9f0: 0x3ff0, 0x9f1: 0xa000, 0x9f2: 0x3ff8, 0x9f3: 0xa000, 0x9f4: 0x4000, 0x9f5: 0xa000, + 0x9f6: 0x4008, 0x9f7: 0xa000, 0x9f8: 0x4010, 0x9f9: 0xa000, 0x9fa: 0x4018, 0x9fb: 0xa000, + 0x9fc: 0x4020, 0x9fd: 0xa000, 0x9fe: 0x4028, 0x9ff: 0xa000, + // Block 0x28, offset 0xa00 + 0xa00: 0x4030, 0xa01: 0xa000, 0xa02: 0x4038, 0xa04: 0xa000, 0xa05: 0x4040, + 0xa06: 0xa000, 0xa07: 0x4048, 0xa08: 0xa000, 0xa09: 0x4050, + 0xa0f: 0xa000, 0xa10: 0x4058, 0xa11: 0x4060, + 0xa12: 0xa000, 0xa13: 0x4068, 0xa14: 0x4070, 0xa15: 0xa000, 0xa16: 0x4078, 0xa17: 0x4080, + 0xa18: 0xa000, 0xa19: 0x4088, 0xa1a: 0x4090, 0xa1b: 0xa000, 0xa1c: 0x4098, 0xa1d: 0x40a0, + 0xa2f: 0xa000, + 0xa30: 0xa000, 0xa31: 0xa000, 0xa32: 0xa000, 0xa34: 0x3fd8, + 0xa37: 0x40a8, 0xa38: 0x40b0, 0xa39: 0x40b8, 0xa3a: 0x40c0, + 0xa3d: 0xa000, 0xa3e: 0x40c8, 0xa3f: 0x26c9, + // Block 0x29, offset 0xa40 + 0xa40: 0x0367, 0xa41: 0x032b, 0xa42: 0x032f, 0xa43: 0x0333, 0xa44: 0x037b, 0xa45: 0x0337, + 0xa46: 0x033b, 0xa47: 0x033f, 0xa48: 0x0343, 0xa49: 0x0347, 0xa4a: 0x034b, 0xa4b: 0x034f, + 0xa4c: 0x0353, 0xa4d: 0x0357, 0xa4e: 0x035b, 0xa4f: 0x49bd, 0xa50: 0x49c3, 0xa51: 0x49c9, + 0xa52: 0x49cf, 0xa53: 0x49d5, 0xa54: 0x49db, 0xa55: 0x49e1, 0xa56: 0x49e7, 0xa57: 0x49ed, + 0xa58: 0x49f3, 0xa59: 0x49f9, 0xa5a: 0x49ff, 0xa5b: 0x4a05, 0xa5c: 0x4a0b, 0xa5d: 0x4a11, + 0xa5e: 0x4a17, 0xa5f: 0x4a1d, 0xa60: 0x4a23, 0xa61: 0x4a29, 0xa62: 0x4a2f, 0xa63: 0x4a35, + 0xa64: 0x03c3, 0xa65: 0x035f, 0xa66: 0x0363, 0xa67: 0x03e7, 0xa68: 0x03eb, 0xa69: 0x03ef, + 0xa6a: 0x03f3, 0xa6b: 0x03f7, 0xa6c: 0x03fb, 0xa6d: 0x03ff, 0xa6e: 0x036b, 0xa6f: 0x0403, + 0xa70: 0x0407, 0xa71: 0x036f, 0xa72: 0x0373, 0xa73: 0x0377, 0xa74: 0x037f, 0xa75: 0x0383, + 0xa76: 0x0387, 0xa77: 0x038b, 0xa78: 0x038f, 0xa79: 0x0393, 0xa7a: 0x0397, 0xa7b: 0x039b, + 0xa7c: 0x039f, 0xa7d: 0x03a3, 0xa7e: 0x03a7, 0xa7f: 0x03ab, + // Block 0x2a, offset 0xa80 + 0xa80: 0x03af, 0xa81: 0x03b3, 0xa82: 0x040b, 0xa83: 0x040f, 0xa84: 0x03b7, 0xa85: 0x03bb, + 0xa86: 0x03bf, 0xa87: 0x03c7, 0xa88: 0x03cb, 0xa89: 0x03cf, 0xa8a: 0x03d3, 0xa8b: 0x03d7, + 0xa8c: 0x03db, 0xa8d: 0x03df, 0xa8e: 0x03e3, + 0xa92: 0x06bf, 0xa93: 0x071b, 0xa94: 0x06cb, 0xa95: 0x097b, 0xa96: 0x06cf, 0xa97: 0x06e7, + 0xa98: 0x06d3, 0xa99: 0x0f93, 0xa9a: 0x0707, 0xa9b: 0x06db, 0xa9c: 0x06c3, 0xa9d: 0x09ff, + 0xa9e: 0x098f, 0xa9f: 0x072f, + // Block 0x2b, offset 0xac0 + 0xac0: 0x2054, 0xac1: 0x205a, 0xac2: 0x2060, 0xac3: 0x2066, 0xac4: 0x206c, 0xac5: 0x2072, + 0xac6: 0x2078, 0xac7: 0x207e, 0xac8: 0x2084, 0xac9: 0x208a, 0xaca: 0x2090, 0xacb: 0x2096, + 0xacc: 0x209c, 0xacd: 0x20a2, 0xace: 0x2726, 0xacf: 0x272f, 0xad0: 0x2738, 0xad1: 0x2741, + 0xad2: 0x274a, 0xad3: 0x2753, 0xad4: 0x275c, 0xad5: 0x2765, 0xad6: 0x276e, 0xad7: 0x2780, + 0xad8: 0x2789, 0xad9: 0x2792, 0xada: 0x279b, 0xadb: 0x27a4, 0xadc: 0x2777, 0xadd: 0x2bac, + 0xade: 0x2aed, 0xae0: 0x20a8, 0xae1: 0x20c0, 0xae2: 0x20b4, 0xae3: 0x2108, + 0xae4: 0x20c6, 0xae5: 0x20e4, 0xae6: 0x20ae, 0xae7: 0x20de, 0xae8: 0x20ba, 0xae9: 0x20f0, + 0xaea: 0x2120, 0xaeb: 0x213e, 0xaec: 0x2138, 0xaed: 0x212c, 0xaee: 0x217a, 0xaef: 0x210e, + 0xaf0: 0x211a, 0xaf1: 0x2132, 0xaf2: 0x2126, 0xaf3: 0x2150, 0xaf4: 0x20fc, 0xaf5: 0x2144, + 0xaf6: 0x216e, 0xaf7: 0x2156, 0xaf8: 0x20ea, 0xaf9: 0x20cc, 0xafa: 0x2102, 0xafb: 0x2114, + 0xafc: 0x214a, 0xafd: 0x20d2, 0xafe: 0x2174, 0xaff: 0x20f6, + // Block 0x2c, offset 0xb00 + 0xb00: 0x215c, 0xb01: 0x20d8, 0xb02: 0x2162, 0xb03: 0x2168, 0xb04: 0x092f, 0xb05: 0x0b03, + 0xb06: 0x0ca7, 0xb07: 0x10c7, + 0xb10: 0x1bc4, 0xb11: 0x18a9, + 0xb12: 0x18ac, 0xb13: 0x18af, 0xb14: 0x18b2, 0xb15: 0x18b5, 0xb16: 0x18b8, 0xb17: 0x18bb, + 0xb18: 0x18be, 0xb19: 0x18c1, 0xb1a: 0x18ca, 0xb1b: 0x18cd, 0xb1c: 0x18d0, 0xb1d: 0x18d3, + 0xb1e: 0x18d6, 0xb1f: 0x18d9, 0xb20: 0x0313, 0xb21: 0x031b, 0xb22: 0x031f, 0xb23: 0x0327, + 0xb24: 0x032b, 0xb25: 0x032f, 0xb26: 0x0337, 0xb27: 0x033f, 0xb28: 0x0343, 0xb29: 0x034b, + 0xb2a: 0x034f, 0xb2b: 0x0353, 0xb2c: 0x0357, 0xb2d: 0x035b, 0xb2e: 0x2e18, 0xb2f: 0x2e20, + 0xb30: 0x2e28, 0xb31: 0x2e30, 0xb32: 0x2e38, 0xb33: 0x2e40, 0xb34: 0x2e48, 0xb35: 0x2e50, + 0xb36: 0x2e60, 0xb37: 0x2e68, 0xb38: 0x2e70, 0xb39: 0x2e78, 0xb3a: 0x2e80, 0xb3b: 0x2e88, + 0xb3c: 0x2ed3, 0xb3d: 0x2e9b, 0xb3e: 0x2e58, + // Block 0x2d, offset 0xb40 + 0xb40: 0x06bf, 0xb41: 0x071b, 0xb42: 0x06cb, 0xb43: 0x097b, 0xb44: 0x071f, 0xb45: 0x07af, + 0xb46: 0x06c7, 0xb47: 0x07ab, 0xb48: 0x070b, 0xb49: 0x0887, 0xb4a: 0x0d07, 0xb4b: 0x0e8f, + 0xb4c: 0x0dd7, 0xb4d: 0x0d1b, 0xb4e: 0x145f, 0xb4f: 0x098b, 0xb50: 0x0ccf, 0xb51: 0x0d4b, + 0xb52: 0x0d0b, 0xb53: 0x104b, 0xb54: 0x08fb, 0xb55: 0x0f03, 0xb56: 0x1387, 0xb57: 0x105f, + 0xb58: 0x0843, 0xb59: 0x108f, 0xb5a: 0x0f9b, 0xb5b: 0x0a17, 0xb5c: 0x140f, 0xb5d: 0x077f, + 0xb5e: 0x08ab, 0xb5f: 0x0df7, 0xb60: 0x1527, 0xb61: 0x0743, 0xb62: 0x07d3, 0xb63: 0x0d9b, + 0xb64: 0x06cf, 0xb65: 0x06e7, 0xb66: 0x06d3, 0xb67: 0x0adb, 0xb68: 0x08ef, 0xb69: 0x087f, + 0xb6a: 0x0a57, 0xb6b: 0x0a4b, 0xb6c: 0x0feb, 0xb6d: 0x073f, 0xb6e: 0x139b, 0xb6f: 0x089b, + 0xb70: 0x09f3, 0xb71: 0x18dc, 0xb72: 0x18df, 0xb73: 0x18e2, 0xb74: 0x18e5, 0xb75: 0x18ee, + 0xb76: 0x18f1, 0xb77: 0x18f4, 0xb78: 0x18f7, 0xb79: 0x18fa, 0xb7a: 0x18fd, 0xb7b: 0x1900, + 0xb7c: 0x1903, 0xb7d: 0x1906, 0xb7e: 0x1909, 0xb7f: 0x1912, + // Block 0x2e, offset 0xb80 + 0xb80: 0x1cc6, 0xb81: 0x1cd5, 0xb82: 0x1ce4, 0xb83: 0x1cf3, 0xb84: 0x1d02, 0xb85: 0x1d11, + 0xb86: 0x1d20, 0xb87: 0x1d2f, 0xb88: 0x1d3e, 0xb89: 0x218c, 0xb8a: 0x219e, 0xb8b: 0x21b0, + 0xb8c: 0x1954, 0xb8d: 0x1c04, 0xb8e: 0x19d2, 0xb8f: 0x1ba8, 0xb90: 0x04cb, 0xb91: 0x04d3, + 0xb92: 0x04db, 0xb93: 0x04e3, 0xb94: 0x04eb, 0xb95: 0x04ef, 0xb96: 0x04f3, 0xb97: 0x04f7, + 0xb98: 0x04fb, 0xb99: 0x04ff, 0xb9a: 0x0503, 0xb9b: 0x0507, 0xb9c: 0x050b, 0xb9d: 0x050f, + 0xb9e: 0x0513, 0xb9f: 0x0517, 0xba0: 0x051b, 0xba1: 0x0523, 0xba2: 0x0527, 0xba3: 0x052b, + 0xba4: 0x052f, 0xba5: 0x0533, 0xba6: 0x0537, 0xba7: 0x053b, 0xba8: 0x053f, 0xba9: 0x0543, + 0xbaa: 0x0547, 0xbab: 0x054b, 0xbac: 0x054f, 0xbad: 0x0553, 0xbae: 0x0557, 0xbaf: 0x055b, + 0xbb0: 0x055f, 0xbb1: 0x0563, 0xbb2: 0x0567, 0xbb3: 0x056f, 0xbb4: 0x0577, 0xbb5: 0x057f, + 0xbb6: 0x0583, 0xbb7: 0x0587, 0xbb8: 0x058b, 0xbb9: 0x058f, 0xbba: 0x0593, 0xbbb: 0x0597, + 0xbbc: 0x059b, 0xbbd: 0x059f, 0xbbe: 0x05a3, + // Block 0x2f, offset 0xbc0 + 0xbc0: 0x2b0c, 0xbc1: 0x29a8, 0xbc2: 0x2b1c, 0xbc3: 0x2880, 0xbc4: 0x2ee4, 0xbc5: 0x288a, + 0xbc6: 0x2894, 0xbc7: 0x2f28, 0xbc8: 0x29b5, 0xbc9: 0x289e, 0xbca: 0x28a8, 0xbcb: 0x28b2, + 0xbcc: 0x29dc, 0xbcd: 0x29e9, 0xbce: 0x29c2, 0xbcf: 0x29cf, 0xbd0: 0x2ea9, 0xbd1: 0x29f6, + 0xbd2: 0x2a03, 0xbd3: 0x2bbe, 0xbd4: 0x26bb, 0xbd5: 0x2bd1, 0xbd6: 0x2be4, 0xbd7: 0x2b2c, + 0xbd8: 0x2a10, 0xbd9: 0x2bf7, 0xbda: 0x2c0a, 0xbdb: 0x2a1d, 0xbdc: 0x28bc, 0xbdd: 0x28c6, + 0xbde: 0x2eb7, 0xbdf: 0x2a2a, 0xbe0: 0x2b3c, 0xbe1: 0x2ef5, 0xbe2: 0x28d0, 0xbe3: 0x28da, + 0xbe4: 0x2a37, 0xbe5: 0x28e4, 0xbe6: 0x28ee, 0xbe7: 0x26d0, 0xbe8: 0x26d7, 0xbe9: 0x28f8, + 0xbea: 0x2902, 0xbeb: 0x2c1d, 0xbec: 0x2a44, 0xbed: 0x2b4c, 0xbee: 0x2c30, 0xbef: 0x2a51, + 0xbf0: 0x2916, 0xbf1: 0x290c, 0xbf2: 0x2f3c, 0xbf3: 0x2a5e, 0xbf4: 0x2c43, 0xbf5: 0x2920, + 0xbf6: 0x2b5c, 0xbf7: 0x292a, 0xbf8: 0x2a78, 0xbf9: 0x2934, 0xbfa: 0x2a85, 0xbfb: 0x2f06, + 0xbfc: 0x2a6b, 0xbfd: 0x2b6c, 0xbfe: 0x2a92, 0xbff: 0x26de, + // Block 0x30, offset 0xc00 + 0xc00: 0x2f17, 0xc01: 0x293e, 0xc02: 0x2948, 0xc03: 0x2a9f, 0xc04: 0x2952, 0xc05: 0x295c, + 0xc06: 0x2966, 0xc07: 0x2b7c, 0xc08: 0x2aac, 0xc09: 0x26e5, 0xc0a: 0x2c56, 0xc0b: 0x2e90, + 0xc0c: 0x2b8c, 0xc0d: 0x2ab9, 0xc0e: 0x2ec5, 0xc0f: 0x2970, 0xc10: 0x297a, 0xc11: 0x2ac6, + 0xc12: 0x26ec, 0xc13: 0x2ad3, 0xc14: 0x2b9c, 0xc15: 0x26f3, 0xc16: 0x2c69, 0xc17: 0x2984, + 0xc18: 0x1cb7, 0xc19: 0x1ccb, 0xc1a: 0x1cda, 0xc1b: 0x1ce9, 0xc1c: 0x1cf8, 0xc1d: 0x1d07, + 0xc1e: 0x1d16, 0xc1f: 0x1d25, 0xc20: 0x1d34, 0xc21: 0x1d43, 0xc22: 0x2192, 0xc23: 0x21a4, + 0xc24: 0x21b6, 0xc25: 0x21c2, 0xc26: 0x21ce, 0xc27: 0x21da, 0xc28: 0x21e6, 0xc29: 0x21f2, + 0xc2a: 0x21fe, 0xc2b: 0x220a, 0xc2c: 0x2246, 0xc2d: 0x2252, 0xc2e: 0x225e, 0xc2f: 0x226a, + 0xc30: 0x2276, 0xc31: 0x1c14, 0xc32: 0x19c6, 0xc33: 0x1936, 0xc34: 0x1be4, 0xc35: 0x1a47, + 0xc36: 0x1a56, 0xc37: 0x19cc, 0xc38: 0x1bfc, 0xc39: 0x1c00, 0xc3a: 0x1960, 0xc3b: 0x2701, + 0xc3c: 0x270f, 0xc3d: 0x26fa, 0xc3e: 0x2708, 0xc3f: 0x2ae0, + // Block 0x31, offset 0xc40 + 0xc40: 0x1a4a, 0xc41: 0x1a32, 0xc42: 0x1c60, 0xc43: 0x1a1a, 0xc44: 0x19f3, 0xc45: 0x1969, + 0xc46: 0x1978, 0xc47: 0x1948, 0xc48: 0x1bf0, 0xc49: 0x1d52, 0xc4a: 0x1a4d, 0xc4b: 0x1a35, + 0xc4c: 0x1c64, 0xc4d: 0x1c70, 0xc4e: 0x1a26, 0xc4f: 0x19fc, 0xc50: 0x1957, 0xc51: 0x1c1c, + 0xc52: 0x1bb0, 0xc53: 0x1b9c, 0xc54: 0x1bcc, 0xc55: 0x1c74, 0xc56: 0x1a29, 0xc57: 0x19c9, + 0xc58: 0x19ff, 0xc59: 0x19de, 0xc5a: 0x1a41, 0xc5b: 0x1c78, 0xc5c: 0x1a2c, 0xc5d: 0x19c0, + 0xc5e: 0x1a02, 0xc5f: 0x1c3c, 0xc60: 0x1bf4, 0xc61: 0x1a14, 0xc62: 0x1c24, 0xc63: 0x1c40, + 0xc64: 0x1bf8, 0xc65: 0x1a17, 0xc66: 0x1c28, 0xc67: 0x22e8, 0xc68: 0x22fc, 0xc69: 0x1996, + 0xc6a: 0x1c20, 0xc6b: 0x1bb4, 0xc6c: 0x1ba0, 0xc6d: 0x1c48, 0xc6e: 0x2716, 0xc6f: 0x27ad, + 0xc70: 0x1a59, 0xc71: 0x1a44, 0xc72: 0x1c7c, 0xc73: 0x1a2f, 0xc74: 0x1a50, 0xc75: 0x1a38, + 0xc76: 0x1c68, 0xc77: 0x1a1d, 0xc78: 0x19f6, 0xc79: 0x1981, 0xc7a: 0x1a53, 0xc7b: 0x1a3b, + 0xc7c: 0x1c6c, 0xc7d: 0x1a20, 0xc7e: 0x19f9, 0xc7f: 0x1984, + // Block 0x32, offset 0xc80 + 0xc80: 0x1c2c, 0xc81: 0x1bb8, 0xc82: 0x1d4d, 0xc83: 0x1939, 0xc84: 0x19ba, 0xc85: 0x19bd, + 0xc86: 0x22f5, 0xc87: 0x1b94, 0xc88: 0x19c3, 0xc89: 0x194b, 0xc8a: 0x19e1, 0xc8b: 0x194e, + 0xc8c: 0x19ea, 0xc8d: 0x196c, 0xc8e: 0x196f, 0xc8f: 0x1a05, 0xc90: 0x1a0b, 0xc91: 0x1a0e, + 0xc92: 0x1c30, 0xc93: 0x1a11, 0xc94: 0x1a23, 0xc95: 0x1c38, 0xc96: 0x1c44, 0xc97: 0x1990, + 0xc98: 0x1d57, 0xc99: 0x1bbc, 0xc9a: 0x1993, 0xc9b: 0x1a5c, 0xc9c: 0x19a5, 0xc9d: 0x19b4, + 0xc9e: 0x22e2, 0xc9f: 0x22dc, 0xca0: 0x1cc1, 0xca1: 0x1cd0, 0xca2: 0x1cdf, 0xca3: 0x1cee, + 0xca4: 0x1cfd, 0xca5: 0x1d0c, 0xca6: 0x1d1b, 0xca7: 0x1d2a, 0xca8: 0x1d39, 0xca9: 0x2186, + 0xcaa: 0x2198, 0xcab: 0x21aa, 0xcac: 0x21bc, 0xcad: 0x21c8, 0xcae: 0x21d4, 0xcaf: 0x21e0, + 0xcb0: 0x21ec, 0xcb1: 0x21f8, 0xcb2: 0x2204, 0xcb3: 0x2240, 0xcb4: 0x224c, 0xcb5: 0x2258, + 0xcb6: 0x2264, 0xcb7: 0x2270, 0xcb8: 0x227c, 0xcb9: 0x2282, 0xcba: 0x2288, 0xcbb: 0x228e, + 0xcbc: 0x2294, 0xcbd: 0x22a6, 0xcbe: 0x22ac, 0xcbf: 0x1c10, + // Block 0x33, offset 0xcc0 + 0xcc0: 0x1377, 0xcc1: 0x0cfb, 0xcc2: 0x13d3, 0xcc3: 0x139f, 0xcc4: 0x0e57, 0xcc5: 0x06eb, + 0xcc6: 0x08df, 0xcc7: 0x162b, 0xcc8: 0x162b, 0xcc9: 0x0a0b, 0xcca: 0x145f, 0xccb: 0x0943, + 0xccc: 0x0a07, 0xccd: 0x0bef, 0xcce: 0x0fcf, 0xccf: 0x115f, 0xcd0: 0x1297, 0xcd1: 0x12d3, + 0xcd2: 0x1307, 0xcd3: 0x141b, 0xcd4: 0x0d73, 0xcd5: 0x0dff, 0xcd6: 0x0eab, 0xcd7: 0x0f43, + 0xcd8: 0x125f, 0xcd9: 0x1447, 0xcda: 0x1573, 0xcdb: 0x070f, 0xcdc: 0x08b3, 0xcdd: 0x0d87, + 0xcde: 0x0ecf, 0xcdf: 0x1293, 0xce0: 0x15c3, 0xce1: 0x0ab3, 0xce2: 0x0e77, 0xce3: 0x1283, + 0xce4: 0x1317, 0xce5: 0x0c23, 0xce6: 0x11bb, 0xce7: 0x12df, 0xce8: 0x0b1f, 0xce9: 0x0d0f, + 0xcea: 0x0e17, 0xceb: 0x0f1b, 0xcec: 0x1427, 0xced: 0x074f, 0xcee: 0x07e7, 0xcef: 0x0853, + 0xcf0: 0x0c8b, 0xcf1: 0x0d7f, 0xcf2: 0x0ecb, 0xcf3: 0x0fef, 0xcf4: 0x1177, 0xcf5: 0x128b, + 0xcf6: 0x12a3, 0xcf7: 0x13c7, 0xcf8: 0x14ef, 0xcf9: 0x15a3, 0xcfa: 0x15bf, 0xcfb: 0x102b, + 0xcfc: 0x106b, 0xcfd: 0x1123, 0xcfe: 0x1243, 0xcff: 0x147b, + // Block 0x34, offset 0xd00 + 0xd00: 0x15cb, 0xd01: 0x134b, 0xd02: 0x09c7, 0xd03: 0x0b3b, 0xd04: 0x10db, 0xd05: 0x119b, + 0xd06: 0x0eff, 0xd07: 0x1033, 0xd08: 0x1397, 0xd09: 0x14e7, 0xd0a: 0x09c3, 0xd0b: 0x0a8f, + 0xd0c: 0x0d77, 0xd0d: 0x0e2b, 0xd0e: 0x0e5f, 0xd0f: 0x1113, 0xd10: 0x113b, 0xd11: 0x14a7, + 0xd12: 0x084f, 0xd13: 0x11a7, 0xd14: 0x07f3, 0xd15: 0x07ef, 0xd16: 0x1097, 0xd17: 0x1127, + 0xd18: 0x125b, 0xd19: 0x14af, 0xd1a: 0x1367, 0xd1b: 0x0c27, 0xd1c: 0x0d73, 0xd1d: 0x1357, + 0xd1e: 0x06f7, 0xd1f: 0x0a63, 0xd20: 0x0b93, 0xd21: 0x0f2f, 0xd22: 0x0faf, 0xd23: 0x0873, + 0xd24: 0x103b, 0xd25: 0x075f, 0xd26: 0x0b77, 0xd27: 0x06d7, 0xd28: 0x0deb, 0xd29: 0x0ca3, + 0xd2a: 0x110f, 0xd2b: 0x08c7, 0xd2c: 0x09b3, 0xd2d: 0x0ffb, 0xd2e: 0x1263, 0xd2f: 0x133b, + 0xd30: 0x0db7, 0xd31: 0x13f7, 0xd32: 0x0de3, 0xd33: 0x0c37, 0xd34: 0x121b, 0xd35: 0x0c57, + 0xd36: 0x0fab, 0xd37: 0x072b, 0xd38: 0x07a7, 0xd39: 0x07eb, 0xd3a: 0x0d53, 0xd3b: 0x10fb, + 0xd3c: 0x11f3, 0xd3d: 0x1347, 0xd3e: 0x145b, 0xd3f: 0x085b, + // Block 0x35, offset 0xd40 + 0xd40: 0x090f, 0xd41: 0x0a17, 0xd42: 0x0b2f, 0xd43: 0x0cbf, 0xd44: 0x0e7b, 0xd45: 0x103f, + 0xd46: 0x1497, 0xd47: 0x157b, 0xd48: 0x15cf, 0xd49: 0x15e7, 0xd4a: 0x0837, 0xd4b: 0x0cf3, + 0xd4c: 0x0da3, 0xd4d: 0x13eb, 0xd4e: 0x0afb, 0xd4f: 0x0bd7, 0xd50: 0x0bf3, 0xd51: 0x0c83, + 0xd52: 0x0e6b, 0xd53: 0x0eb7, 0xd54: 0x0f67, 0xd55: 0x108b, 0xd56: 0x112f, 0xd57: 0x1193, + 0xd58: 0x13db, 0xd59: 0x126b, 0xd5a: 0x1403, 0xd5b: 0x147f, 0xd5c: 0x080f, 0xd5d: 0x083b, + 0xd5e: 0x0923, 0xd5f: 0x0ea7, 0xd60: 0x12f3, 0xd61: 0x133b, 0xd62: 0x0b1b, 0xd63: 0x0b8b, + 0xd64: 0x0c4f, 0xd65: 0x0daf, 0xd66: 0x10d7, 0xd67: 0x0f23, 0xd68: 0x073b, 0xd69: 0x097f, + 0xd6a: 0x0a63, 0xd6b: 0x0ac7, 0xd6c: 0x0b97, 0xd6d: 0x0f3f, 0xd6e: 0x0f5b, 0xd6f: 0x116b, + 0xd70: 0x118b, 0xd71: 0x1463, 0xd72: 0x14e3, 0xd73: 0x14f3, 0xd74: 0x152f, 0xd75: 0x0753, + 0xd76: 0x107f, 0xd77: 0x144f, 0xd78: 0x14cb, 0xd79: 0x0baf, 0xd7a: 0x0717, 0xd7b: 0x0777, + 0xd7c: 0x0a67, 0xd7d: 0x0a87, 0xd7e: 0x0caf, 0xd7f: 0x0d73, + // Block 0x36, offset 0xd80 + 0xd80: 0x0ec3, 0xd81: 0x0fcb, 0xd82: 0x1277, 0xd83: 0x1417, 0xd84: 0x1623, 0xd85: 0x0ce3, + 0xd86: 0x14a3, 0xd87: 0x0833, 0xd88: 0x0d2f, 0xd89: 0x0d3b, 0xd8a: 0x0e0f, 0xd8b: 0x0e47, + 0xd8c: 0x0f4b, 0xd8d: 0x0fa7, 0xd8e: 0x1027, 0xd8f: 0x110b, 0xd90: 0x153b, 0xd91: 0x07af, + 0xd92: 0x0c03, 0xd93: 0x14b3, 0xd94: 0x0767, 0xd95: 0x0aab, 0xd96: 0x0e2f, 0xd97: 0x13df, + 0xd98: 0x0b67, 0xd99: 0x0bb7, 0xd9a: 0x0d43, 0xd9b: 0x0f2f, 0xd9c: 0x14bb, 0xd9d: 0x0817, + 0xd9e: 0x08ff, 0xd9f: 0x0a97, 0xda0: 0x0cd3, 0xda1: 0x0d1f, 0xda2: 0x0d5f, 0xda3: 0x0df3, + 0xda4: 0x0f47, 0xda5: 0x0fbb, 0xda6: 0x1157, 0xda7: 0x12f7, 0xda8: 0x1303, 0xda9: 0x1457, + 0xdaa: 0x14d7, 0xdab: 0x0883, 0xdac: 0x0e4b, 0xdad: 0x0903, 0xdae: 0x0ec7, 0xdaf: 0x0f6b, + 0xdb0: 0x1287, 0xdb1: 0x14bf, 0xdb2: 0x15ab, 0xdb3: 0x15d3, 0xdb4: 0x0d37, 0xdb5: 0x0e27, + 0xdb6: 0x11c3, 0xdb7: 0x10b7, 0xdb8: 0x10c3, 0xdb9: 0x10e7, 0xdba: 0x0f17, 0xdbb: 0x0e9f, + 0xdbc: 0x1363, 0xdbd: 0x0733, 0xdbe: 0x122b, 0xdbf: 0x081b, + // Block 0x37, offset 0xdc0 + 0xdc0: 0x080b, 0xdc1: 0x0b0b, 0xdc2: 0x0c2b, 0xdc3: 0x10f3, 0xdc4: 0x0a53, 0xdc5: 0x0e03, + 0xdc6: 0x0cef, 0xdc7: 0x13e7, 0xdc8: 0x12e7, 0xdc9: 0x14ab, 0xdca: 0x1323, 0xdcb: 0x0b27, + 0xdcc: 0x0787, 0xdcd: 0x095b, 0xdd0: 0x09af, + 0xdd2: 0x0cdf, 0xdd5: 0x07f7, 0xdd6: 0x0f1f, 0xdd7: 0x0fe3, + 0xdd8: 0x1047, 0xdd9: 0x1063, 0xdda: 0x1067, 0xddb: 0x107b, 0xddc: 0x14fb, 0xddd: 0x10eb, + 0xdde: 0x116f, 0xde0: 0x128f, 0xde2: 0x1353, + 0xde5: 0x1407, 0xde6: 0x1433, + 0xdea: 0x154f, 0xdeb: 0x1553, 0xdec: 0x1557, 0xded: 0x15bb, 0xdee: 0x142b, 0xdef: 0x14c7, + 0xdf0: 0x0757, 0xdf1: 0x077b, 0xdf2: 0x078f, 0xdf3: 0x084b, 0xdf4: 0x0857, 0xdf5: 0x0897, + 0xdf6: 0x094b, 0xdf7: 0x0967, 0xdf8: 0x096f, 0xdf9: 0x09ab, 0xdfa: 0x09b7, 0xdfb: 0x0a93, + 0xdfc: 0x0a9b, 0xdfd: 0x0ba3, 0xdfe: 0x0bcb, 0xdff: 0x0bd3, + // Block 0x38, offset 0xe00 + 0xe00: 0x0beb, 0xe01: 0x0c97, 0xe02: 0x0cc7, 0xe03: 0x0ce7, 0xe04: 0x0d57, 0xe05: 0x0e1b, + 0xe06: 0x0e37, 0xe07: 0x0e67, 0xe08: 0x0ebb, 0xe09: 0x0edb, 0xe0a: 0x0f4f, 0xe0b: 0x102f, + 0xe0c: 0x104b, 0xe0d: 0x1053, 0xe0e: 0x104f, 0xe0f: 0x1057, 0xe10: 0x105b, 0xe11: 0x105f, + 0xe12: 0x1073, 0xe13: 0x1077, 0xe14: 0x109b, 0xe15: 0x10af, 0xe16: 0x10cb, 0xe17: 0x112f, + 0xe18: 0x1137, 0xe19: 0x113f, 0xe1a: 0x1153, 0xe1b: 0x117b, 0xe1c: 0x11cb, 0xe1d: 0x11ff, + 0xe1e: 0x11ff, 0xe1f: 0x1267, 0xe20: 0x130f, 0xe21: 0x1327, 0xe22: 0x135b, 0xe23: 0x135f, + 0xe24: 0x13a3, 0xe25: 0x13a7, 0xe26: 0x13ff, 0xe27: 0x1407, 0xe28: 0x14db, 0xe29: 0x151f, + 0xe2a: 0x1537, 0xe2b: 0x0b9b, 0xe2c: 0x171e, 0xe2d: 0x11e3, + 0xe30: 0x06df, 0xe31: 0x07e3, 0xe32: 0x07a3, 0xe33: 0x074b, 0xe34: 0x078b, 0xe35: 0x07b7, + 0xe36: 0x0847, 0xe37: 0x0863, 0xe38: 0x094b, 0xe39: 0x0937, 0xe3a: 0x0947, 0xe3b: 0x0963, + 0xe3c: 0x09af, 0xe3d: 0x09bf, 0xe3e: 0x0a03, 0xe3f: 0x0a0f, + // Block 0x39, offset 0xe40 + 0xe40: 0x0a2b, 0xe41: 0x0a3b, 0xe42: 0x0b23, 0xe43: 0x0b2b, 0xe44: 0x0b5b, 0xe45: 0x0b7b, + 0xe46: 0x0bab, 0xe47: 0x0bc3, 0xe48: 0x0bb3, 0xe49: 0x0bd3, 0xe4a: 0x0bc7, 0xe4b: 0x0beb, + 0xe4c: 0x0c07, 0xe4d: 0x0c5f, 0xe4e: 0x0c6b, 0xe4f: 0x0c73, 0xe50: 0x0c9b, 0xe51: 0x0cdf, + 0xe52: 0x0d0f, 0xe53: 0x0d13, 0xe54: 0x0d27, 0xe55: 0x0da7, 0xe56: 0x0db7, 0xe57: 0x0e0f, + 0xe58: 0x0e5b, 0xe59: 0x0e53, 0xe5a: 0x0e67, 0xe5b: 0x0e83, 0xe5c: 0x0ebb, 0xe5d: 0x1013, + 0xe5e: 0x0edf, 0xe5f: 0x0f13, 0xe60: 0x0f1f, 0xe61: 0x0f5f, 0xe62: 0x0f7b, 0xe63: 0x0f9f, + 0xe64: 0x0fc3, 0xe65: 0x0fc7, 0xe66: 0x0fe3, 0xe67: 0x0fe7, 0xe68: 0x0ff7, 0xe69: 0x100b, + 0xe6a: 0x1007, 0xe6b: 0x1037, 0xe6c: 0x10b3, 0xe6d: 0x10cb, 0xe6e: 0x10e3, 0xe6f: 0x111b, + 0xe70: 0x112f, 0xe71: 0x114b, 0xe72: 0x117b, 0xe73: 0x122f, 0xe74: 0x1257, 0xe75: 0x12cb, + 0xe76: 0x1313, 0xe77: 0x131f, 0xe78: 0x1327, 0xe79: 0x133f, 0xe7a: 0x1353, 0xe7b: 0x1343, + 0xe7c: 0x135b, 0xe7d: 0x1357, 0xe7e: 0x134f, 0xe7f: 0x135f, + // Block 0x3a, offset 0xe80 + 0xe80: 0x136b, 0xe81: 0x13a7, 0xe82: 0x13e3, 0xe83: 0x1413, 0xe84: 0x144b, 0xe85: 0x146b, + 0xe86: 0x14b7, 0xe87: 0x14db, 0xe88: 0x14fb, 0xe89: 0x150f, 0xe8a: 0x151f, 0xe8b: 0x152b, + 0xe8c: 0x1537, 0xe8d: 0x158b, 0xe8e: 0x162b, 0xe8f: 0x16b5, 0xe90: 0x16b0, 0xe91: 0x16e2, + 0xe92: 0x0607, 0xe93: 0x062f, 0xe94: 0x0633, 0xe95: 0x1764, 0xe96: 0x1791, 0xe97: 0x1809, + 0xe98: 0x1617, 0xe99: 0x1627, + // Block 0x3b, offset 0xec0 + 0xec0: 0x19d5, 0xec1: 0x19d8, 0xec2: 0x19db, 0xec3: 0x1c08, 0xec4: 0x1c0c, 0xec5: 0x1a5f, + 0xec6: 0x1a5f, + 0xed3: 0x1d75, 0xed4: 0x1d66, 0xed5: 0x1d6b, 0xed6: 0x1d7a, 0xed7: 0x1d70, + 0xedd: 0x4390, + 0xede: 0x8115, 0xedf: 0x4402, 0xee0: 0x022d, 0xee1: 0x0215, 0xee2: 0x021e, 0xee3: 0x0221, + 0xee4: 0x0224, 0xee5: 0x0227, 0xee6: 0x022a, 0xee7: 0x0230, 0xee8: 0x0233, 0xee9: 0x0017, + 0xeea: 0x43f0, 0xeeb: 0x43f6, 0xeec: 0x44f4, 0xeed: 0x44fc, 0xeee: 0x4348, 0xeef: 0x434e, + 0xef0: 0x4354, 0xef1: 0x435a, 0xef2: 0x4366, 0xef3: 0x436c, 0xef4: 0x4372, 0xef5: 0x437e, + 0xef6: 0x4384, 0xef8: 0x438a, 0xef9: 0x4396, 0xefa: 0x439c, 0xefb: 0x43a2, + 0xefc: 0x43ae, 0xefe: 0x43b4, + // Block 0x3c, offset 0xf00 + 0xf00: 0x43ba, 0xf01: 0x43c0, 0xf03: 0x43c6, 0xf04: 0x43cc, + 0xf06: 0x43d8, 0xf07: 0x43de, 0xf08: 0x43e4, 0xf09: 0x43ea, 0xf0a: 0x43fc, 0xf0b: 0x4378, + 0xf0c: 0x4360, 0xf0d: 0x43a8, 0xf0e: 0x43d2, 0xf0f: 0x1d7f, 0xf10: 0x0299, 0xf11: 0x0299, + 0xf12: 0x02a2, 0xf13: 0x02a2, 0xf14: 0x02a2, 0xf15: 0x02a2, 0xf16: 0x02a5, 0xf17: 0x02a5, + 0xf18: 0x02a5, 0xf19: 0x02a5, 0xf1a: 0x02ab, 0xf1b: 0x02ab, 0xf1c: 0x02ab, 0xf1d: 0x02ab, + 0xf1e: 0x029f, 0xf1f: 0x029f, 0xf20: 0x029f, 0xf21: 0x029f, 0xf22: 0x02a8, 0xf23: 0x02a8, + 0xf24: 0x02a8, 0xf25: 0x02a8, 0xf26: 0x029c, 0xf27: 0x029c, 0xf28: 0x029c, 0xf29: 0x029c, + 0xf2a: 0x02cf, 0xf2b: 0x02cf, 0xf2c: 0x02cf, 0xf2d: 0x02cf, 0xf2e: 0x02d2, 0xf2f: 0x02d2, + 0xf30: 0x02d2, 0xf31: 0x02d2, 0xf32: 0x02b1, 0xf33: 0x02b1, 0xf34: 0x02b1, 0xf35: 0x02b1, + 0xf36: 0x02ae, 0xf37: 0x02ae, 0xf38: 0x02ae, 0xf39: 0x02ae, 0xf3a: 0x02b4, 0xf3b: 0x02b4, + 0xf3c: 0x02b4, 0xf3d: 0x02b4, 0xf3e: 0x02b7, 0xf3f: 0x02b7, + // Block 0x3d, offset 0xf40 + 0xf40: 0x02b7, 0xf41: 0x02b7, 0xf42: 0x02c0, 0xf43: 0x02c0, 0xf44: 0x02bd, 0xf45: 0x02bd, + 0xf46: 0x02c3, 0xf47: 0x02c3, 0xf48: 0x02ba, 0xf49: 0x02ba, 0xf4a: 0x02c9, 0xf4b: 0x02c9, + 0xf4c: 0x02c6, 0xf4d: 0x02c6, 0xf4e: 0x02d5, 0xf4f: 0x02d5, 0xf50: 0x02d5, 0xf51: 0x02d5, + 0xf52: 0x02db, 0xf53: 0x02db, 0xf54: 0x02db, 0xf55: 0x02db, 0xf56: 0x02e1, 0xf57: 0x02e1, + 0xf58: 0x02e1, 0xf59: 0x02e1, 0xf5a: 0x02de, 0xf5b: 0x02de, 0xf5c: 0x02de, 0xf5d: 0x02de, + 0xf5e: 0x02e4, 0xf5f: 0x02e4, 0xf60: 0x02e7, 0xf61: 0x02e7, 0xf62: 0x02e7, 0xf63: 0x02e7, + 0xf64: 0x446e, 0xf65: 0x446e, 0xf66: 0x02ed, 0xf67: 0x02ed, 0xf68: 0x02ed, 0xf69: 0x02ed, + 0xf6a: 0x02ea, 0xf6b: 0x02ea, 0xf6c: 0x02ea, 0xf6d: 0x02ea, 0xf6e: 0x0308, 0xf6f: 0x0308, + 0xf70: 0x4468, 0xf71: 0x4468, + // Block 0x3e, offset 0xf80 + 0xf93: 0x02d8, 0xf94: 0x02d8, 0xf95: 0x02d8, 0xf96: 0x02d8, 0xf97: 0x02f6, + 0xf98: 0x02f6, 0xf99: 0x02f3, 0xf9a: 0x02f3, 0xf9b: 0x02f9, 0xf9c: 0x02f9, 0xf9d: 0x204f, + 0xf9e: 0x02ff, 0xf9f: 0x02ff, 0xfa0: 0x02f0, 0xfa1: 0x02f0, 0xfa2: 0x02fc, 0xfa3: 0x02fc, + 0xfa4: 0x0305, 0xfa5: 0x0305, 0xfa6: 0x0305, 0xfa7: 0x0305, 0xfa8: 0x028d, 0xfa9: 0x028d, + 0xfaa: 0x25aa, 0xfab: 0x25aa, 0xfac: 0x261a, 0xfad: 0x261a, 0xfae: 0x25e9, 0xfaf: 0x25e9, + 0xfb0: 0x2605, 0xfb1: 0x2605, 0xfb2: 0x25fe, 0xfb3: 0x25fe, 0xfb4: 0x260c, 0xfb5: 0x260c, + 0xfb6: 0x2613, 0xfb7: 0x2613, 0xfb8: 0x2613, 0xfb9: 0x25f0, 0xfba: 0x25f0, 0xfbb: 0x25f0, + 0xfbc: 0x0302, 0xfbd: 0x0302, 0xfbe: 0x0302, 0xfbf: 0x0302, + // Block 0x3f, offset 0xfc0 + 0xfc0: 0x25b1, 0xfc1: 0x25b8, 0xfc2: 0x25d4, 0xfc3: 0x25f0, 0xfc4: 0x25f7, 0xfc5: 0x1d89, + 0xfc6: 0x1d8e, 0xfc7: 0x1d93, 0xfc8: 0x1da2, 0xfc9: 0x1db1, 0xfca: 0x1db6, 0xfcb: 0x1dbb, + 0xfcc: 0x1dc0, 0xfcd: 0x1dc5, 0xfce: 0x1dd4, 0xfcf: 0x1de3, 0xfd0: 0x1de8, 0xfd1: 0x1ded, + 0xfd2: 0x1dfc, 0xfd3: 0x1e0b, 0xfd4: 0x1e10, 0xfd5: 0x1e15, 0xfd6: 0x1e1a, 0xfd7: 0x1e29, + 0xfd8: 0x1e2e, 0xfd9: 0x1e3d, 0xfda: 0x1e42, 0xfdb: 0x1e47, 0xfdc: 0x1e56, 0xfdd: 0x1e5b, + 0xfde: 0x1e60, 0xfdf: 0x1e6a, 0xfe0: 0x1ea6, 0xfe1: 0x1eb5, 0xfe2: 0x1ec4, 0xfe3: 0x1ec9, + 0xfe4: 0x1ece, 0xfe5: 0x1ed8, 0xfe6: 0x1ee7, 0xfe7: 0x1eec, 0xfe8: 0x1efb, 0xfe9: 0x1f00, + 0xfea: 0x1f05, 0xfeb: 0x1f14, 0xfec: 0x1f19, 0xfed: 0x1f28, 0xfee: 0x1f2d, 0xfef: 0x1f32, + 0xff0: 0x1f37, 0xff1: 0x1f3c, 0xff2: 0x1f41, 0xff3: 0x1f46, 0xff4: 0x1f4b, 0xff5: 0x1f50, + 0xff6: 0x1f55, 0xff7: 0x1f5a, 0xff8: 0x1f5f, 0xff9: 0x1f64, 0xffa: 0x1f69, 0xffb: 0x1f6e, + 0xffc: 0x1f73, 0xffd: 0x1f78, 0xffe: 0x1f7d, 0xfff: 0x1f87, + // Block 0x40, offset 0x1000 + 0x1000: 0x1f8c, 0x1001: 0x1f91, 0x1002: 0x1f96, 0x1003: 0x1fa0, 0x1004: 0x1fa5, 0x1005: 0x1faf, + 0x1006: 0x1fb4, 0x1007: 0x1fb9, 0x1008: 0x1fbe, 0x1009: 0x1fc3, 0x100a: 0x1fc8, 0x100b: 0x1fcd, + 0x100c: 0x1fd2, 0x100d: 0x1fd7, 0x100e: 0x1fe6, 0x100f: 0x1ff5, 0x1010: 0x1ffa, 0x1011: 0x1fff, + 0x1012: 0x2004, 0x1013: 0x2009, 0x1014: 0x200e, 0x1015: 0x2018, 0x1016: 0x201d, 0x1017: 0x2022, + 0x1018: 0x2031, 0x1019: 0x2040, 0x101a: 0x2045, 0x101b: 0x4420, 0x101c: 0x4426, 0x101d: 0x445c, + 0x101e: 0x44b3, 0x101f: 0x44ba, 0x1020: 0x44c1, 0x1021: 0x44c8, 0x1022: 0x44cf, 0x1023: 0x44d6, + 0x1024: 0x25c6, 0x1025: 0x25cd, 0x1026: 0x25d4, 0x1027: 0x25db, 0x1028: 0x25f0, 0x1029: 0x25f7, + 0x102a: 0x1d98, 0x102b: 0x1d9d, 0x102c: 0x1da2, 0x102d: 0x1da7, 0x102e: 0x1db1, 0x102f: 0x1db6, + 0x1030: 0x1dca, 0x1031: 0x1dcf, 0x1032: 0x1dd4, 0x1033: 0x1dd9, 0x1034: 0x1de3, 0x1035: 0x1de8, + 0x1036: 0x1df2, 0x1037: 0x1df7, 0x1038: 0x1dfc, 0x1039: 0x1e01, 0x103a: 0x1e0b, 0x103b: 0x1e10, + 0x103c: 0x1f3c, 0x103d: 0x1f41, 0x103e: 0x1f50, 0x103f: 0x1f55, + // Block 0x41, offset 0x1040 + 0x1040: 0x1f5a, 0x1041: 0x1f6e, 0x1042: 0x1f73, 0x1043: 0x1f78, 0x1044: 0x1f7d, 0x1045: 0x1f96, + 0x1046: 0x1fa0, 0x1047: 0x1fa5, 0x1048: 0x1faa, 0x1049: 0x1fbe, 0x104a: 0x1fdc, 0x104b: 0x1fe1, + 0x104c: 0x1fe6, 0x104d: 0x1feb, 0x104e: 0x1ff5, 0x104f: 0x1ffa, 0x1050: 0x445c, 0x1051: 0x2027, + 0x1052: 0x202c, 0x1053: 0x2031, 0x1054: 0x2036, 0x1055: 0x2040, 0x1056: 0x2045, 0x1057: 0x25b1, + 0x1058: 0x25b8, 0x1059: 0x25bf, 0x105a: 0x25d4, 0x105b: 0x25e2, 0x105c: 0x1d89, 0x105d: 0x1d8e, + 0x105e: 0x1d93, 0x105f: 0x1da2, 0x1060: 0x1dac, 0x1061: 0x1dbb, 0x1062: 0x1dc0, 0x1063: 0x1dc5, + 0x1064: 0x1dd4, 0x1065: 0x1dde, 0x1066: 0x1dfc, 0x1067: 0x1e15, 0x1068: 0x1e1a, 0x1069: 0x1e29, + 0x106a: 0x1e2e, 0x106b: 0x1e3d, 0x106c: 0x1e47, 0x106d: 0x1e56, 0x106e: 0x1e5b, 0x106f: 0x1e60, + 0x1070: 0x1e6a, 0x1071: 0x1ea6, 0x1072: 0x1eab, 0x1073: 0x1eb5, 0x1074: 0x1ec4, 0x1075: 0x1ec9, + 0x1076: 0x1ece, 0x1077: 0x1ed8, 0x1078: 0x1ee7, 0x1079: 0x1efb, 0x107a: 0x1f00, 0x107b: 0x1f05, + 0x107c: 0x1f14, 0x107d: 0x1f19, 0x107e: 0x1f28, 0x107f: 0x1f2d, + // Block 0x42, offset 0x1080 + 0x1080: 0x1f32, 0x1081: 0x1f37, 0x1082: 0x1f46, 0x1083: 0x1f4b, 0x1084: 0x1f5f, 0x1085: 0x1f64, + 0x1086: 0x1f69, 0x1087: 0x1f6e, 0x1088: 0x1f73, 0x1089: 0x1f87, 0x108a: 0x1f8c, 0x108b: 0x1f91, + 0x108c: 0x1f96, 0x108d: 0x1f9b, 0x108e: 0x1faf, 0x108f: 0x1fb4, 0x1090: 0x1fb9, 0x1091: 0x1fbe, + 0x1092: 0x1fcd, 0x1093: 0x1fd2, 0x1094: 0x1fd7, 0x1095: 0x1fe6, 0x1096: 0x1ff0, 0x1097: 0x1fff, + 0x1098: 0x2004, 0x1099: 0x4450, 0x109a: 0x2018, 0x109b: 0x201d, 0x109c: 0x2022, 0x109d: 0x2031, + 0x109e: 0x203b, 0x109f: 0x25d4, 0x10a0: 0x25e2, 0x10a1: 0x1da2, 0x10a2: 0x1dac, 0x10a3: 0x1dd4, + 0x10a4: 0x1dde, 0x10a5: 0x1dfc, 0x10a6: 0x1e06, 0x10a7: 0x1e6a, 0x10a8: 0x1e6f, 0x10a9: 0x1e92, + 0x10aa: 0x1e97, 0x10ab: 0x1f6e, 0x10ac: 0x1f73, 0x10ad: 0x1f96, 0x10ae: 0x1fe6, 0x10af: 0x1ff0, + 0x10b0: 0x2031, 0x10b1: 0x203b, 0x10b2: 0x4504, 0x10b3: 0x450c, 0x10b4: 0x4514, 0x10b5: 0x1ef1, + 0x10b6: 0x1ef6, 0x10b7: 0x1f0a, 0x10b8: 0x1f0f, 0x10b9: 0x1f1e, 0x10ba: 0x1f23, 0x10bb: 0x1e74, + 0x10bc: 0x1e79, 0x10bd: 0x1e9c, 0x10be: 0x1ea1, 0x10bf: 0x1e33, + // Block 0x43, offset 0x10c0 + 0x10c0: 0x1e38, 0x10c1: 0x1e1f, 0x10c2: 0x1e24, 0x10c3: 0x1e4c, 0x10c4: 0x1e51, 0x10c5: 0x1eba, + 0x10c6: 0x1ebf, 0x10c7: 0x1edd, 0x10c8: 0x1ee2, 0x10c9: 0x1e7e, 0x10ca: 0x1e83, 0x10cb: 0x1e88, + 0x10cc: 0x1e92, 0x10cd: 0x1e8d, 0x10ce: 0x1e65, 0x10cf: 0x1eb0, 0x10d0: 0x1ed3, 0x10d1: 0x1ef1, + 0x10d2: 0x1ef6, 0x10d3: 0x1f0a, 0x10d4: 0x1f0f, 0x10d5: 0x1f1e, 0x10d6: 0x1f23, 0x10d7: 0x1e74, + 0x10d8: 0x1e79, 0x10d9: 0x1e9c, 0x10da: 0x1ea1, 0x10db: 0x1e33, 0x10dc: 0x1e38, 0x10dd: 0x1e1f, + 0x10de: 0x1e24, 0x10df: 0x1e4c, 0x10e0: 0x1e51, 0x10e1: 0x1eba, 0x10e2: 0x1ebf, 0x10e3: 0x1edd, + 0x10e4: 0x1ee2, 0x10e5: 0x1e7e, 0x10e6: 0x1e83, 0x10e7: 0x1e88, 0x10e8: 0x1e92, 0x10e9: 0x1e8d, + 0x10ea: 0x1e65, 0x10eb: 0x1eb0, 0x10ec: 0x1ed3, 0x10ed: 0x1e7e, 0x10ee: 0x1e83, 0x10ef: 0x1e88, + 0x10f0: 0x1e92, 0x10f1: 0x1e6f, 0x10f2: 0x1e97, 0x10f3: 0x1eec, 0x10f4: 0x1e56, 0x10f5: 0x1e5b, + 0x10f6: 0x1e60, 0x10f7: 0x1e7e, 0x10f8: 0x1e83, 0x10f9: 0x1e88, 0x10fa: 0x1eec, 0x10fb: 0x1efb, + 0x10fc: 0x4408, 0x10fd: 0x4408, + // Block 0x44, offset 0x1100 + 0x1110: 0x2311, 0x1111: 0x2326, + 0x1112: 0x2326, 0x1113: 0x232d, 0x1114: 0x2334, 0x1115: 0x2349, 0x1116: 0x2350, 0x1117: 0x2357, + 0x1118: 0x237a, 0x1119: 0x237a, 0x111a: 0x239d, 0x111b: 0x2396, 0x111c: 0x23b2, 0x111d: 0x23a4, + 0x111e: 0x23ab, 0x111f: 0x23ce, 0x1120: 0x23ce, 0x1121: 0x23c7, 0x1122: 0x23d5, 0x1123: 0x23d5, + 0x1124: 0x23ff, 0x1125: 0x23ff, 0x1126: 0x241b, 0x1127: 0x23e3, 0x1128: 0x23e3, 0x1129: 0x23dc, + 0x112a: 0x23f1, 0x112b: 0x23f1, 0x112c: 0x23f8, 0x112d: 0x23f8, 0x112e: 0x2422, 0x112f: 0x2430, + 0x1130: 0x2430, 0x1131: 0x2437, 0x1132: 0x2437, 0x1133: 0x243e, 0x1134: 0x2445, 0x1135: 0x244c, + 0x1136: 0x2453, 0x1137: 0x2453, 0x1138: 0x245a, 0x1139: 0x2468, 0x113a: 0x2476, 0x113b: 0x246f, + 0x113c: 0x247d, 0x113d: 0x247d, 0x113e: 0x2492, 0x113f: 0x2499, + // Block 0x45, offset 0x1140 + 0x1140: 0x24ca, 0x1141: 0x24d8, 0x1142: 0x24d1, 0x1143: 0x24b5, 0x1144: 0x24b5, 0x1145: 0x24df, + 0x1146: 0x24df, 0x1147: 0x24e6, 0x1148: 0x24e6, 0x1149: 0x2510, 0x114a: 0x2517, 0x114b: 0x251e, + 0x114c: 0x24f4, 0x114d: 0x2502, 0x114e: 0x2525, 0x114f: 0x252c, + 0x1152: 0x24fb, 0x1153: 0x2580, 0x1154: 0x2587, 0x1155: 0x255d, 0x1156: 0x2564, 0x1157: 0x2548, + 0x1158: 0x2548, 0x1159: 0x254f, 0x115a: 0x2579, 0x115b: 0x2572, 0x115c: 0x259c, 0x115d: 0x259c, + 0x115e: 0x230a, 0x115f: 0x231f, 0x1160: 0x2318, 0x1161: 0x2342, 0x1162: 0x233b, 0x1163: 0x2365, + 0x1164: 0x235e, 0x1165: 0x2388, 0x1166: 0x236c, 0x1167: 0x2381, 0x1168: 0x23b9, 0x1169: 0x2406, + 0x116a: 0x23ea, 0x116b: 0x2429, 0x116c: 0x24c3, 0x116d: 0x24ed, 0x116e: 0x2595, 0x116f: 0x258e, + 0x1170: 0x25a3, 0x1171: 0x253a, 0x1172: 0x24a0, 0x1173: 0x256b, 0x1174: 0x2492, 0x1175: 0x24ca, + 0x1176: 0x2461, 0x1177: 0x24ae, 0x1178: 0x2541, 0x1179: 0x2533, 0x117a: 0x24bc, 0x117b: 0x24a7, + 0x117c: 0x24bc, 0x117d: 0x2541, 0x117e: 0x2373, 0x117f: 0x238f, + // Block 0x46, offset 0x1180 + 0x1180: 0x2509, 0x1181: 0x2484, 0x1182: 0x2303, 0x1183: 0x24a7, 0x1184: 0x244c, 0x1185: 0x241b, + 0x1186: 0x23c0, 0x1187: 0x2556, + 0x11b0: 0x2414, 0x11b1: 0x248b, 0x11b2: 0x27bf, 0x11b3: 0x27b6, 0x11b4: 0x27ec, 0x11b5: 0x27da, + 0x11b6: 0x27c8, 0x11b7: 0x27e3, 0x11b8: 0x27f5, 0x11b9: 0x240d, 0x11ba: 0x2c7c, 0x11bb: 0x2afc, + 0x11bc: 0x27d1, + // Block 0x47, offset 0x11c0 + 0x11d0: 0x0019, 0x11d1: 0x0483, + 0x11d2: 0x0487, 0x11d3: 0x0035, 0x11d4: 0x0037, 0x11d5: 0x0003, 0x11d6: 0x003f, 0x11d7: 0x04bf, + 0x11d8: 0x04c3, 0x11d9: 0x1b5c, + 0x11e0: 0x8132, 0x11e1: 0x8132, 0x11e2: 0x8132, 0x11e3: 0x8132, + 0x11e4: 0x8132, 0x11e5: 0x8132, 0x11e6: 0x8132, 0x11e7: 0x812d, 0x11e8: 0x812d, 0x11e9: 0x812d, + 0x11ea: 0x812d, 0x11eb: 0x812d, 0x11ec: 0x812d, 0x11ed: 0x812d, 0x11ee: 0x8132, 0x11ef: 0x8132, + 0x11f0: 0x1873, 0x11f1: 0x0443, 0x11f2: 0x043f, 0x11f3: 0x007f, 0x11f4: 0x007f, 0x11f5: 0x0011, + 0x11f6: 0x0013, 0x11f7: 0x00b7, 0x11f8: 0x00bb, 0x11f9: 0x04b7, 0x11fa: 0x04bb, 0x11fb: 0x04ab, + 0x11fc: 0x04af, 0x11fd: 0x0493, 0x11fe: 0x0497, 0x11ff: 0x048b, + // Block 0x48, offset 0x1200 + 0x1200: 0x048f, 0x1201: 0x049b, 0x1202: 0x049f, 0x1203: 0x04a3, 0x1204: 0x04a7, + 0x1207: 0x0077, 0x1208: 0x007b, 0x1209: 0x4269, 0x120a: 0x4269, 0x120b: 0x4269, + 0x120c: 0x4269, 0x120d: 0x007f, 0x120e: 0x007f, 0x120f: 0x007f, 0x1210: 0x0019, 0x1211: 0x0483, + 0x1212: 0x001d, 0x1214: 0x0037, 0x1215: 0x0035, 0x1216: 0x003f, 0x1217: 0x0003, + 0x1218: 0x0443, 0x1219: 0x0011, 0x121a: 0x0013, 0x121b: 0x00b7, 0x121c: 0x00bb, 0x121d: 0x04b7, + 0x121e: 0x04bb, 0x121f: 0x0007, 0x1220: 0x000d, 0x1221: 0x0015, 0x1222: 0x0017, 0x1223: 0x001b, + 0x1224: 0x0039, 0x1225: 0x003d, 0x1226: 0x003b, 0x1228: 0x0079, 0x1229: 0x0009, + 0x122a: 0x000b, 0x122b: 0x0041, + 0x1230: 0x42aa, 0x1231: 0x442c, 0x1232: 0x42af, 0x1234: 0x42b4, + 0x1236: 0x42b9, 0x1237: 0x4432, 0x1238: 0x42be, 0x1239: 0x4438, 0x123a: 0x42c3, 0x123b: 0x443e, + 0x123c: 0x42c8, 0x123d: 0x4444, 0x123e: 0x42cd, 0x123f: 0x444a, + // Block 0x49, offset 0x1240 + 0x1240: 0x0236, 0x1241: 0x440e, 0x1242: 0x440e, 0x1243: 0x4414, 0x1244: 0x4414, 0x1245: 0x4456, + 0x1246: 0x4456, 0x1247: 0x441a, 0x1248: 0x441a, 0x1249: 0x4462, 0x124a: 0x4462, 0x124b: 0x4462, + 0x124c: 0x4462, 0x124d: 0x0239, 0x124e: 0x0239, 0x124f: 0x023c, 0x1250: 0x023c, 0x1251: 0x023c, + 0x1252: 0x023c, 0x1253: 0x023f, 0x1254: 0x023f, 0x1255: 0x0242, 0x1256: 0x0242, 0x1257: 0x0242, + 0x1258: 0x0242, 0x1259: 0x0245, 0x125a: 0x0245, 0x125b: 0x0245, 0x125c: 0x0245, 0x125d: 0x0248, + 0x125e: 0x0248, 0x125f: 0x0248, 0x1260: 0x0248, 0x1261: 0x024b, 0x1262: 0x024b, 0x1263: 0x024b, + 0x1264: 0x024b, 0x1265: 0x024e, 0x1266: 0x024e, 0x1267: 0x024e, 0x1268: 0x024e, 0x1269: 0x0251, + 0x126a: 0x0251, 0x126b: 0x0254, 0x126c: 0x0254, 0x126d: 0x0257, 0x126e: 0x0257, 0x126f: 0x025a, + 0x1270: 0x025a, 0x1271: 0x025d, 0x1272: 0x025d, 0x1273: 0x025d, 0x1274: 0x025d, 0x1275: 0x0260, + 0x1276: 0x0260, 0x1277: 0x0260, 0x1278: 0x0260, 0x1279: 0x0263, 0x127a: 0x0263, 0x127b: 0x0263, + 0x127c: 0x0263, 0x127d: 0x0266, 0x127e: 0x0266, 0x127f: 0x0266, + // Block 0x4a, offset 0x1280 + 0x1280: 0x0266, 0x1281: 0x0269, 0x1282: 0x0269, 0x1283: 0x0269, 0x1284: 0x0269, 0x1285: 0x026c, + 0x1286: 0x026c, 0x1287: 0x026c, 0x1288: 0x026c, 0x1289: 0x026f, 0x128a: 0x026f, 0x128b: 0x026f, + 0x128c: 0x026f, 0x128d: 0x0272, 0x128e: 0x0272, 0x128f: 0x0272, 0x1290: 0x0272, 0x1291: 0x0275, + 0x1292: 0x0275, 0x1293: 0x0275, 0x1294: 0x0275, 0x1295: 0x0278, 0x1296: 0x0278, 0x1297: 0x0278, + 0x1298: 0x0278, 0x1299: 0x027b, 0x129a: 0x027b, 0x129b: 0x027b, 0x129c: 0x027b, 0x129d: 0x027e, + 0x129e: 0x027e, 0x129f: 0x027e, 0x12a0: 0x027e, 0x12a1: 0x0281, 0x12a2: 0x0281, 0x12a3: 0x0281, + 0x12a4: 0x0281, 0x12a5: 0x0284, 0x12a6: 0x0284, 0x12a7: 0x0284, 0x12a8: 0x0284, 0x12a9: 0x0287, + 0x12aa: 0x0287, 0x12ab: 0x0287, 0x12ac: 0x0287, 0x12ad: 0x028a, 0x12ae: 0x028a, 0x12af: 0x028d, + 0x12b0: 0x028d, 0x12b1: 0x0290, 0x12b2: 0x0290, 0x12b3: 0x0290, 0x12b4: 0x0290, 0x12b5: 0x2e00, + 0x12b6: 0x2e00, 0x12b7: 0x2e08, 0x12b8: 0x2e08, 0x12b9: 0x2e10, 0x12ba: 0x2e10, 0x12bb: 0x1f82, + 0x12bc: 0x1f82, + // Block 0x4b, offset 0x12c0 + 0x12c0: 0x0081, 0x12c1: 0x0083, 0x12c2: 0x0085, 0x12c3: 0x0087, 0x12c4: 0x0089, 0x12c5: 0x008b, + 0x12c6: 0x008d, 0x12c7: 0x008f, 0x12c8: 0x0091, 0x12c9: 0x0093, 0x12ca: 0x0095, 0x12cb: 0x0097, + 0x12cc: 0x0099, 0x12cd: 0x009b, 0x12ce: 0x009d, 0x12cf: 0x009f, 0x12d0: 0x00a1, 0x12d1: 0x00a3, + 0x12d2: 0x00a5, 0x12d3: 0x00a7, 0x12d4: 0x00a9, 0x12d5: 0x00ab, 0x12d6: 0x00ad, 0x12d7: 0x00af, + 0x12d8: 0x00b1, 0x12d9: 0x00b3, 0x12da: 0x00b5, 0x12db: 0x00b7, 0x12dc: 0x00b9, 0x12dd: 0x00bb, + 0x12de: 0x00bd, 0x12df: 0x0477, 0x12e0: 0x047b, 0x12e1: 0x0487, 0x12e2: 0x049b, 0x12e3: 0x049f, + 0x12e4: 0x0483, 0x12e5: 0x05ab, 0x12e6: 0x05a3, 0x12e7: 0x04c7, 0x12e8: 0x04cf, 0x12e9: 0x04d7, + 0x12ea: 0x04df, 0x12eb: 0x04e7, 0x12ec: 0x056b, 0x12ed: 0x0573, 0x12ee: 0x057b, 0x12ef: 0x051f, + 0x12f0: 0x05af, 0x12f1: 0x04cb, 0x12f2: 0x04d3, 0x12f3: 0x04db, 0x12f4: 0x04e3, 0x12f5: 0x04eb, + 0x12f6: 0x04ef, 0x12f7: 0x04f3, 0x12f8: 0x04f7, 0x12f9: 0x04fb, 0x12fa: 0x04ff, 0x12fb: 0x0503, + 0x12fc: 0x0507, 0x12fd: 0x050b, 0x12fe: 0x050f, 0x12ff: 0x0513, + // Block 0x4c, offset 0x1300 + 0x1300: 0x0517, 0x1301: 0x051b, 0x1302: 0x0523, 0x1303: 0x0527, 0x1304: 0x052b, 0x1305: 0x052f, + 0x1306: 0x0533, 0x1307: 0x0537, 0x1308: 0x053b, 0x1309: 0x053f, 0x130a: 0x0543, 0x130b: 0x0547, + 0x130c: 0x054b, 0x130d: 0x054f, 0x130e: 0x0553, 0x130f: 0x0557, 0x1310: 0x055b, 0x1311: 0x055f, + 0x1312: 0x0563, 0x1313: 0x0567, 0x1314: 0x056f, 0x1315: 0x0577, 0x1316: 0x057f, 0x1317: 0x0583, + 0x1318: 0x0587, 0x1319: 0x058b, 0x131a: 0x058f, 0x131b: 0x0593, 0x131c: 0x0597, 0x131d: 0x05a7, + 0x131e: 0x4a78, 0x131f: 0x4a7e, 0x1320: 0x03c3, 0x1321: 0x0313, 0x1322: 0x0317, 0x1323: 0x4a3b, + 0x1324: 0x031b, 0x1325: 0x4a41, 0x1326: 0x4a47, 0x1327: 0x031f, 0x1328: 0x0323, 0x1329: 0x0327, + 0x132a: 0x4a4d, 0x132b: 0x4a53, 0x132c: 0x4a59, 0x132d: 0x4a5f, 0x132e: 0x4a65, 0x132f: 0x4a6b, + 0x1330: 0x0367, 0x1331: 0x032b, 0x1332: 0x032f, 0x1333: 0x0333, 0x1334: 0x037b, 0x1335: 0x0337, + 0x1336: 0x033b, 0x1337: 0x033f, 0x1338: 0x0343, 0x1339: 0x0347, 0x133a: 0x034b, 0x133b: 0x034f, + 0x133c: 0x0353, 0x133d: 0x0357, 0x133e: 0x035b, + // Block 0x4d, offset 0x1340 + 0x1342: 0x49bd, 0x1343: 0x49c3, 0x1344: 0x49c9, 0x1345: 0x49cf, + 0x1346: 0x49d5, 0x1347: 0x49db, 0x134a: 0x49e1, 0x134b: 0x49e7, + 0x134c: 0x49ed, 0x134d: 0x49f3, 0x134e: 0x49f9, 0x134f: 0x49ff, + 0x1352: 0x4a05, 0x1353: 0x4a0b, 0x1354: 0x4a11, 0x1355: 0x4a17, 0x1356: 0x4a1d, 0x1357: 0x4a23, + 0x135a: 0x4a29, 0x135b: 0x4a2f, 0x135c: 0x4a35, + 0x1360: 0x00bf, 0x1361: 0x00c2, 0x1362: 0x00cb, 0x1363: 0x4264, + 0x1364: 0x00c8, 0x1365: 0x00c5, 0x1366: 0x0447, 0x1368: 0x046b, 0x1369: 0x044b, + 0x136a: 0x044f, 0x136b: 0x0453, 0x136c: 0x0457, 0x136d: 0x046f, 0x136e: 0x0473, + // Block 0x4e, offset 0x1380 + 0x1380: 0x0063, 0x1381: 0x0065, 0x1382: 0x0067, 0x1383: 0x0069, 0x1384: 0x006b, 0x1385: 0x006d, + 0x1386: 0x006f, 0x1387: 0x0071, 0x1388: 0x0073, 0x1389: 0x0075, 0x138a: 0x0083, 0x138b: 0x0085, + 0x138c: 0x0087, 0x138d: 0x0089, 0x138e: 0x008b, 0x138f: 0x008d, 0x1390: 0x008f, 0x1391: 0x0091, + 0x1392: 0x0093, 0x1393: 0x0095, 0x1394: 0x0097, 0x1395: 0x0099, 0x1396: 0x009b, 0x1397: 0x009d, + 0x1398: 0x009f, 0x1399: 0x00a1, 0x139a: 0x00a3, 0x139b: 0x00a5, 0x139c: 0x00a7, 0x139d: 0x00a9, + 0x139e: 0x00ab, 0x139f: 0x00ad, 0x13a0: 0x00af, 0x13a1: 0x00b1, 0x13a2: 0x00b3, 0x13a3: 0x00b5, + 0x13a4: 0x00dd, 0x13a5: 0x00f2, 0x13a8: 0x0173, 0x13a9: 0x0176, + 0x13aa: 0x0179, 0x13ab: 0x017c, 0x13ac: 0x017f, 0x13ad: 0x0182, 0x13ae: 0x0185, 0x13af: 0x0188, + 0x13b0: 0x018b, 0x13b1: 0x018e, 0x13b2: 0x0191, 0x13b3: 0x0194, 0x13b4: 0x0197, 0x13b5: 0x019a, + 0x13b6: 0x019d, 0x13b7: 0x01a0, 0x13b8: 0x01a3, 0x13b9: 0x0188, 0x13ba: 0x01a6, 0x13bb: 0x01a9, + 0x13bc: 0x01ac, 0x13bd: 0x01af, 0x13be: 0x01b2, 0x13bf: 0x01b5, + // Block 0x4f, offset 0x13c0 + 0x13c0: 0x01fd, 0x13c1: 0x0200, 0x13c2: 0x0203, 0x13c3: 0x045b, 0x13c4: 0x01c7, 0x13c5: 0x01d0, + 0x13c6: 0x01d6, 0x13c7: 0x01fa, 0x13c8: 0x01eb, 0x13c9: 0x01e8, 0x13ca: 0x0206, 0x13cb: 0x0209, + 0x13ce: 0x0021, 0x13cf: 0x0023, 0x13d0: 0x0025, 0x13d1: 0x0027, + 0x13d2: 0x0029, 0x13d3: 0x002b, 0x13d4: 0x002d, 0x13d5: 0x002f, 0x13d6: 0x0031, 0x13d7: 0x0033, + 0x13d8: 0x0021, 0x13d9: 0x0023, 0x13da: 0x0025, 0x13db: 0x0027, 0x13dc: 0x0029, 0x13dd: 0x002b, + 0x13de: 0x002d, 0x13df: 0x002f, 0x13e0: 0x0031, 0x13e1: 0x0033, 0x13e2: 0x0021, 0x13e3: 0x0023, + 0x13e4: 0x0025, 0x13e5: 0x0027, 0x13e6: 0x0029, 0x13e7: 0x002b, 0x13e8: 0x002d, 0x13e9: 0x002f, + 0x13ea: 0x0031, 0x13eb: 0x0033, 0x13ec: 0x0021, 0x13ed: 0x0023, 0x13ee: 0x0025, 0x13ef: 0x0027, + 0x13f0: 0x0029, 0x13f1: 0x002b, 0x13f2: 0x002d, 0x13f3: 0x002f, 0x13f4: 0x0031, 0x13f5: 0x0033, + 0x13f6: 0x0021, 0x13f7: 0x0023, 0x13f8: 0x0025, 0x13f9: 0x0027, 0x13fa: 0x0029, 0x13fb: 0x002b, + 0x13fc: 0x002d, 0x13fd: 0x002f, 0x13fe: 0x0031, 0x13ff: 0x0033, + // Block 0x50, offset 0x1400 + 0x1400: 0x0239, 0x1401: 0x023c, 0x1402: 0x0248, 0x1403: 0x0251, 0x1405: 0x028a, + 0x1406: 0x025a, 0x1407: 0x024b, 0x1408: 0x0269, 0x1409: 0x0290, 0x140a: 0x027b, 0x140b: 0x027e, + 0x140c: 0x0281, 0x140d: 0x0284, 0x140e: 0x025d, 0x140f: 0x026f, 0x1410: 0x0275, 0x1411: 0x0263, + 0x1412: 0x0278, 0x1413: 0x0257, 0x1414: 0x0260, 0x1415: 0x0242, 0x1416: 0x0245, 0x1417: 0x024e, + 0x1418: 0x0254, 0x1419: 0x0266, 0x141a: 0x026c, 0x141b: 0x0272, 0x141c: 0x0293, 0x141d: 0x02e4, + 0x141e: 0x02cc, 0x141f: 0x0296, 0x1421: 0x023c, 0x1422: 0x0248, + 0x1424: 0x0287, 0x1427: 0x024b, 0x1429: 0x0290, + 0x142a: 0x027b, 0x142b: 0x027e, 0x142c: 0x0281, 0x142d: 0x0284, 0x142e: 0x025d, 0x142f: 0x026f, + 0x1430: 0x0275, 0x1431: 0x0263, 0x1432: 0x0278, 0x1434: 0x0260, 0x1435: 0x0242, + 0x1436: 0x0245, 0x1437: 0x024e, 0x1439: 0x0266, 0x143b: 0x0272, + // Block 0x51, offset 0x1440 + 0x1442: 0x0248, + 0x1447: 0x024b, 0x1449: 0x0290, 0x144b: 0x027e, + 0x144d: 0x0284, 0x144e: 0x025d, 0x144f: 0x026f, 0x1451: 0x0263, + 0x1452: 0x0278, 0x1454: 0x0260, 0x1457: 0x024e, + 0x1459: 0x0266, 0x145b: 0x0272, 0x145d: 0x02e4, + 0x145f: 0x0296, 0x1461: 0x023c, 0x1462: 0x0248, + 0x1464: 0x0287, 0x1467: 0x024b, 0x1468: 0x0269, 0x1469: 0x0290, + 0x146a: 0x027b, 0x146c: 0x0281, 0x146d: 0x0284, 0x146e: 0x025d, 0x146f: 0x026f, + 0x1470: 0x0275, 0x1471: 0x0263, 0x1472: 0x0278, 0x1474: 0x0260, 0x1475: 0x0242, + 0x1476: 0x0245, 0x1477: 0x024e, 0x1479: 0x0266, 0x147a: 0x026c, 0x147b: 0x0272, + 0x147c: 0x0293, 0x147e: 0x02cc, + // Block 0x52, offset 0x1480 + 0x1480: 0x0239, 0x1481: 0x023c, 0x1482: 0x0248, 0x1483: 0x0251, 0x1484: 0x0287, 0x1485: 0x028a, + 0x1486: 0x025a, 0x1487: 0x024b, 0x1488: 0x0269, 0x1489: 0x0290, 0x148b: 0x027e, + 0x148c: 0x0281, 0x148d: 0x0284, 0x148e: 0x025d, 0x148f: 0x026f, 0x1490: 0x0275, 0x1491: 0x0263, + 0x1492: 0x0278, 0x1493: 0x0257, 0x1494: 0x0260, 0x1495: 0x0242, 0x1496: 0x0245, 0x1497: 0x024e, + 0x1498: 0x0254, 0x1499: 0x0266, 0x149a: 0x026c, 0x149b: 0x0272, + 0x14a1: 0x023c, 0x14a2: 0x0248, 0x14a3: 0x0251, + 0x14a5: 0x028a, 0x14a6: 0x025a, 0x14a7: 0x024b, 0x14a8: 0x0269, 0x14a9: 0x0290, + 0x14ab: 0x027e, 0x14ac: 0x0281, 0x14ad: 0x0284, 0x14ae: 0x025d, 0x14af: 0x026f, + 0x14b0: 0x0275, 0x14b1: 0x0263, 0x14b2: 0x0278, 0x14b3: 0x0257, 0x14b4: 0x0260, 0x14b5: 0x0242, + 0x14b6: 0x0245, 0x14b7: 0x024e, 0x14b8: 0x0254, 0x14b9: 0x0266, 0x14ba: 0x026c, 0x14bb: 0x0272, + // Block 0x53, offset 0x14c0 + 0x14c0: 0x1879, 0x14c1: 0x1876, 0x14c2: 0x187c, 0x14c3: 0x18a0, 0x14c4: 0x18c4, 0x14c5: 0x18e8, + 0x14c6: 0x190c, 0x14c7: 0x1915, 0x14c8: 0x191b, 0x14c9: 0x1921, 0x14ca: 0x1927, + 0x14d0: 0x1a8c, 0x14d1: 0x1a90, + 0x14d2: 0x1a94, 0x14d3: 0x1a98, 0x14d4: 0x1a9c, 0x14d5: 0x1aa0, 0x14d6: 0x1aa4, 0x14d7: 0x1aa8, + 0x14d8: 0x1aac, 0x14d9: 0x1ab0, 0x14da: 0x1ab4, 0x14db: 0x1ab8, 0x14dc: 0x1abc, 0x14dd: 0x1ac0, + 0x14de: 0x1ac4, 0x14df: 0x1ac8, 0x14e0: 0x1acc, 0x14e1: 0x1ad0, 0x14e2: 0x1ad4, 0x14e3: 0x1ad8, + 0x14e4: 0x1adc, 0x14e5: 0x1ae0, 0x14e6: 0x1ae4, 0x14e7: 0x1ae8, 0x14e8: 0x1aec, 0x14e9: 0x1af0, + 0x14ea: 0x271e, 0x14eb: 0x0047, 0x14ec: 0x0065, 0x14ed: 0x193c, 0x14ee: 0x19b1, + 0x14f0: 0x0043, 0x14f1: 0x0045, 0x14f2: 0x0047, 0x14f3: 0x0049, 0x14f4: 0x004b, 0x14f5: 0x004d, + 0x14f6: 0x004f, 0x14f7: 0x0051, 0x14f8: 0x0053, 0x14f9: 0x0055, 0x14fa: 0x0057, 0x14fb: 0x0059, + 0x14fc: 0x005b, 0x14fd: 0x005d, 0x14fe: 0x005f, 0x14ff: 0x0061, + // Block 0x54, offset 0x1500 + 0x1500: 0x26ad, 0x1501: 0x26c2, 0x1502: 0x0503, + 0x1510: 0x0c0f, 0x1511: 0x0a47, + 0x1512: 0x08d3, 0x1513: 0x45c4, 0x1514: 0x071b, 0x1515: 0x09ef, 0x1516: 0x132f, 0x1517: 0x09ff, + 0x1518: 0x0727, 0x1519: 0x0cd7, 0x151a: 0x0eaf, 0x151b: 0x0caf, 0x151c: 0x0827, 0x151d: 0x0b6b, + 0x151e: 0x07bf, 0x151f: 0x0cb7, 0x1520: 0x0813, 0x1521: 0x1117, 0x1522: 0x0f83, 0x1523: 0x138b, + 0x1524: 0x09d3, 0x1525: 0x090b, 0x1526: 0x0e63, 0x1527: 0x0c1b, 0x1528: 0x0c47, 0x1529: 0x06bf, + 0x152a: 0x06cb, 0x152b: 0x140b, 0x152c: 0x0adb, 0x152d: 0x06e7, 0x152e: 0x08ef, 0x152f: 0x0c3b, + 0x1530: 0x13b3, 0x1531: 0x0c13, 0x1532: 0x106f, 0x1533: 0x10ab, 0x1534: 0x08f7, 0x1535: 0x0e43, + 0x1536: 0x0d0b, 0x1537: 0x0d07, 0x1538: 0x0f97, 0x1539: 0x082b, 0x153a: 0x0957, 0x153b: 0x1443, + // Block 0x55, offset 0x1540 + 0x1540: 0x06fb, 0x1541: 0x06f3, 0x1542: 0x0703, 0x1543: 0x1647, 0x1544: 0x0747, 0x1545: 0x0757, + 0x1546: 0x075b, 0x1547: 0x0763, 0x1548: 0x076b, 0x1549: 0x076f, 0x154a: 0x077b, 0x154b: 0x0773, + 0x154c: 0x05b3, 0x154d: 0x165b, 0x154e: 0x078f, 0x154f: 0x0793, 0x1550: 0x0797, 0x1551: 0x07b3, + 0x1552: 0x164c, 0x1553: 0x05b7, 0x1554: 0x079f, 0x1555: 0x07bf, 0x1556: 0x1656, 0x1557: 0x07cf, + 0x1558: 0x07d7, 0x1559: 0x0737, 0x155a: 0x07df, 0x155b: 0x07e3, 0x155c: 0x1831, 0x155d: 0x07ff, + 0x155e: 0x0807, 0x155f: 0x05bf, 0x1560: 0x081f, 0x1561: 0x0823, 0x1562: 0x082b, 0x1563: 0x082f, + 0x1564: 0x05c3, 0x1565: 0x0847, 0x1566: 0x084b, 0x1567: 0x0857, 0x1568: 0x0863, 0x1569: 0x0867, + 0x156a: 0x086b, 0x156b: 0x0873, 0x156c: 0x0893, 0x156d: 0x0897, 0x156e: 0x089f, 0x156f: 0x08af, + 0x1570: 0x08b7, 0x1571: 0x08bb, 0x1572: 0x08bb, 0x1573: 0x08bb, 0x1574: 0x166a, 0x1575: 0x0e93, + 0x1576: 0x08cf, 0x1577: 0x08d7, 0x1578: 0x166f, 0x1579: 0x08e3, 0x157a: 0x08eb, 0x157b: 0x08f3, + 0x157c: 0x091b, 0x157d: 0x0907, 0x157e: 0x0913, 0x157f: 0x0917, + // Block 0x56, offset 0x1580 + 0x1580: 0x091f, 0x1581: 0x0927, 0x1582: 0x092b, 0x1583: 0x0933, 0x1584: 0x093b, 0x1585: 0x093f, + 0x1586: 0x093f, 0x1587: 0x0947, 0x1588: 0x094f, 0x1589: 0x0953, 0x158a: 0x095f, 0x158b: 0x0983, + 0x158c: 0x0967, 0x158d: 0x0987, 0x158e: 0x096b, 0x158f: 0x0973, 0x1590: 0x080b, 0x1591: 0x09cf, + 0x1592: 0x0997, 0x1593: 0x099b, 0x1594: 0x099f, 0x1595: 0x0993, 0x1596: 0x09a7, 0x1597: 0x09a3, + 0x1598: 0x09bb, 0x1599: 0x1674, 0x159a: 0x09d7, 0x159b: 0x09db, 0x159c: 0x09e3, 0x159d: 0x09ef, + 0x159e: 0x09f7, 0x159f: 0x0a13, 0x15a0: 0x1679, 0x15a1: 0x167e, 0x15a2: 0x0a1f, 0x15a3: 0x0a23, + 0x15a4: 0x0a27, 0x15a5: 0x0a1b, 0x15a6: 0x0a2f, 0x15a7: 0x05c7, 0x15a8: 0x05cb, 0x15a9: 0x0a37, + 0x15aa: 0x0a3f, 0x15ab: 0x0a3f, 0x15ac: 0x1683, 0x15ad: 0x0a5b, 0x15ae: 0x0a5f, 0x15af: 0x0a63, + 0x15b0: 0x0a6b, 0x15b1: 0x1688, 0x15b2: 0x0a73, 0x15b3: 0x0a77, 0x15b4: 0x0b4f, 0x15b5: 0x0a7f, + 0x15b6: 0x05cf, 0x15b7: 0x0a8b, 0x15b8: 0x0a9b, 0x15b9: 0x0aa7, 0x15ba: 0x0aa3, 0x15bb: 0x1692, + 0x15bc: 0x0aaf, 0x15bd: 0x1697, 0x15be: 0x0abb, 0x15bf: 0x0ab7, + // Block 0x57, offset 0x15c0 + 0x15c0: 0x0abf, 0x15c1: 0x0acf, 0x15c2: 0x0ad3, 0x15c3: 0x05d3, 0x15c4: 0x0ae3, 0x15c5: 0x0aeb, + 0x15c6: 0x0aef, 0x15c7: 0x0af3, 0x15c8: 0x05d7, 0x15c9: 0x169c, 0x15ca: 0x05db, 0x15cb: 0x0b0f, + 0x15cc: 0x0b13, 0x15cd: 0x0b17, 0x15ce: 0x0b1f, 0x15cf: 0x1863, 0x15d0: 0x0b37, 0x15d1: 0x16a6, + 0x15d2: 0x16a6, 0x15d3: 0x11d7, 0x15d4: 0x0b47, 0x15d5: 0x0b47, 0x15d6: 0x05df, 0x15d7: 0x16c9, + 0x15d8: 0x179b, 0x15d9: 0x0b57, 0x15da: 0x0b5f, 0x15db: 0x05e3, 0x15dc: 0x0b73, 0x15dd: 0x0b83, + 0x15de: 0x0b87, 0x15df: 0x0b8f, 0x15e0: 0x0b9f, 0x15e1: 0x05eb, 0x15e2: 0x05e7, 0x15e3: 0x0ba3, + 0x15e4: 0x16ab, 0x15e5: 0x0ba7, 0x15e6: 0x0bbb, 0x15e7: 0x0bbf, 0x15e8: 0x0bc3, 0x15e9: 0x0bbf, + 0x15ea: 0x0bcf, 0x15eb: 0x0bd3, 0x15ec: 0x0be3, 0x15ed: 0x0bdb, 0x15ee: 0x0bdf, 0x15ef: 0x0be7, + 0x15f0: 0x0beb, 0x15f1: 0x0bef, 0x15f2: 0x0bfb, 0x15f3: 0x0bff, 0x15f4: 0x0c17, 0x15f5: 0x0c1f, + 0x15f6: 0x0c2f, 0x15f7: 0x0c43, 0x15f8: 0x16ba, 0x15f9: 0x0c3f, 0x15fa: 0x0c33, 0x15fb: 0x0c4b, + 0x15fc: 0x0c53, 0x15fd: 0x0c67, 0x15fe: 0x16bf, 0x15ff: 0x0c6f, + // Block 0x58, offset 0x1600 + 0x1600: 0x0c63, 0x1601: 0x0c5b, 0x1602: 0x05ef, 0x1603: 0x0c77, 0x1604: 0x0c7f, 0x1605: 0x0c87, + 0x1606: 0x0c7b, 0x1607: 0x05f3, 0x1608: 0x0c97, 0x1609: 0x0c9f, 0x160a: 0x16c4, 0x160b: 0x0ccb, + 0x160c: 0x0cff, 0x160d: 0x0cdb, 0x160e: 0x05ff, 0x160f: 0x0ce7, 0x1610: 0x05fb, 0x1611: 0x05f7, + 0x1612: 0x07c3, 0x1613: 0x07c7, 0x1614: 0x0d03, 0x1615: 0x0ceb, 0x1616: 0x11ab, 0x1617: 0x0663, + 0x1618: 0x0d0f, 0x1619: 0x0d13, 0x161a: 0x0d17, 0x161b: 0x0d2b, 0x161c: 0x0d23, 0x161d: 0x16dd, + 0x161e: 0x0603, 0x161f: 0x0d3f, 0x1620: 0x0d33, 0x1621: 0x0d4f, 0x1622: 0x0d57, 0x1623: 0x16e7, + 0x1624: 0x0d5b, 0x1625: 0x0d47, 0x1626: 0x0d63, 0x1627: 0x0607, 0x1628: 0x0d67, 0x1629: 0x0d6b, + 0x162a: 0x0d6f, 0x162b: 0x0d7b, 0x162c: 0x16ec, 0x162d: 0x0d83, 0x162e: 0x060b, 0x162f: 0x0d8f, + 0x1630: 0x16f1, 0x1631: 0x0d93, 0x1632: 0x060f, 0x1633: 0x0d9f, 0x1634: 0x0dab, 0x1635: 0x0db7, + 0x1636: 0x0dbb, 0x1637: 0x16f6, 0x1638: 0x168d, 0x1639: 0x16fb, 0x163a: 0x0ddb, 0x163b: 0x1700, + 0x163c: 0x0de7, 0x163d: 0x0def, 0x163e: 0x0ddf, 0x163f: 0x0dfb, + // Block 0x59, offset 0x1640 + 0x1640: 0x0e0b, 0x1641: 0x0e1b, 0x1642: 0x0e0f, 0x1643: 0x0e13, 0x1644: 0x0e1f, 0x1645: 0x0e23, + 0x1646: 0x1705, 0x1647: 0x0e07, 0x1648: 0x0e3b, 0x1649: 0x0e3f, 0x164a: 0x0613, 0x164b: 0x0e53, + 0x164c: 0x0e4f, 0x164d: 0x170a, 0x164e: 0x0e33, 0x164f: 0x0e6f, 0x1650: 0x170f, 0x1651: 0x1714, + 0x1652: 0x0e73, 0x1653: 0x0e87, 0x1654: 0x0e83, 0x1655: 0x0e7f, 0x1656: 0x0617, 0x1657: 0x0e8b, + 0x1658: 0x0e9b, 0x1659: 0x0e97, 0x165a: 0x0ea3, 0x165b: 0x1651, 0x165c: 0x0eb3, 0x165d: 0x1719, + 0x165e: 0x0ebf, 0x165f: 0x1723, 0x1660: 0x0ed3, 0x1661: 0x0edf, 0x1662: 0x0ef3, 0x1663: 0x1728, + 0x1664: 0x0f07, 0x1665: 0x0f0b, 0x1666: 0x172d, 0x1667: 0x1732, 0x1668: 0x0f27, 0x1669: 0x0f37, + 0x166a: 0x061b, 0x166b: 0x0f3b, 0x166c: 0x061f, 0x166d: 0x061f, 0x166e: 0x0f53, 0x166f: 0x0f57, + 0x1670: 0x0f5f, 0x1671: 0x0f63, 0x1672: 0x0f6f, 0x1673: 0x0623, 0x1674: 0x0f87, 0x1675: 0x1737, + 0x1676: 0x0fa3, 0x1677: 0x173c, 0x1678: 0x0faf, 0x1679: 0x16a1, 0x167a: 0x0fbf, 0x167b: 0x1741, + 0x167c: 0x1746, 0x167d: 0x174b, 0x167e: 0x0627, 0x167f: 0x062b, + // Block 0x5a, offset 0x1680 + 0x1680: 0x0ff7, 0x1681: 0x1755, 0x1682: 0x1750, 0x1683: 0x175a, 0x1684: 0x175f, 0x1685: 0x0fff, + 0x1686: 0x1003, 0x1687: 0x1003, 0x1688: 0x100b, 0x1689: 0x0633, 0x168a: 0x100f, 0x168b: 0x0637, + 0x168c: 0x063b, 0x168d: 0x1769, 0x168e: 0x1023, 0x168f: 0x102b, 0x1690: 0x1037, 0x1691: 0x063f, + 0x1692: 0x176e, 0x1693: 0x105b, 0x1694: 0x1773, 0x1695: 0x1778, 0x1696: 0x107b, 0x1697: 0x1093, + 0x1698: 0x0643, 0x1699: 0x109b, 0x169a: 0x109f, 0x169b: 0x10a3, 0x169c: 0x177d, 0x169d: 0x1782, + 0x169e: 0x1782, 0x169f: 0x10bb, 0x16a0: 0x0647, 0x16a1: 0x1787, 0x16a2: 0x10cf, 0x16a3: 0x10d3, + 0x16a4: 0x064b, 0x16a5: 0x178c, 0x16a6: 0x10ef, 0x16a7: 0x064f, 0x16a8: 0x10ff, 0x16a9: 0x10f7, + 0x16aa: 0x1107, 0x16ab: 0x1796, 0x16ac: 0x111f, 0x16ad: 0x0653, 0x16ae: 0x112b, 0x16af: 0x1133, + 0x16b0: 0x1143, 0x16b1: 0x0657, 0x16b2: 0x17a0, 0x16b3: 0x17a5, 0x16b4: 0x065b, 0x16b5: 0x17aa, + 0x16b6: 0x115b, 0x16b7: 0x17af, 0x16b8: 0x1167, 0x16b9: 0x1173, 0x16ba: 0x117b, 0x16bb: 0x17b4, + 0x16bc: 0x17b9, 0x16bd: 0x118f, 0x16be: 0x17be, 0x16bf: 0x1197, + // Block 0x5b, offset 0x16c0 + 0x16c0: 0x16ce, 0x16c1: 0x065f, 0x16c2: 0x11af, 0x16c3: 0x11b3, 0x16c4: 0x0667, 0x16c5: 0x11b7, + 0x16c6: 0x0a33, 0x16c7: 0x17c3, 0x16c8: 0x17c8, 0x16c9: 0x16d3, 0x16ca: 0x16d8, 0x16cb: 0x11d7, + 0x16cc: 0x11db, 0x16cd: 0x13f3, 0x16ce: 0x066b, 0x16cf: 0x1207, 0x16d0: 0x1203, 0x16d1: 0x120b, + 0x16d2: 0x083f, 0x16d3: 0x120f, 0x16d4: 0x1213, 0x16d5: 0x1217, 0x16d6: 0x121f, 0x16d7: 0x17cd, + 0x16d8: 0x121b, 0x16d9: 0x1223, 0x16da: 0x1237, 0x16db: 0x123b, 0x16dc: 0x1227, 0x16dd: 0x123f, + 0x16de: 0x1253, 0x16df: 0x1267, 0x16e0: 0x1233, 0x16e1: 0x1247, 0x16e2: 0x124b, 0x16e3: 0x124f, + 0x16e4: 0x17d2, 0x16e5: 0x17dc, 0x16e6: 0x17d7, 0x16e7: 0x066f, 0x16e8: 0x126f, 0x16e9: 0x1273, + 0x16ea: 0x127b, 0x16eb: 0x17f0, 0x16ec: 0x127f, 0x16ed: 0x17e1, 0x16ee: 0x0673, 0x16ef: 0x0677, + 0x16f0: 0x17e6, 0x16f1: 0x17eb, 0x16f2: 0x067b, 0x16f3: 0x129f, 0x16f4: 0x12a3, 0x16f5: 0x12a7, + 0x16f6: 0x12ab, 0x16f7: 0x12b7, 0x16f8: 0x12b3, 0x16f9: 0x12bf, 0x16fa: 0x12bb, 0x16fb: 0x12cb, + 0x16fc: 0x12c3, 0x16fd: 0x12c7, 0x16fe: 0x12cf, 0x16ff: 0x067f, + // Block 0x5c, offset 0x1700 + 0x1700: 0x12d7, 0x1701: 0x12db, 0x1702: 0x0683, 0x1703: 0x12eb, 0x1704: 0x12ef, 0x1705: 0x17f5, + 0x1706: 0x12fb, 0x1707: 0x12ff, 0x1708: 0x0687, 0x1709: 0x130b, 0x170a: 0x05bb, 0x170b: 0x17fa, + 0x170c: 0x17ff, 0x170d: 0x068b, 0x170e: 0x068f, 0x170f: 0x1337, 0x1710: 0x134f, 0x1711: 0x136b, + 0x1712: 0x137b, 0x1713: 0x1804, 0x1714: 0x138f, 0x1715: 0x1393, 0x1716: 0x13ab, 0x1717: 0x13b7, + 0x1718: 0x180e, 0x1719: 0x1660, 0x171a: 0x13c3, 0x171b: 0x13bf, 0x171c: 0x13cb, 0x171d: 0x1665, + 0x171e: 0x13d7, 0x171f: 0x13e3, 0x1720: 0x1813, 0x1721: 0x1818, 0x1722: 0x1423, 0x1723: 0x142f, + 0x1724: 0x1437, 0x1725: 0x181d, 0x1726: 0x143b, 0x1727: 0x1467, 0x1728: 0x1473, 0x1729: 0x1477, + 0x172a: 0x146f, 0x172b: 0x1483, 0x172c: 0x1487, 0x172d: 0x1822, 0x172e: 0x1493, 0x172f: 0x0693, + 0x1730: 0x149b, 0x1731: 0x1827, 0x1732: 0x0697, 0x1733: 0x14d3, 0x1734: 0x0ac3, 0x1735: 0x14eb, + 0x1736: 0x182c, 0x1737: 0x1836, 0x1738: 0x069b, 0x1739: 0x069f, 0x173a: 0x1513, 0x173b: 0x183b, + 0x173c: 0x06a3, 0x173d: 0x1840, 0x173e: 0x152b, 0x173f: 0x152b, + // Block 0x5d, offset 0x1740 + 0x1740: 0x1533, 0x1741: 0x1845, 0x1742: 0x154b, 0x1743: 0x06a7, 0x1744: 0x155b, 0x1745: 0x1567, + 0x1746: 0x156f, 0x1747: 0x1577, 0x1748: 0x06ab, 0x1749: 0x184a, 0x174a: 0x158b, 0x174b: 0x15a7, + 0x174c: 0x15b3, 0x174d: 0x06af, 0x174e: 0x06b3, 0x174f: 0x15b7, 0x1750: 0x184f, 0x1751: 0x06b7, + 0x1752: 0x1854, 0x1753: 0x1859, 0x1754: 0x185e, 0x1755: 0x15db, 0x1756: 0x06bb, 0x1757: 0x15ef, + 0x1758: 0x15f7, 0x1759: 0x15fb, 0x175a: 0x1603, 0x175b: 0x160b, 0x175c: 0x1613, 0x175d: 0x1868, +} + +// nfkcIndex: 22 blocks, 1408 entries, 1408 bytes +// Block 0 is the zero block. +var nfkcIndex = [1408]uint8{ + // Block 0x0, offset 0x0 + // Block 0x1, offset 0x40 + // Block 0x2, offset 0x80 + // Block 0x3, offset 0xc0 + 0xc2: 0x5c, 0xc3: 0x01, 0xc4: 0x02, 0xc5: 0x03, 0xc6: 0x5d, 0xc7: 0x04, + 0xc8: 0x05, 0xca: 0x5e, 0xcb: 0x5f, 0xcc: 0x06, 0xcd: 0x07, 0xce: 0x08, 0xcf: 0x09, + 0xd0: 0x0a, 0xd1: 0x60, 0xd2: 0x61, 0xd3: 0x0b, 0xd6: 0x0c, 0xd7: 0x62, + 0xd8: 0x63, 0xd9: 0x0d, 0xdb: 0x64, 0xdc: 0x65, 0xdd: 0x66, 0xdf: 0x67, + 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, + 0xea: 0x06, 0xeb: 0x07, 0xec: 0x08, 0xed: 0x09, 0xef: 0x0a, + 0xf0: 0x13, + // Block 0x4, offset 0x100 + 0x120: 0x68, 0x121: 0x69, 0x123: 0x0e, 0x124: 0x6a, 0x125: 0x6b, 0x126: 0x6c, 0x127: 0x6d, + 0x128: 0x6e, 0x129: 0x6f, 0x12a: 0x70, 0x12b: 0x71, 0x12c: 0x6c, 0x12d: 0x72, 0x12e: 0x73, 0x12f: 0x74, + 0x131: 0x75, 0x132: 0x76, 0x133: 0x77, 0x134: 0x78, 0x135: 0x79, 0x137: 0x7a, + 0x138: 0x7b, 0x139: 0x7c, 0x13a: 0x7d, 0x13b: 0x7e, 0x13c: 0x7f, 0x13d: 0x80, 0x13e: 0x81, 0x13f: 0x82, + // Block 0x5, offset 0x140 + 0x140: 0x83, 0x142: 0x84, 0x143: 0x85, 0x144: 0x86, 0x145: 0x87, 0x146: 0x88, 0x147: 0x89, + 0x14d: 0x8a, + 0x15c: 0x8b, 0x15f: 0x8c, + 0x162: 0x8d, 0x164: 0x8e, + 0x168: 0x8f, 0x169: 0x90, 0x16a: 0x91, 0x16c: 0x0f, 0x16d: 0x92, 0x16e: 0x93, 0x16f: 0x94, + 0x170: 0x95, 0x173: 0x96, 0x174: 0x97, 0x175: 0x10, 0x176: 0x11, 0x177: 0x12, + 0x178: 0x13, 0x179: 0x14, 0x17a: 0x15, 0x17b: 0x16, 0x17c: 0x17, 0x17d: 0x18, 0x17e: 0x19, 0x17f: 0x1a, + // Block 0x6, offset 0x180 + 0x180: 0x98, 0x181: 0x99, 0x182: 0x9a, 0x183: 0x9b, 0x184: 0x1b, 0x185: 0x1c, 0x186: 0x9c, 0x187: 0x9d, + 0x188: 0x9e, 0x189: 0x1d, 0x18a: 0x1e, 0x18b: 0x9f, 0x18c: 0xa0, + 0x191: 0x1f, 0x192: 0x20, 0x193: 0xa1, + 0x1a8: 0xa2, 0x1a9: 0xa3, 0x1ab: 0xa4, + 0x1b1: 0xa5, 0x1b3: 0xa6, 0x1b5: 0xa7, 0x1b7: 0xa8, + 0x1ba: 0xa9, 0x1bb: 0xaa, 0x1bc: 0x21, 0x1bd: 0x22, 0x1be: 0x23, 0x1bf: 0xab, + // Block 0x7, offset 0x1c0 + 0x1c0: 0xac, 0x1c1: 0x24, 0x1c2: 0x25, 0x1c3: 0x26, 0x1c4: 0xad, 0x1c5: 0x27, 0x1c6: 0x28, + 0x1c8: 0x29, 0x1c9: 0x2a, 0x1ca: 0x2b, 0x1cb: 0x2c, 0x1cc: 0x2d, 0x1cd: 0x2e, 0x1ce: 0x2f, 0x1cf: 0x30, + // Block 0x8, offset 0x200 + 0x219: 0xae, 0x21a: 0xaf, 0x21b: 0xb0, 0x21d: 0xb1, 0x21f: 0xb2, + 0x220: 0xb3, 0x223: 0xb4, 0x224: 0xb5, 0x225: 0xb6, 0x226: 0xb7, 0x227: 0xb8, + 0x22a: 0xb9, 0x22b: 0xba, 0x22d: 0xbb, 0x22f: 0xbc, + 0x230: 0xbd, 0x231: 0xbe, 0x232: 0xbf, 0x233: 0xc0, 0x234: 0xc1, 0x235: 0xc2, 0x236: 0xc3, 0x237: 0xbd, + 0x238: 0xbe, 0x239: 0xbf, 0x23a: 0xc0, 0x23b: 0xc1, 0x23c: 0xc2, 0x23d: 0xc3, 0x23e: 0xbd, 0x23f: 0xbe, + // Block 0x9, offset 0x240 + 0x240: 0xbf, 0x241: 0xc0, 0x242: 0xc1, 0x243: 0xc2, 0x244: 0xc3, 0x245: 0xbd, 0x246: 0xbe, 0x247: 0xbf, + 0x248: 0xc0, 0x249: 0xc1, 0x24a: 0xc2, 0x24b: 0xc3, 0x24c: 0xbd, 0x24d: 0xbe, 0x24e: 0xbf, 0x24f: 0xc0, + 0x250: 0xc1, 0x251: 0xc2, 0x252: 0xc3, 0x253: 0xbd, 0x254: 0xbe, 0x255: 0xbf, 0x256: 0xc0, 0x257: 0xc1, + 0x258: 0xc2, 0x259: 0xc3, 0x25a: 0xbd, 0x25b: 0xbe, 0x25c: 0xbf, 0x25d: 0xc0, 0x25e: 0xc1, 0x25f: 0xc2, + 0x260: 0xc3, 0x261: 0xbd, 0x262: 0xbe, 0x263: 0xbf, 0x264: 0xc0, 0x265: 0xc1, 0x266: 0xc2, 0x267: 0xc3, + 0x268: 0xbd, 0x269: 0xbe, 0x26a: 0xbf, 0x26b: 0xc0, 0x26c: 0xc1, 0x26d: 0xc2, 0x26e: 0xc3, 0x26f: 0xbd, + 0x270: 0xbe, 0x271: 0xbf, 0x272: 0xc0, 0x273: 0xc1, 0x274: 0xc2, 0x275: 0xc3, 0x276: 0xbd, 0x277: 0xbe, + 0x278: 0xbf, 0x279: 0xc0, 0x27a: 0xc1, 0x27b: 0xc2, 0x27c: 0xc3, 0x27d: 0xbd, 0x27e: 0xbe, 0x27f: 0xbf, + // Block 0xa, offset 0x280 + 0x280: 0xc0, 0x281: 0xc1, 0x282: 0xc2, 0x283: 0xc3, 0x284: 0xbd, 0x285: 0xbe, 0x286: 0xbf, 0x287: 0xc0, + 0x288: 0xc1, 0x289: 0xc2, 0x28a: 0xc3, 0x28b: 0xbd, 0x28c: 0xbe, 0x28d: 0xbf, 0x28e: 0xc0, 0x28f: 0xc1, + 0x290: 0xc2, 0x291: 0xc3, 0x292: 0xbd, 0x293: 0xbe, 0x294: 0xbf, 0x295: 0xc0, 0x296: 0xc1, 0x297: 0xc2, + 0x298: 0xc3, 0x299: 0xbd, 0x29a: 0xbe, 0x29b: 0xbf, 0x29c: 0xc0, 0x29d: 0xc1, 0x29e: 0xc2, 0x29f: 0xc3, + 0x2a0: 0xbd, 0x2a1: 0xbe, 0x2a2: 0xbf, 0x2a3: 0xc0, 0x2a4: 0xc1, 0x2a5: 0xc2, 0x2a6: 0xc3, 0x2a7: 0xbd, + 0x2a8: 0xbe, 0x2a9: 0xbf, 0x2aa: 0xc0, 0x2ab: 0xc1, 0x2ac: 0xc2, 0x2ad: 0xc3, 0x2ae: 0xbd, 0x2af: 0xbe, + 0x2b0: 0xbf, 0x2b1: 0xc0, 0x2b2: 0xc1, 0x2b3: 0xc2, 0x2b4: 0xc3, 0x2b5: 0xbd, 0x2b6: 0xbe, 0x2b7: 0xbf, + 0x2b8: 0xc0, 0x2b9: 0xc1, 0x2ba: 0xc2, 0x2bb: 0xc3, 0x2bc: 0xbd, 0x2bd: 0xbe, 0x2be: 0xbf, 0x2bf: 0xc0, + // Block 0xb, offset 0x2c0 + 0x2c0: 0xc1, 0x2c1: 0xc2, 0x2c2: 0xc3, 0x2c3: 0xbd, 0x2c4: 0xbe, 0x2c5: 0xbf, 0x2c6: 0xc0, 0x2c7: 0xc1, + 0x2c8: 0xc2, 0x2c9: 0xc3, 0x2ca: 0xbd, 0x2cb: 0xbe, 0x2cc: 0xbf, 0x2cd: 0xc0, 0x2ce: 0xc1, 0x2cf: 0xc2, + 0x2d0: 0xc3, 0x2d1: 0xbd, 0x2d2: 0xbe, 0x2d3: 0xbf, 0x2d4: 0xc0, 0x2d5: 0xc1, 0x2d6: 0xc2, 0x2d7: 0xc3, + 0x2d8: 0xbd, 0x2d9: 0xbe, 0x2da: 0xbf, 0x2db: 0xc0, 0x2dc: 0xc1, 0x2dd: 0xc2, 0x2de: 0xc4, + // Block 0xc, offset 0x300 + 0x324: 0x31, 0x325: 0x32, 0x326: 0x33, 0x327: 0x34, + 0x328: 0x35, 0x329: 0x36, 0x32a: 0x37, 0x32b: 0x38, 0x32c: 0x39, 0x32d: 0x3a, 0x32e: 0x3b, 0x32f: 0x3c, + 0x330: 0x3d, 0x331: 0x3e, 0x332: 0x3f, 0x333: 0x40, 0x334: 0x41, 0x335: 0x42, 0x336: 0x43, 0x337: 0x44, + 0x338: 0x45, 0x339: 0x46, 0x33a: 0x47, 0x33b: 0x48, 0x33c: 0xc5, 0x33d: 0x49, 0x33e: 0x4a, 0x33f: 0x4b, + // Block 0xd, offset 0x340 + 0x347: 0xc6, + 0x34b: 0xc7, 0x34d: 0xc8, + 0x368: 0xc9, 0x36b: 0xca, + 0x374: 0xcb, + 0x37d: 0xcc, + // Block 0xe, offset 0x380 + 0x381: 0xcd, 0x382: 0xce, 0x384: 0xcf, 0x385: 0xb7, 0x387: 0xd0, + 0x388: 0xd1, 0x38b: 0xd2, 0x38c: 0xd3, 0x38d: 0xd4, + 0x391: 0xd5, 0x392: 0xd6, 0x393: 0xd7, 0x396: 0xd8, 0x397: 0xd9, + 0x398: 0xda, 0x39a: 0xdb, 0x39c: 0xdc, + 0x3a0: 0xdd, + 0x3a8: 0xde, 0x3a9: 0xdf, 0x3aa: 0xe0, + 0x3b0: 0xda, 0x3b5: 0xe1, 0x3b6: 0xe2, + // Block 0xf, offset 0x3c0 + 0x3eb: 0xe3, 0x3ec: 0xe4, + // Block 0x10, offset 0x400 + 0x432: 0xe5, + // Block 0x11, offset 0x440 + 0x445: 0xe6, 0x446: 0xe7, 0x447: 0xe8, + 0x449: 0xe9, + 0x450: 0xea, 0x451: 0xeb, 0x452: 0xec, 0x453: 0xed, 0x454: 0xee, 0x455: 0xef, 0x456: 0xf0, 0x457: 0xf1, + 0x458: 0xf2, 0x459: 0xf3, 0x45a: 0x4c, 0x45b: 0xf4, 0x45c: 0xf5, 0x45d: 0xf6, 0x45e: 0xf7, 0x45f: 0x4d, + // Block 0x12, offset 0x480 + 0x480: 0xf8, + 0x4a3: 0xf9, 0x4a5: 0xfa, + 0x4b8: 0x4e, 0x4b9: 0x4f, 0x4ba: 0x50, + // Block 0x13, offset 0x4c0 + 0x4c4: 0x51, 0x4c5: 0xfb, 0x4c6: 0xfc, + 0x4c8: 0x52, 0x4c9: 0xfd, + // Block 0x14, offset 0x500 + 0x520: 0x53, 0x521: 0x54, 0x522: 0x55, 0x523: 0x56, 0x524: 0x57, 0x525: 0x58, 0x526: 0x59, 0x527: 0x5a, + 0x528: 0x5b, + // Block 0x15, offset 0x540 + 0x550: 0x0b, 0x551: 0x0c, 0x556: 0x0d, + 0x55b: 0x0e, 0x55d: 0x0f, 0x55e: 0x10, 0x55f: 0x11, + 0x56f: 0x12, +} + +// nfkcSparseOffset: 162 entries, 324 bytes +var nfkcSparseOffset = []uint16{0x0, 0xe, 0x12, 0x1b, 0x25, 0x35, 0x37, 0x3c, 0x47, 0x56, 0x63, 0x6b, 0x70, 0x75, 0x77, 0x7f, 0x86, 0x89, 0x91, 0x95, 0x99, 0x9b, 0x9d, 0xa6, 0xaa, 0xb1, 0xb6, 0xb9, 0xc3, 0xc6, 0xcd, 0xd5, 0xd9, 0xdb, 0xde, 0xe2, 0xe8, 0xf9, 0x105, 0x107, 0x10d, 0x10f, 0x111, 0x113, 0x115, 0x117, 0x119, 0x11b, 0x11e, 0x121, 0x123, 0x126, 0x129, 0x12d, 0x132, 0x13b, 0x13d, 0x140, 0x142, 0x14d, 0x158, 0x166, 0x174, 0x184, 0x192, 0x199, 0x19f, 0x1ae, 0x1b2, 0x1b4, 0x1b8, 0x1ba, 0x1bd, 0x1bf, 0x1c2, 0x1c4, 0x1c7, 0x1c9, 0x1cb, 0x1cd, 0x1d9, 0x1e3, 0x1ed, 0x1f0, 0x1f4, 0x1f6, 0x1f8, 0x1fa, 0x1fc, 0x1ff, 0x201, 0x203, 0x205, 0x207, 0x20d, 0x210, 0x214, 0x216, 0x21d, 0x223, 0x229, 0x231, 0x237, 0x23d, 0x243, 0x247, 0x249, 0x24b, 0x24d, 0x24f, 0x255, 0x258, 0x25a, 0x260, 0x263, 0x26b, 0x272, 0x275, 0x278, 0x27a, 0x27d, 0x285, 0x289, 0x290, 0x293, 0x299, 0x29b, 0x29d, 0x2a0, 0x2a2, 0x2a5, 0x2a7, 0x2a9, 0x2ab, 0x2ae, 0x2b0, 0x2b2, 0x2b4, 0x2b6, 0x2c3, 0x2cd, 0x2cf, 0x2d1, 0x2d5, 0x2da, 0x2e6, 0x2eb, 0x2f4, 0x2fa, 0x2ff, 0x303, 0x308, 0x30c, 0x31c, 0x32a, 0x338, 0x346, 0x34c, 0x34e, 0x351, 0x35b, 0x35d} + +// nfkcSparseValues: 871 entries, 3484 bytes +var nfkcSparseValues = [871]valueRange{ + // Block 0x0, offset 0x0 + {value: 0x0002, lo: 0x0d}, + {value: 0x0001, lo: 0xa0, hi: 0xa0}, + {value: 0x4278, lo: 0xa8, hi: 0xa8}, + {value: 0x0083, lo: 0xaa, hi: 0xaa}, + {value: 0x4264, lo: 0xaf, hi: 0xaf}, + {value: 0x0025, lo: 0xb2, hi: 0xb3}, + {value: 0x425a, lo: 0xb4, hi: 0xb4}, + {value: 0x01dc, lo: 0xb5, hi: 0xb5}, + {value: 0x4291, lo: 0xb8, hi: 0xb8}, + {value: 0x0023, lo: 0xb9, hi: 0xb9}, + {value: 0x009f, lo: 0xba, hi: 0xba}, + {value: 0x221c, lo: 0xbc, hi: 0xbc}, + {value: 0x2210, lo: 0xbd, hi: 0xbd}, + {value: 0x22b2, lo: 0xbe, hi: 0xbe}, + // Block 0x1, offset 0xe + {value: 0x0091, lo: 0x03}, + {value: 0x46e2, lo: 0xa0, hi: 0xa1}, + {value: 0x4714, lo: 0xaf, hi: 0xb0}, + {value: 0xa000, lo: 0xb7, hi: 0xb7}, + // Block 0x2, offset 0x12 + {value: 0x0003, lo: 0x08}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x0091, lo: 0xb0, hi: 0xb0}, + {value: 0x0119, lo: 0xb1, hi: 0xb1}, + {value: 0x0095, lo: 0xb2, hi: 0xb2}, + {value: 0x00a5, lo: 0xb3, hi: 0xb3}, + {value: 0x0143, lo: 0xb4, hi: 0xb6}, + {value: 0x00af, lo: 0xb7, hi: 0xb7}, + {value: 0x00b3, lo: 0xb8, hi: 0xb8}, + // Block 0x3, offset 0x1b + {value: 0x000a, lo: 0x09}, + {value: 0x426e, lo: 0x98, hi: 0x98}, + {value: 0x4273, lo: 0x99, hi: 0x9a}, + {value: 0x4296, lo: 0x9b, hi: 0x9b}, + {value: 0x425f, lo: 0x9c, hi: 0x9c}, + {value: 0x4282, lo: 0x9d, hi: 0x9d}, + {value: 0x0113, lo: 0xa0, hi: 0xa0}, + {value: 0x0099, lo: 0xa1, hi: 0xa1}, + {value: 0x00a7, lo: 0xa2, hi: 0xa3}, + {value: 0x0167, lo: 0xa4, hi: 0xa4}, + // Block 0x4, offset 0x25 + {value: 0x0000, lo: 0x0f}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0xa000, lo: 0x8d, hi: 0x8d}, + {value: 0x37a5, lo: 0x90, hi: 0x90}, + {value: 0x37b1, lo: 0x91, hi: 0x91}, + {value: 0x379f, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x96, hi: 0x96}, + {value: 0x3817, lo: 0x97, hi: 0x97}, + {value: 0x37e1, lo: 0x9c, hi: 0x9c}, + {value: 0x37c9, lo: 0x9d, hi: 0x9d}, + {value: 0x37f3, lo: 0x9e, hi: 0x9e}, + {value: 0xa000, lo: 0xb4, hi: 0xb5}, + {value: 0x381d, lo: 0xb6, hi: 0xb6}, + {value: 0x3823, lo: 0xb7, hi: 0xb7}, + // Block 0x5, offset 0x35 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x83, hi: 0x87}, + // Block 0x6, offset 0x37 + {value: 0x0001, lo: 0x04}, + {value: 0x8113, lo: 0x81, hi: 0x82}, + {value: 0x8132, lo: 0x84, hi: 0x84}, + {value: 0x812d, lo: 0x85, hi: 0x85}, + {value: 0x810d, lo: 0x87, hi: 0x87}, + // Block 0x7, offset 0x3c + {value: 0x0000, lo: 0x0a}, + {value: 0x8132, lo: 0x90, hi: 0x97}, + {value: 0x8119, lo: 0x98, hi: 0x98}, + {value: 0x811a, lo: 0x99, hi: 0x99}, + {value: 0x811b, lo: 0x9a, hi: 0x9a}, + {value: 0x3841, lo: 0xa2, hi: 0xa2}, + {value: 0x3847, lo: 0xa3, hi: 0xa3}, + {value: 0x3853, lo: 0xa4, hi: 0xa4}, + {value: 0x384d, lo: 0xa5, hi: 0xa5}, + {value: 0x3859, lo: 0xa6, hi: 0xa6}, + {value: 0xa000, lo: 0xa7, hi: 0xa7}, + // Block 0x8, offset 0x47 + {value: 0x0000, lo: 0x0e}, + {value: 0x386b, lo: 0x80, hi: 0x80}, + {value: 0xa000, lo: 0x81, hi: 0x81}, + {value: 0x385f, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x3865, lo: 0x93, hi: 0x93}, + {value: 0xa000, lo: 0x95, hi: 0x95}, + {value: 0x8132, lo: 0x96, hi: 0x9c}, + {value: 0x8132, lo: 0x9f, hi: 0xa2}, + {value: 0x812d, lo: 0xa3, hi: 0xa3}, + {value: 0x8132, lo: 0xa4, hi: 0xa4}, + {value: 0x8132, lo: 0xa7, hi: 0xa8}, + {value: 0x812d, lo: 0xaa, hi: 0xaa}, + {value: 0x8132, lo: 0xab, hi: 0xac}, + {value: 0x812d, lo: 0xad, hi: 0xad}, + // Block 0x9, offset 0x56 + {value: 0x0000, lo: 0x0c}, + {value: 0x811f, lo: 0x91, hi: 0x91}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + {value: 0x812d, lo: 0xb1, hi: 0xb1}, + {value: 0x8132, lo: 0xb2, hi: 0xb3}, + {value: 0x812d, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb5, hi: 0xb6}, + {value: 0x812d, lo: 0xb7, hi: 0xb9}, + {value: 0x8132, lo: 0xba, hi: 0xba}, + {value: 0x812d, lo: 0xbb, hi: 0xbc}, + {value: 0x8132, lo: 0xbd, hi: 0xbd}, + {value: 0x812d, lo: 0xbe, hi: 0xbe}, + {value: 0x8132, lo: 0xbf, hi: 0xbf}, + // Block 0xa, offset 0x63 + {value: 0x0005, lo: 0x07}, + {value: 0x8132, lo: 0x80, hi: 0x80}, + {value: 0x8132, lo: 0x81, hi: 0x81}, + {value: 0x812d, lo: 0x82, hi: 0x83}, + {value: 0x812d, lo: 0x84, hi: 0x85}, + {value: 0x812d, lo: 0x86, hi: 0x87}, + {value: 0x812d, lo: 0x88, hi: 0x89}, + {value: 0x8132, lo: 0x8a, hi: 0x8a}, + // Block 0xb, offset 0x6b + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0xab, hi: 0xb1}, + {value: 0x812d, lo: 0xb2, hi: 0xb2}, + {value: 0x8132, lo: 0xb3, hi: 0xb3}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0xc, offset 0x70 + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0x96, hi: 0x99}, + {value: 0x8132, lo: 0x9b, hi: 0xa3}, + {value: 0x8132, lo: 0xa5, hi: 0xa7}, + {value: 0x8132, lo: 0xa9, hi: 0xad}, + // Block 0xd, offset 0x75 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x99, hi: 0x9b}, + // Block 0xe, offset 0x77 + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0xa8, hi: 0xa8}, + {value: 0x3ed8, lo: 0xa9, hi: 0xa9}, + {value: 0xa000, lo: 0xb0, hi: 0xb0}, + {value: 0x3ee0, lo: 0xb1, hi: 0xb1}, + {value: 0xa000, lo: 0xb3, hi: 0xb3}, + {value: 0x3ee8, lo: 0xb4, hi: 0xb4}, + {value: 0x9902, lo: 0xbc, hi: 0xbc}, + // Block 0xf, offset 0x7f + {value: 0x0008, lo: 0x06}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x8132, lo: 0x91, hi: 0x91}, + {value: 0x812d, lo: 0x92, hi: 0x92}, + {value: 0x8132, lo: 0x93, hi: 0x93}, + {value: 0x8132, lo: 0x94, hi: 0x94}, + {value: 0x451c, lo: 0x98, hi: 0x9f}, + // Block 0x10, offset 0x86 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x11, offset 0x89 + {value: 0x0008, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2c9e, lo: 0x8b, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x455c, lo: 0x9c, hi: 0x9d}, + {value: 0x456c, lo: 0x9f, hi: 0x9f}, + {value: 0x8132, lo: 0xbe, hi: 0xbe}, + // Block 0x12, offset 0x91 + {value: 0x0000, lo: 0x03}, + {value: 0x4594, lo: 0xb3, hi: 0xb3}, + {value: 0x459c, lo: 0xb6, hi: 0xb6}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + // Block 0x13, offset 0x95 + {value: 0x0008, lo: 0x03}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x4574, lo: 0x99, hi: 0x9b}, + {value: 0x458c, lo: 0x9e, hi: 0x9e}, + // Block 0x14, offset 0x99 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + // Block 0x15, offset 0x9b + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + // Block 0x16, offset 0x9d + {value: 0x0000, lo: 0x08}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2cb6, lo: 0x88, hi: 0x88}, + {value: 0x2cae, lo: 0x8b, hi: 0x8b}, + {value: 0x2cbe, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x96, hi: 0x97}, + {value: 0x45a4, lo: 0x9c, hi: 0x9c}, + {value: 0x45ac, lo: 0x9d, hi: 0x9d}, + // Block 0x17, offset 0xa6 + {value: 0x0000, lo: 0x03}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0x2cc6, lo: 0x94, hi: 0x94}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x18, offset 0xaa + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2cce, lo: 0x8a, hi: 0x8a}, + {value: 0x2cde, lo: 0x8b, hi: 0x8b}, + {value: 0x2cd6, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x19, offset 0xb1 + {value: 0x1801, lo: 0x04}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x3ef0, lo: 0x88, hi: 0x88}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x8120, lo: 0x95, hi: 0x96}, + // Block 0x1a, offset 0xb6 + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbc, hi: 0xbc}, + {value: 0xa000, lo: 0xbf, hi: 0xbf}, + // Block 0x1b, offset 0xb9 + {value: 0x0000, lo: 0x09}, + {value: 0x2ce6, lo: 0x80, hi: 0x80}, + {value: 0x9900, lo: 0x82, hi: 0x82}, + {value: 0xa000, lo: 0x86, hi: 0x86}, + {value: 0x2cee, lo: 0x87, hi: 0x87}, + {value: 0x2cf6, lo: 0x88, hi: 0x88}, + {value: 0x2f50, lo: 0x8a, hi: 0x8a}, + {value: 0x2dd8, lo: 0x8b, hi: 0x8b}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x95, hi: 0x96}, + // Block 0x1c, offset 0xc3 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x1d, offset 0xc6 + {value: 0x0000, lo: 0x06}, + {value: 0xa000, lo: 0x86, hi: 0x87}, + {value: 0x2cfe, lo: 0x8a, hi: 0x8a}, + {value: 0x2d0e, lo: 0x8b, hi: 0x8b}, + {value: 0x2d06, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + // Block 0x1e, offset 0xcd + {value: 0x6bea, lo: 0x07}, + {value: 0x9904, lo: 0x8a, hi: 0x8a}, + {value: 0x9900, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x3ef8, lo: 0x9a, hi: 0x9a}, + {value: 0x2f58, lo: 0x9c, hi: 0x9c}, + {value: 0x2de3, lo: 0x9d, hi: 0x9d}, + {value: 0x2d16, lo: 0x9e, hi: 0x9f}, + // Block 0x1f, offset 0xd5 + {value: 0x0000, lo: 0x03}, + {value: 0x2621, lo: 0xb3, hi: 0xb3}, + {value: 0x8122, lo: 0xb8, hi: 0xb9}, + {value: 0x8104, lo: 0xba, hi: 0xba}, + // Block 0x20, offset 0xd9 + {value: 0x0000, lo: 0x01}, + {value: 0x8123, lo: 0x88, hi: 0x8b}, + // Block 0x21, offset 0xdb + {value: 0x0000, lo: 0x02}, + {value: 0x2636, lo: 0xb3, hi: 0xb3}, + {value: 0x8124, lo: 0xb8, hi: 0xb9}, + // Block 0x22, offset 0xde + {value: 0x0000, lo: 0x03}, + {value: 0x8125, lo: 0x88, hi: 0x8b}, + {value: 0x2628, lo: 0x9c, hi: 0x9c}, + {value: 0x262f, lo: 0x9d, hi: 0x9d}, + // Block 0x23, offset 0xe2 + {value: 0x0000, lo: 0x05}, + {value: 0x030b, lo: 0x8c, hi: 0x8c}, + {value: 0x812d, lo: 0x98, hi: 0x99}, + {value: 0x812d, lo: 0xb5, hi: 0xb5}, + {value: 0x812d, lo: 0xb7, hi: 0xb7}, + {value: 0x812b, lo: 0xb9, hi: 0xb9}, + // Block 0x24, offset 0xe8 + {value: 0x0000, lo: 0x10}, + {value: 0x2644, lo: 0x83, hi: 0x83}, + {value: 0x264b, lo: 0x8d, hi: 0x8d}, + {value: 0x2652, lo: 0x92, hi: 0x92}, + {value: 0x2659, lo: 0x97, hi: 0x97}, + {value: 0x2660, lo: 0x9c, hi: 0x9c}, + {value: 0x263d, lo: 0xa9, hi: 0xa9}, + {value: 0x8126, lo: 0xb1, hi: 0xb1}, + {value: 0x8127, lo: 0xb2, hi: 0xb2}, + {value: 0x4a84, lo: 0xb3, hi: 0xb3}, + {value: 0x8128, lo: 0xb4, hi: 0xb4}, + {value: 0x4a8d, lo: 0xb5, hi: 0xb5}, + {value: 0x45b4, lo: 0xb6, hi: 0xb6}, + {value: 0x45f4, lo: 0xb7, hi: 0xb7}, + {value: 0x45bc, lo: 0xb8, hi: 0xb8}, + {value: 0x45ff, lo: 0xb9, hi: 0xb9}, + {value: 0x8127, lo: 0xba, hi: 0xbd}, + // Block 0x25, offset 0xf9 + {value: 0x0000, lo: 0x0b}, + {value: 0x8127, lo: 0x80, hi: 0x80}, + {value: 0x4a96, lo: 0x81, hi: 0x81}, + {value: 0x8132, lo: 0x82, hi: 0x83}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0x86, hi: 0x87}, + {value: 0x266e, lo: 0x93, hi: 0x93}, + {value: 0x2675, lo: 0x9d, hi: 0x9d}, + {value: 0x267c, lo: 0xa2, hi: 0xa2}, + {value: 0x2683, lo: 0xa7, hi: 0xa7}, + {value: 0x268a, lo: 0xac, hi: 0xac}, + {value: 0x2667, lo: 0xb9, hi: 0xb9}, + // Block 0x26, offset 0x105 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x86, hi: 0x86}, + // Block 0x27, offset 0x107 + {value: 0x0000, lo: 0x05}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x2d1e, lo: 0xa6, hi: 0xa6}, + {value: 0x9900, lo: 0xae, hi: 0xae}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + {value: 0x8104, lo: 0xb9, hi: 0xba}, + // Block 0x28, offset 0x10d + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x8d, hi: 0x8d}, + // Block 0x29, offset 0x10f + {value: 0x0000, lo: 0x01}, + {value: 0x030f, lo: 0xbc, hi: 0xbc}, + // Block 0x2a, offset 0x111 + {value: 0x0000, lo: 0x01}, + {value: 0xa000, lo: 0x80, hi: 0x92}, + // Block 0x2b, offset 0x113 + {value: 0x0000, lo: 0x01}, + {value: 0xb900, lo: 0xa1, hi: 0xb5}, + // Block 0x2c, offset 0x115 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0xa8, hi: 0xbf}, + // Block 0x2d, offset 0x117 + {value: 0x0000, lo: 0x01}, + {value: 0x9900, lo: 0x80, hi: 0x82}, + // Block 0x2e, offset 0x119 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x9d, hi: 0x9f}, + // Block 0x2f, offset 0x11b + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x94, hi: 0x94}, + {value: 0x8104, lo: 0xb4, hi: 0xb4}, + // Block 0x30, offset 0x11e + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x92, hi: 0x92}, + {value: 0x8132, lo: 0x9d, hi: 0x9d}, + // Block 0x31, offset 0x121 + {value: 0x0000, lo: 0x01}, + {value: 0x8131, lo: 0xa9, hi: 0xa9}, + // Block 0x32, offset 0x123 + {value: 0x0004, lo: 0x02}, + {value: 0x812e, lo: 0xb9, hi: 0xba}, + {value: 0x812d, lo: 0xbb, hi: 0xbb}, + // Block 0x33, offset 0x126 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x97, hi: 0x97}, + {value: 0x812d, lo: 0x98, hi: 0x98}, + // Block 0x34, offset 0x129 + {value: 0x0000, lo: 0x03}, + {value: 0x8104, lo: 0xa0, hi: 0xa0}, + {value: 0x8132, lo: 0xb5, hi: 0xbc}, + {value: 0x812d, lo: 0xbf, hi: 0xbf}, + // Block 0x35, offset 0x12d + {value: 0x0000, lo: 0x04}, + {value: 0x8132, lo: 0xb0, hi: 0xb4}, + {value: 0x812d, lo: 0xb5, hi: 0xba}, + {value: 0x8132, lo: 0xbb, hi: 0xbc}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0x36, offset 0x132 + {value: 0x0000, lo: 0x08}, + {value: 0x2d66, lo: 0x80, hi: 0x80}, + {value: 0x2d6e, lo: 0x81, hi: 0x81}, + {value: 0xa000, lo: 0x82, hi: 0x82}, + {value: 0x2d76, lo: 0x83, hi: 0x83}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0xab, hi: 0xab}, + {value: 0x812d, lo: 0xac, hi: 0xac}, + {value: 0x8132, lo: 0xad, hi: 0xb3}, + // Block 0x37, offset 0x13b + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xaa, hi: 0xab}, + // Block 0x38, offset 0x13d + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xa6, hi: 0xa6}, + {value: 0x8104, lo: 0xb2, hi: 0xb3}, + // Block 0x39, offset 0x140 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + // Block 0x3a, offset 0x142 + {value: 0x0000, lo: 0x0a}, + {value: 0x8132, lo: 0x90, hi: 0x92}, + {value: 0x8101, lo: 0x94, hi: 0x94}, + {value: 0x812d, lo: 0x95, hi: 0x99}, + {value: 0x8132, lo: 0x9a, hi: 0x9b}, + {value: 0x812d, lo: 0x9c, hi: 0x9f}, + {value: 0x8132, lo: 0xa0, hi: 0xa0}, + {value: 0x8101, lo: 0xa2, hi: 0xa8}, + {value: 0x812d, lo: 0xad, hi: 0xad}, + {value: 0x8132, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb8, hi: 0xb9}, + // Block 0x3b, offset 0x14d + {value: 0x0002, lo: 0x0a}, + {value: 0x0043, lo: 0xac, hi: 0xac}, + {value: 0x00d1, lo: 0xad, hi: 0xad}, + {value: 0x0045, lo: 0xae, hi: 0xae}, + {value: 0x0049, lo: 0xb0, hi: 0xb1}, + {value: 0x00e6, lo: 0xb2, hi: 0xb2}, + {value: 0x004f, lo: 0xb3, hi: 0xba}, + {value: 0x005f, lo: 0xbc, hi: 0xbc}, + {value: 0x00ef, lo: 0xbd, hi: 0xbd}, + {value: 0x0061, lo: 0xbe, hi: 0xbe}, + {value: 0x0065, lo: 0xbf, hi: 0xbf}, + // Block 0x3c, offset 0x158 + {value: 0x0000, lo: 0x0d}, + {value: 0x0001, lo: 0x80, hi: 0x8a}, + {value: 0x043b, lo: 0x91, hi: 0x91}, + {value: 0x429b, lo: 0x97, hi: 0x97}, + {value: 0x001d, lo: 0xa4, hi: 0xa4}, + {value: 0x1873, lo: 0xa5, hi: 0xa5}, + {value: 0x1b5c, lo: 0xa6, hi: 0xa6}, + {value: 0x0001, lo: 0xaf, hi: 0xaf}, + {value: 0x2691, lo: 0xb3, hi: 0xb3}, + {value: 0x27fe, lo: 0xb4, hi: 0xb4}, + {value: 0x2698, lo: 0xb6, hi: 0xb6}, + {value: 0x2808, lo: 0xb7, hi: 0xb7}, + {value: 0x186d, lo: 0xbc, hi: 0xbc}, + {value: 0x4269, lo: 0xbe, hi: 0xbe}, + // Block 0x3d, offset 0x166 + {value: 0x0002, lo: 0x0d}, + {value: 0x1933, lo: 0x87, hi: 0x87}, + {value: 0x1930, lo: 0x88, hi: 0x88}, + {value: 0x1870, lo: 0x89, hi: 0x89}, + {value: 0x298e, lo: 0x97, hi: 0x97}, + {value: 0x0001, lo: 0x9f, hi: 0x9f}, + {value: 0x0021, lo: 0xb0, hi: 0xb0}, + {value: 0x0093, lo: 0xb1, hi: 0xb1}, + {value: 0x0029, lo: 0xb4, hi: 0xb9}, + {value: 0x0017, lo: 0xba, hi: 0xba}, + {value: 0x0467, lo: 0xbb, hi: 0xbb}, + {value: 0x003b, lo: 0xbc, hi: 0xbc}, + {value: 0x0011, lo: 0xbd, hi: 0xbe}, + {value: 0x009d, lo: 0xbf, hi: 0xbf}, + // Block 0x3e, offset 0x174 + {value: 0x0002, lo: 0x0f}, + {value: 0x0021, lo: 0x80, hi: 0x89}, + {value: 0x0017, lo: 0x8a, hi: 0x8a}, + {value: 0x0467, lo: 0x8b, hi: 0x8b}, + {value: 0x003b, lo: 0x8c, hi: 0x8c}, + {value: 0x0011, lo: 0x8d, hi: 0x8e}, + {value: 0x0083, lo: 0x90, hi: 0x90}, + {value: 0x008b, lo: 0x91, hi: 0x91}, + {value: 0x009f, lo: 0x92, hi: 0x92}, + {value: 0x00b1, lo: 0x93, hi: 0x93}, + {value: 0x0104, lo: 0x94, hi: 0x94}, + {value: 0x0091, lo: 0x95, hi: 0x95}, + {value: 0x0097, lo: 0x96, hi: 0x99}, + {value: 0x00a1, lo: 0x9a, hi: 0x9a}, + {value: 0x00a7, lo: 0x9b, hi: 0x9c}, + {value: 0x1999, lo: 0xa8, hi: 0xa8}, + // Block 0x3f, offset 0x184 + {value: 0x0000, lo: 0x0d}, + {value: 0x8132, lo: 0x90, hi: 0x91}, + {value: 0x8101, lo: 0x92, hi: 0x93}, + {value: 0x8132, lo: 0x94, hi: 0x97}, + {value: 0x8101, lo: 0x98, hi: 0x9a}, + {value: 0x8132, lo: 0x9b, hi: 0x9c}, + {value: 0x8132, lo: 0xa1, hi: 0xa1}, + {value: 0x8101, lo: 0xa5, hi: 0xa6}, + {value: 0x8132, lo: 0xa7, hi: 0xa7}, + {value: 0x812d, lo: 0xa8, hi: 0xa8}, + {value: 0x8132, lo: 0xa9, hi: 0xa9}, + {value: 0x8101, lo: 0xaa, hi: 0xab}, + {value: 0x812d, lo: 0xac, hi: 0xaf}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + // Block 0x40, offset 0x192 + {value: 0x0007, lo: 0x06}, + {value: 0x2180, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + {value: 0x3bb9, lo: 0x9a, hi: 0x9b}, + {value: 0x3bc7, lo: 0xae, hi: 0xae}, + // Block 0x41, offset 0x199 + {value: 0x000e, lo: 0x05}, + {value: 0x3bce, lo: 0x8d, hi: 0x8e}, + {value: 0x3bd5, lo: 0x8f, hi: 0x8f}, + {value: 0xa000, lo: 0x90, hi: 0x90}, + {value: 0xa000, lo: 0x92, hi: 0x92}, + {value: 0xa000, lo: 0x94, hi: 0x94}, + // Block 0x42, offset 0x19f + {value: 0x0173, lo: 0x0e}, + {value: 0xa000, lo: 0x83, hi: 0x83}, + {value: 0x3be3, lo: 0x84, hi: 0x84}, + {value: 0xa000, lo: 0x88, hi: 0x88}, + {value: 0x3bea, lo: 0x89, hi: 0x89}, + {value: 0xa000, lo: 0x8b, hi: 0x8b}, + {value: 0x3bf1, lo: 0x8c, hi: 0x8c}, + {value: 0xa000, lo: 0xa3, hi: 0xa3}, + {value: 0x3bf8, lo: 0xa4, hi: 0xa4}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x3bff, lo: 0xa6, hi: 0xa6}, + {value: 0x269f, lo: 0xac, hi: 0xad}, + {value: 0x26a6, lo: 0xaf, hi: 0xaf}, + {value: 0x281c, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xbc, hi: 0xbc}, + // Block 0x43, offset 0x1ae + {value: 0x0007, lo: 0x03}, + {value: 0x3c68, lo: 0xa0, hi: 0xa1}, + {value: 0x3c92, lo: 0xa2, hi: 0xa3}, + {value: 0x3cbc, lo: 0xaa, hi: 0xad}, + // Block 0x44, offset 0x1b2 + {value: 0x0004, lo: 0x01}, + {value: 0x048b, lo: 0xa9, hi: 0xaa}, + // Block 0x45, offset 0x1b4 + {value: 0x0002, lo: 0x03}, + {value: 0x0057, lo: 0x80, hi: 0x8f}, + {value: 0x0083, lo: 0x90, hi: 0xa9}, + {value: 0x0021, lo: 0xaa, hi: 0xaa}, + // Block 0x46, offset 0x1b8 + {value: 0x0000, lo: 0x01}, + {value: 0x299b, lo: 0x8c, hi: 0x8c}, + // Block 0x47, offset 0x1ba + {value: 0x0263, lo: 0x02}, + {value: 0x1b8c, lo: 0xb4, hi: 0xb4}, + {value: 0x192d, lo: 0xb5, hi: 0xb6}, + // Block 0x48, offset 0x1bd + {value: 0x0000, lo: 0x01}, + {value: 0x44dd, lo: 0x9c, hi: 0x9c}, + // Block 0x49, offset 0x1bf + {value: 0x0000, lo: 0x02}, + {value: 0x0095, lo: 0xbc, hi: 0xbc}, + {value: 0x006d, lo: 0xbd, hi: 0xbd}, + // Block 0x4a, offset 0x1c2 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xaf, hi: 0xb1}, + // Block 0x4b, offset 0x1c4 + {value: 0x0000, lo: 0x02}, + {value: 0x047f, lo: 0xaf, hi: 0xaf}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x4c, offset 0x1c7 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa0, hi: 0xbf}, + // Block 0x4d, offset 0x1c9 + {value: 0x0000, lo: 0x01}, + {value: 0x0dc3, lo: 0x9f, hi: 0x9f}, + // Block 0x4e, offset 0x1cb + {value: 0x0000, lo: 0x01}, + {value: 0x162f, lo: 0xb3, hi: 0xb3}, + // Block 0x4f, offset 0x1cd + {value: 0x0004, lo: 0x0b}, + {value: 0x1597, lo: 0x80, hi: 0x82}, + {value: 0x15af, lo: 0x83, hi: 0x83}, + {value: 0x15c7, lo: 0x84, hi: 0x85}, + {value: 0x15d7, lo: 0x86, hi: 0x89}, + {value: 0x15eb, lo: 0x8a, hi: 0x8c}, + {value: 0x15ff, lo: 0x8d, hi: 0x8d}, + {value: 0x1607, lo: 0x8e, hi: 0x8e}, + {value: 0x160f, lo: 0x8f, hi: 0x90}, + {value: 0x161b, lo: 0x91, hi: 0x93}, + {value: 0x162b, lo: 0x94, hi: 0x94}, + {value: 0x1633, lo: 0x95, hi: 0x95}, + // Block 0x50, offset 0x1d9 + {value: 0x0004, lo: 0x09}, + {value: 0x0001, lo: 0x80, hi: 0x80}, + {value: 0x812c, lo: 0xaa, hi: 0xaa}, + {value: 0x8131, lo: 0xab, hi: 0xab}, + {value: 0x8133, lo: 0xac, hi: 0xac}, + {value: 0x812e, lo: 0xad, hi: 0xad}, + {value: 0x812f, lo: 0xae, hi: 0xae}, + {value: 0x812f, lo: 0xaf, hi: 0xaf}, + {value: 0x04b3, lo: 0xb6, hi: 0xb6}, + {value: 0x0887, lo: 0xb8, hi: 0xba}, + // Block 0x51, offset 0x1e3 + {value: 0x0006, lo: 0x09}, + {value: 0x0313, lo: 0xb1, hi: 0xb1}, + {value: 0x0317, lo: 0xb2, hi: 0xb2}, + {value: 0x4a3b, lo: 0xb3, hi: 0xb3}, + {value: 0x031b, lo: 0xb4, hi: 0xb4}, + {value: 0x4a41, lo: 0xb5, hi: 0xb6}, + {value: 0x031f, lo: 0xb7, hi: 0xb7}, + {value: 0x0323, lo: 0xb8, hi: 0xb8}, + {value: 0x0327, lo: 0xb9, hi: 0xb9}, + {value: 0x4a4d, lo: 0xba, hi: 0xbf}, + // Block 0x52, offset 0x1ed + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0xaf, hi: 0xaf}, + {value: 0x8132, lo: 0xb4, hi: 0xbd}, + // Block 0x53, offset 0x1f0 + {value: 0x0000, lo: 0x03}, + {value: 0x020f, lo: 0x9c, hi: 0x9c}, + {value: 0x0212, lo: 0x9d, hi: 0x9d}, + {value: 0x8132, lo: 0x9e, hi: 0x9f}, + // Block 0x54, offset 0x1f4 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb0, hi: 0xb1}, + // Block 0x55, offset 0x1f6 + {value: 0x0000, lo: 0x01}, + {value: 0x163b, lo: 0xb0, hi: 0xb0}, + // Block 0x56, offset 0x1f8 + {value: 0x000c, lo: 0x01}, + {value: 0x00d7, lo: 0xb8, hi: 0xb9}, + // Block 0x57, offset 0x1fa + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x86, hi: 0x86}, + // Block 0x58, offset 0x1fc + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x84, hi: 0x84}, + {value: 0x8132, lo: 0xa0, hi: 0xb1}, + // Block 0x59, offset 0x1ff + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xab, hi: 0xad}, + // Block 0x5a, offset 0x201 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x93, hi: 0x93}, + // Block 0x5b, offset 0x203 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0xb3, hi: 0xb3}, + // Block 0x5c, offset 0x205 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x80, hi: 0x80}, + // Block 0x5d, offset 0x207 + {value: 0x0000, lo: 0x05}, + {value: 0x8132, lo: 0xb0, hi: 0xb0}, + {value: 0x8132, lo: 0xb2, hi: 0xb3}, + {value: 0x812d, lo: 0xb4, hi: 0xb4}, + {value: 0x8132, lo: 0xb7, hi: 0xb8}, + {value: 0x8132, lo: 0xbe, hi: 0xbf}, + // Block 0x5e, offset 0x20d + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x81, hi: 0x81}, + {value: 0x8104, lo: 0xb6, hi: 0xb6}, + // Block 0x5f, offset 0x210 + {value: 0x0008, lo: 0x03}, + {value: 0x1637, lo: 0x9c, hi: 0x9d}, + {value: 0x0125, lo: 0x9e, hi: 0x9e}, + {value: 0x1643, lo: 0x9f, hi: 0x9f}, + // Block 0x60, offset 0x214 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xad, hi: 0xad}, + // Block 0x61, offset 0x216 + {value: 0x0000, lo: 0x06}, + {value: 0xe500, lo: 0x80, hi: 0x80}, + {value: 0xc600, lo: 0x81, hi: 0x9b}, + {value: 0xe500, lo: 0x9c, hi: 0x9c}, + {value: 0xc600, lo: 0x9d, hi: 0xb7}, + {value: 0xe500, lo: 0xb8, hi: 0xb8}, + {value: 0xc600, lo: 0xb9, hi: 0xbf}, + // Block 0x62, offset 0x21d + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x93}, + {value: 0xe500, lo: 0x94, hi: 0x94}, + {value: 0xc600, lo: 0x95, hi: 0xaf}, + {value: 0xe500, lo: 0xb0, hi: 0xb0}, + {value: 0xc600, lo: 0xb1, hi: 0xbf}, + // Block 0x63, offset 0x223 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8b}, + {value: 0xe500, lo: 0x8c, hi: 0x8c}, + {value: 0xc600, lo: 0x8d, hi: 0xa7}, + {value: 0xe500, lo: 0xa8, hi: 0xa8}, + {value: 0xc600, lo: 0xa9, hi: 0xbf}, + // Block 0x64, offset 0x229 + {value: 0x0000, lo: 0x07}, + {value: 0xc600, lo: 0x80, hi: 0x83}, + {value: 0xe500, lo: 0x84, hi: 0x84}, + {value: 0xc600, lo: 0x85, hi: 0x9f}, + {value: 0xe500, lo: 0xa0, hi: 0xa0}, + {value: 0xc600, lo: 0xa1, hi: 0xbb}, + {value: 0xe500, lo: 0xbc, hi: 0xbc}, + {value: 0xc600, lo: 0xbd, hi: 0xbf}, + // Block 0x65, offset 0x231 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x97}, + {value: 0xe500, lo: 0x98, hi: 0x98}, + {value: 0xc600, lo: 0x99, hi: 0xb3}, + {value: 0xe500, lo: 0xb4, hi: 0xb4}, + {value: 0xc600, lo: 0xb5, hi: 0xbf}, + // Block 0x66, offset 0x237 + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x8f}, + {value: 0xe500, lo: 0x90, hi: 0x90}, + {value: 0xc600, lo: 0x91, hi: 0xab}, + {value: 0xe500, lo: 0xac, hi: 0xac}, + {value: 0xc600, lo: 0xad, hi: 0xbf}, + // Block 0x67, offset 0x23d + {value: 0x0000, lo: 0x05}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + {value: 0xe500, lo: 0xa4, hi: 0xa4}, + {value: 0xc600, lo: 0xa5, hi: 0xbf}, + // Block 0x68, offset 0x243 + {value: 0x0000, lo: 0x03}, + {value: 0xc600, lo: 0x80, hi: 0x87}, + {value: 0xe500, lo: 0x88, hi: 0x88}, + {value: 0xc600, lo: 0x89, hi: 0xa3}, + // Block 0x69, offset 0x247 + {value: 0x0002, lo: 0x01}, + {value: 0x0003, lo: 0x81, hi: 0xbf}, + // Block 0x6a, offset 0x249 + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xbd, hi: 0xbd}, + // Block 0x6b, offset 0x24b + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0xa0, hi: 0xa0}, + // Block 0x6c, offset 0x24d + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb6, hi: 0xba}, + // Block 0x6d, offset 0x24f + {value: 0x002c, lo: 0x05}, + {value: 0x812d, lo: 0x8d, hi: 0x8d}, + {value: 0x8132, lo: 0x8f, hi: 0x8f}, + {value: 0x8132, lo: 0xb8, hi: 0xb8}, + {value: 0x8101, lo: 0xb9, hi: 0xba}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x6e, offset 0x255 + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0xa5, hi: 0xa5}, + {value: 0x812d, lo: 0xa6, hi: 0xa6}, + // Block 0x6f, offset 0x258 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xa4, hi: 0xa7}, + // Block 0x70, offset 0x25a + {value: 0x0000, lo: 0x05}, + {value: 0x812d, lo: 0x86, hi: 0x87}, + {value: 0x8132, lo: 0x88, hi: 0x8a}, + {value: 0x812d, lo: 0x8b, hi: 0x8b}, + {value: 0x8132, lo: 0x8c, hi: 0x8c}, + {value: 0x812d, lo: 0x8d, hi: 0x90}, + // Block 0x71, offset 0x260 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x86, hi: 0x86}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x72, offset 0x263 + {value: 0x17fe, lo: 0x07}, + {value: 0xa000, lo: 0x99, hi: 0x99}, + {value: 0x4238, lo: 0x9a, hi: 0x9a}, + {value: 0xa000, lo: 0x9b, hi: 0x9b}, + {value: 0x4242, lo: 0x9c, hi: 0x9c}, + {value: 0xa000, lo: 0xa5, hi: 0xa5}, + {value: 0x424c, lo: 0xab, hi: 0xab}, + {value: 0x8104, lo: 0xb9, hi: 0xba}, + // Block 0x73, offset 0x26b + {value: 0x0000, lo: 0x06}, + {value: 0x8132, lo: 0x80, hi: 0x82}, + {value: 0x9900, lo: 0xa7, hi: 0xa7}, + {value: 0x2d7e, lo: 0xae, hi: 0xae}, + {value: 0x2d88, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb1, hi: 0xb2}, + {value: 0x8104, lo: 0xb3, hi: 0xb4}, + // Block 0x74, offset 0x272 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x80, hi: 0x80}, + {value: 0x8102, lo: 0x8a, hi: 0x8a}, + // Block 0x75, offset 0x275 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb5, hi: 0xb5}, + {value: 0x8102, lo: 0xb6, hi: 0xb6}, + // Block 0x76, offset 0x278 + {value: 0x0002, lo: 0x01}, + {value: 0x8102, lo: 0xa9, hi: 0xaa}, + // Block 0x77, offset 0x27a + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0xbb, hi: 0xbc}, + {value: 0x9900, lo: 0xbe, hi: 0xbe}, + // Block 0x78, offset 0x27d + {value: 0x0000, lo: 0x07}, + {value: 0xa000, lo: 0x87, hi: 0x87}, + {value: 0x2d92, lo: 0x8b, hi: 0x8b}, + {value: 0x2d9c, lo: 0x8c, hi: 0x8c}, + {value: 0x8104, lo: 0x8d, hi: 0x8d}, + {value: 0x9900, lo: 0x97, hi: 0x97}, + {value: 0x8132, lo: 0xa6, hi: 0xac}, + {value: 0x8132, lo: 0xb0, hi: 0xb4}, + // Block 0x79, offset 0x285 + {value: 0x0000, lo: 0x03}, + {value: 0x8104, lo: 0x82, hi: 0x82}, + {value: 0x8102, lo: 0x86, hi: 0x86}, + {value: 0x8132, lo: 0x9e, hi: 0x9e}, + // Block 0x7a, offset 0x289 + {value: 0x6b5a, lo: 0x06}, + {value: 0x9900, lo: 0xb0, hi: 0xb0}, + {value: 0xa000, lo: 0xb9, hi: 0xb9}, + {value: 0x9900, lo: 0xba, hi: 0xba}, + {value: 0x2db0, lo: 0xbb, hi: 0xbb}, + {value: 0x2da6, lo: 0xbc, hi: 0xbd}, + {value: 0x2dba, lo: 0xbe, hi: 0xbe}, + // Block 0x7b, offset 0x290 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0x82, hi: 0x82}, + {value: 0x8102, lo: 0x83, hi: 0x83}, + // Block 0x7c, offset 0x293 + {value: 0x0000, lo: 0x05}, + {value: 0x9900, lo: 0xaf, hi: 0xaf}, + {value: 0xa000, lo: 0xb8, hi: 0xb9}, + {value: 0x2dc4, lo: 0xba, hi: 0xba}, + {value: 0x2dce, lo: 0xbb, hi: 0xbb}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x7d, offset 0x299 + {value: 0x0000, lo: 0x01}, + {value: 0x8102, lo: 0x80, hi: 0x80}, + // Block 0x7e, offset 0x29b + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xbf, hi: 0xbf}, + // Block 0x7f, offset 0x29d + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb6, hi: 0xb6}, + {value: 0x8102, lo: 0xb7, hi: 0xb7}, + // Block 0x80, offset 0x2a0 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xab, hi: 0xab}, + // Block 0x81, offset 0x2a2 + {value: 0x0000, lo: 0x02}, + {value: 0x8104, lo: 0xb9, hi: 0xb9}, + {value: 0x8102, lo: 0xba, hi: 0xba}, + // Block 0x82, offset 0x2a5 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0xb4, hi: 0xb4}, + // Block 0x83, offset 0x2a7 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x87, hi: 0x87}, + // Block 0x84, offset 0x2a9 + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x99, hi: 0x99}, + // Block 0x85, offset 0x2ab + {value: 0x0000, lo: 0x02}, + {value: 0x8102, lo: 0x82, hi: 0x82}, + {value: 0x8104, lo: 0x84, hi: 0x85}, + // Block 0x86, offset 0x2ae + {value: 0x0000, lo: 0x01}, + {value: 0x8104, lo: 0x97, hi: 0x97}, + // Block 0x87, offset 0x2b0 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0xb0, hi: 0xb4}, + // Block 0x88, offset 0x2b2 + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0xb0, hi: 0xb6}, + // Block 0x89, offset 0x2b4 + {value: 0x0000, lo: 0x01}, + {value: 0x8101, lo: 0x9e, hi: 0x9e}, + // Block 0x8a, offset 0x2b6 + {value: 0x0000, lo: 0x0c}, + {value: 0x45cc, lo: 0x9e, hi: 0x9e}, + {value: 0x45d6, lo: 0x9f, hi: 0x9f}, + {value: 0x460a, lo: 0xa0, hi: 0xa0}, + {value: 0x4618, lo: 0xa1, hi: 0xa1}, + {value: 0x4626, lo: 0xa2, hi: 0xa2}, + {value: 0x4634, lo: 0xa3, hi: 0xa3}, + {value: 0x4642, lo: 0xa4, hi: 0xa4}, + {value: 0x812b, lo: 0xa5, hi: 0xa6}, + {value: 0x8101, lo: 0xa7, hi: 0xa9}, + {value: 0x8130, lo: 0xad, hi: 0xad}, + {value: 0x812b, lo: 0xae, hi: 0xb2}, + {value: 0x812d, lo: 0xbb, hi: 0xbf}, + // Block 0x8b, offset 0x2c3 + {value: 0x0000, lo: 0x09}, + {value: 0x812d, lo: 0x80, hi: 0x82}, + {value: 0x8132, lo: 0x85, hi: 0x89}, + {value: 0x812d, lo: 0x8a, hi: 0x8b}, + {value: 0x8132, lo: 0xaa, hi: 0xad}, + {value: 0x45e0, lo: 0xbb, hi: 0xbb}, + {value: 0x45ea, lo: 0xbc, hi: 0xbc}, + {value: 0x4650, lo: 0xbd, hi: 0xbd}, + {value: 0x466c, lo: 0xbe, hi: 0xbe}, + {value: 0x465e, lo: 0xbf, hi: 0xbf}, + // Block 0x8c, offset 0x2cd + {value: 0x0000, lo: 0x01}, + {value: 0x467a, lo: 0x80, hi: 0x80}, + // Block 0x8d, offset 0x2cf + {value: 0x0000, lo: 0x01}, + {value: 0x8132, lo: 0x82, hi: 0x84}, + // Block 0x8e, offset 0x2d1 + {value: 0x0002, lo: 0x03}, + {value: 0x0043, lo: 0x80, hi: 0x99}, + {value: 0x0083, lo: 0x9a, hi: 0xb3}, + {value: 0x0043, lo: 0xb4, hi: 0xbf}, + // Block 0x8f, offset 0x2d5 + {value: 0x0002, lo: 0x04}, + {value: 0x005b, lo: 0x80, hi: 0x8d}, + {value: 0x0083, lo: 0x8e, hi: 0x94}, + {value: 0x0093, lo: 0x96, hi: 0xa7}, + {value: 0x0043, lo: 0xa8, hi: 0xbf}, + // Block 0x90, offset 0x2da + {value: 0x0002, lo: 0x0b}, + {value: 0x0073, lo: 0x80, hi: 0x81}, + {value: 0x0083, lo: 0x82, hi: 0x9b}, + {value: 0x0043, lo: 0x9c, hi: 0x9c}, + {value: 0x0047, lo: 0x9e, hi: 0x9f}, + {value: 0x004f, lo: 0xa2, hi: 0xa2}, + {value: 0x0055, lo: 0xa5, hi: 0xa6}, + {value: 0x005d, lo: 0xa9, hi: 0xac}, + {value: 0x0067, lo: 0xae, hi: 0xb5}, + {value: 0x0083, lo: 0xb6, hi: 0xb9}, + {value: 0x008d, lo: 0xbb, hi: 0xbb}, + {value: 0x0091, lo: 0xbd, hi: 0xbf}, + // Block 0x91, offset 0x2e6 + {value: 0x0002, lo: 0x04}, + {value: 0x0097, lo: 0x80, hi: 0x83}, + {value: 0x00a1, lo: 0x85, hi: 0x8f}, + {value: 0x0043, lo: 0x90, hi: 0xa9}, + {value: 0x0083, lo: 0xaa, hi: 0xbf}, + // Block 0x92, offset 0x2eb + {value: 0x0002, lo: 0x08}, + {value: 0x00af, lo: 0x80, hi: 0x83}, + {value: 0x0043, lo: 0x84, hi: 0x85}, + {value: 0x0049, lo: 0x87, hi: 0x8a}, + {value: 0x0055, lo: 0x8d, hi: 0x94}, + {value: 0x0067, lo: 0x96, hi: 0x9c}, + {value: 0x0083, lo: 0x9e, hi: 0xb7}, + {value: 0x0043, lo: 0xb8, hi: 0xb9}, + {value: 0x0049, lo: 0xbb, hi: 0xbe}, + // Block 0x93, offset 0x2f4 + {value: 0x0002, lo: 0x05}, + {value: 0x0053, lo: 0x80, hi: 0x84}, + {value: 0x005f, lo: 0x86, hi: 0x86}, + {value: 0x0067, lo: 0x8a, hi: 0x90}, + {value: 0x0083, lo: 0x92, hi: 0xab}, + {value: 0x0043, lo: 0xac, hi: 0xbf}, + // Block 0x94, offset 0x2fa + {value: 0x0002, lo: 0x04}, + {value: 0x006b, lo: 0x80, hi: 0x85}, + {value: 0x0083, lo: 0x86, hi: 0x9f}, + {value: 0x0043, lo: 0xa0, hi: 0xb9}, + {value: 0x0083, lo: 0xba, hi: 0xbf}, + // Block 0x95, offset 0x2ff + {value: 0x0002, lo: 0x03}, + {value: 0x008f, lo: 0x80, hi: 0x93}, + {value: 0x0043, lo: 0x94, hi: 0xad}, + {value: 0x0083, lo: 0xae, hi: 0xbf}, + // Block 0x96, offset 0x303 + {value: 0x0002, lo: 0x04}, + {value: 0x00a7, lo: 0x80, hi: 0x87}, + {value: 0x0043, lo: 0x88, hi: 0xa1}, + {value: 0x0083, lo: 0xa2, hi: 0xbb}, + {value: 0x0043, lo: 0xbc, hi: 0xbf}, + // Block 0x97, offset 0x308 + {value: 0x0002, lo: 0x03}, + {value: 0x004b, lo: 0x80, hi: 0x95}, + {value: 0x0083, lo: 0x96, hi: 0xaf}, + {value: 0x0043, lo: 0xb0, hi: 0xbf}, + // Block 0x98, offset 0x30c + {value: 0x0003, lo: 0x0f}, + {value: 0x01b8, lo: 0x80, hi: 0x80}, + {value: 0x045f, lo: 0x81, hi: 0x81}, + {value: 0x01bb, lo: 0x82, hi: 0x9a}, + {value: 0x045b, lo: 0x9b, hi: 0x9b}, + {value: 0x01c7, lo: 0x9c, hi: 0x9c}, + {value: 0x01d0, lo: 0x9d, hi: 0x9d}, + {value: 0x01d6, lo: 0x9e, hi: 0x9e}, + {value: 0x01fa, lo: 0x9f, hi: 0x9f}, + {value: 0x01eb, lo: 0xa0, hi: 0xa0}, + {value: 0x01e8, lo: 0xa1, hi: 0xa1}, + {value: 0x0173, lo: 0xa2, hi: 0xb2}, + {value: 0x0188, lo: 0xb3, hi: 0xb3}, + {value: 0x01a6, lo: 0xb4, hi: 0xba}, + {value: 0x045f, lo: 0xbb, hi: 0xbb}, + {value: 0x01bb, lo: 0xbc, hi: 0xbf}, + // Block 0x99, offset 0x31c + {value: 0x0003, lo: 0x0d}, + {value: 0x01c7, lo: 0x80, hi: 0x94}, + {value: 0x045b, lo: 0x95, hi: 0x95}, + {value: 0x01c7, lo: 0x96, hi: 0x96}, + {value: 0x01d0, lo: 0x97, hi: 0x97}, + {value: 0x01d6, lo: 0x98, hi: 0x98}, + {value: 0x01fa, lo: 0x99, hi: 0x99}, + {value: 0x01eb, lo: 0x9a, hi: 0x9a}, + {value: 0x01e8, lo: 0x9b, hi: 0x9b}, + {value: 0x0173, lo: 0x9c, hi: 0xac}, + {value: 0x0188, lo: 0xad, hi: 0xad}, + {value: 0x01a6, lo: 0xae, hi: 0xb4}, + {value: 0x045f, lo: 0xb5, hi: 0xb5}, + {value: 0x01bb, lo: 0xb6, hi: 0xbf}, + // Block 0x9a, offset 0x32a + {value: 0x0003, lo: 0x0d}, + {value: 0x01d9, lo: 0x80, hi: 0x8e}, + {value: 0x045b, lo: 0x8f, hi: 0x8f}, + {value: 0x01c7, lo: 0x90, hi: 0x90}, + {value: 0x01d0, lo: 0x91, hi: 0x91}, + {value: 0x01d6, lo: 0x92, hi: 0x92}, + {value: 0x01fa, lo: 0x93, hi: 0x93}, + {value: 0x01eb, lo: 0x94, hi: 0x94}, + {value: 0x01e8, lo: 0x95, hi: 0x95}, + {value: 0x0173, lo: 0x96, hi: 0xa6}, + {value: 0x0188, lo: 0xa7, hi: 0xa7}, + {value: 0x01a6, lo: 0xa8, hi: 0xae}, + {value: 0x045f, lo: 0xaf, hi: 0xaf}, + {value: 0x01bb, lo: 0xb0, hi: 0xbf}, + // Block 0x9b, offset 0x338 + {value: 0x0003, lo: 0x0d}, + {value: 0x01eb, lo: 0x80, hi: 0x88}, + {value: 0x045b, lo: 0x89, hi: 0x89}, + {value: 0x01c7, lo: 0x8a, hi: 0x8a}, + {value: 0x01d0, lo: 0x8b, hi: 0x8b}, + {value: 0x01d6, lo: 0x8c, hi: 0x8c}, + {value: 0x01fa, lo: 0x8d, hi: 0x8d}, + {value: 0x01eb, lo: 0x8e, hi: 0x8e}, + {value: 0x01e8, lo: 0x8f, hi: 0x8f}, + {value: 0x0173, lo: 0x90, hi: 0xa0}, + {value: 0x0188, lo: 0xa1, hi: 0xa1}, + {value: 0x01a6, lo: 0xa2, hi: 0xa8}, + {value: 0x045f, lo: 0xa9, hi: 0xa9}, + {value: 0x01bb, lo: 0xaa, hi: 0xbf}, + // Block 0x9c, offset 0x346 + {value: 0x0000, lo: 0x05}, + {value: 0x8132, lo: 0x80, hi: 0x86}, + {value: 0x8132, lo: 0x88, hi: 0x98}, + {value: 0x8132, lo: 0x9b, hi: 0xa1}, + {value: 0x8132, lo: 0xa3, hi: 0xa4}, + {value: 0x8132, lo: 0xa6, hi: 0xaa}, + // Block 0x9d, offset 0x34c + {value: 0x0000, lo: 0x01}, + {value: 0x812d, lo: 0x90, hi: 0x96}, + // Block 0x9e, offset 0x34e + {value: 0x0000, lo: 0x02}, + {value: 0x8132, lo: 0x84, hi: 0x89}, + {value: 0x8102, lo: 0x8a, hi: 0x8a}, + // Block 0x9f, offset 0x351 + {value: 0x0002, lo: 0x09}, + {value: 0x0063, lo: 0x80, hi: 0x89}, + {value: 0x1951, lo: 0x8a, hi: 0x8a}, + {value: 0x1981, lo: 0x8b, hi: 0x8b}, + {value: 0x199c, lo: 0x8c, hi: 0x8c}, + {value: 0x19a2, lo: 0x8d, hi: 0x8d}, + {value: 0x1bc0, lo: 0x8e, hi: 0x8e}, + {value: 0x19ae, lo: 0x8f, hi: 0x8f}, + {value: 0x197b, lo: 0xaa, hi: 0xaa}, + {value: 0x197e, lo: 0xab, hi: 0xab}, + // Block 0xa0, offset 0x35b + {value: 0x0000, lo: 0x01}, + {value: 0x193f, lo: 0x90, hi: 0x90}, + // Block 0xa1, offset 0x35d + {value: 0x0028, lo: 0x09}, + {value: 0x2862, lo: 0x80, hi: 0x80}, + {value: 0x2826, lo: 0x81, hi: 0x81}, + {value: 0x2830, lo: 0x82, hi: 0x82}, + {value: 0x2844, lo: 0x83, hi: 0x84}, + {value: 0x284e, lo: 0x85, hi: 0x86}, + {value: 0x283a, lo: 0x87, hi: 0x87}, + {value: 0x2858, lo: 0x88, hi: 0x88}, + {value: 0x0b6f, lo: 0x90, hi: 0x90}, + {value: 0x08e7, lo: 0x91, hi: 0x91}, +} + +// recompMap: 7520 bytes (entries only) +var recompMap map[uint32]rune +var recompMapOnce sync.Once + +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "" + // Total size of tables: 53KB (54514 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go index a01274a8e8..9429069291 100644 --- a/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go +++ b/vendor/golang.org/x/text/unicode/norm/tables9.0.0.go @@ -4,6 +4,8 @@ package norm +import "sync" + const ( // Version is the Unicode edition from which the tables are derived. Version = "9.0.0" @@ -6687,947 +6689,949 @@ var nfkcSparseValues = [875]valueRange{ } // recompMap: 7520 bytes (entries only) -var recompMap = map[uint32]rune{ - 0x00410300: 0x00C0, - 0x00410301: 0x00C1, - 0x00410302: 0x00C2, - 0x00410303: 0x00C3, - 0x00410308: 0x00C4, - 0x0041030A: 0x00C5, - 0x00430327: 0x00C7, - 0x00450300: 0x00C8, - 0x00450301: 0x00C9, - 0x00450302: 0x00CA, - 0x00450308: 0x00CB, - 0x00490300: 0x00CC, - 0x00490301: 0x00CD, - 0x00490302: 0x00CE, - 0x00490308: 0x00CF, - 0x004E0303: 0x00D1, - 0x004F0300: 0x00D2, - 0x004F0301: 0x00D3, - 0x004F0302: 0x00D4, - 0x004F0303: 0x00D5, - 0x004F0308: 0x00D6, - 0x00550300: 0x00D9, - 0x00550301: 0x00DA, - 0x00550302: 0x00DB, - 0x00550308: 0x00DC, - 0x00590301: 0x00DD, - 0x00610300: 0x00E0, - 0x00610301: 0x00E1, - 0x00610302: 0x00E2, - 0x00610303: 0x00E3, - 0x00610308: 0x00E4, - 0x0061030A: 0x00E5, - 0x00630327: 0x00E7, - 0x00650300: 0x00E8, - 0x00650301: 0x00E9, - 0x00650302: 0x00EA, - 0x00650308: 0x00EB, - 0x00690300: 0x00EC, - 0x00690301: 0x00ED, - 0x00690302: 0x00EE, - 0x00690308: 0x00EF, - 0x006E0303: 0x00F1, - 0x006F0300: 0x00F2, - 0x006F0301: 0x00F3, - 0x006F0302: 0x00F4, - 0x006F0303: 0x00F5, - 0x006F0308: 0x00F6, - 0x00750300: 0x00F9, - 0x00750301: 0x00FA, - 0x00750302: 0x00FB, - 0x00750308: 0x00FC, - 0x00790301: 0x00FD, - 0x00790308: 0x00FF, - 0x00410304: 0x0100, - 0x00610304: 0x0101, - 0x00410306: 0x0102, - 0x00610306: 0x0103, - 0x00410328: 0x0104, - 0x00610328: 0x0105, - 0x00430301: 0x0106, - 0x00630301: 0x0107, - 0x00430302: 0x0108, - 0x00630302: 0x0109, - 0x00430307: 0x010A, - 0x00630307: 0x010B, - 0x0043030C: 0x010C, - 0x0063030C: 0x010D, - 0x0044030C: 0x010E, - 0x0064030C: 0x010F, - 0x00450304: 0x0112, - 0x00650304: 0x0113, - 0x00450306: 0x0114, - 0x00650306: 0x0115, - 0x00450307: 0x0116, - 0x00650307: 0x0117, - 0x00450328: 0x0118, - 0x00650328: 0x0119, - 0x0045030C: 0x011A, - 0x0065030C: 0x011B, - 0x00470302: 0x011C, - 0x00670302: 0x011D, - 0x00470306: 0x011E, - 0x00670306: 0x011F, - 0x00470307: 0x0120, - 0x00670307: 0x0121, - 0x00470327: 0x0122, - 0x00670327: 0x0123, - 0x00480302: 0x0124, - 0x00680302: 0x0125, - 0x00490303: 0x0128, - 0x00690303: 0x0129, - 0x00490304: 0x012A, - 0x00690304: 0x012B, - 0x00490306: 0x012C, - 0x00690306: 0x012D, - 0x00490328: 0x012E, - 0x00690328: 0x012F, - 0x00490307: 0x0130, - 0x004A0302: 0x0134, - 0x006A0302: 0x0135, - 0x004B0327: 0x0136, - 0x006B0327: 0x0137, - 0x004C0301: 0x0139, - 0x006C0301: 0x013A, - 0x004C0327: 0x013B, - 0x006C0327: 0x013C, - 0x004C030C: 0x013D, - 0x006C030C: 0x013E, - 0x004E0301: 0x0143, - 0x006E0301: 0x0144, - 0x004E0327: 0x0145, - 0x006E0327: 0x0146, - 0x004E030C: 0x0147, - 0x006E030C: 0x0148, - 0x004F0304: 0x014C, - 0x006F0304: 0x014D, - 0x004F0306: 0x014E, - 0x006F0306: 0x014F, - 0x004F030B: 0x0150, - 0x006F030B: 0x0151, - 0x00520301: 0x0154, - 0x00720301: 0x0155, - 0x00520327: 0x0156, - 0x00720327: 0x0157, - 0x0052030C: 0x0158, - 0x0072030C: 0x0159, - 0x00530301: 0x015A, - 0x00730301: 0x015B, - 0x00530302: 0x015C, - 0x00730302: 0x015D, - 0x00530327: 0x015E, - 0x00730327: 0x015F, - 0x0053030C: 0x0160, - 0x0073030C: 0x0161, - 0x00540327: 0x0162, - 0x00740327: 0x0163, - 0x0054030C: 0x0164, - 0x0074030C: 0x0165, - 0x00550303: 0x0168, - 0x00750303: 0x0169, - 0x00550304: 0x016A, - 0x00750304: 0x016B, - 0x00550306: 0x016C, - 0x00750306: 0x016D, - 0x0055030A: 0x016E, - 0x0075030A: 0x016F, - 0x0055030B: 0x0170, - 0x0075030B: 0x0171, - 0x00550328: 0x0172, - 0x00750328: 0x0173, - 0x00570302: 0x0174, - 0x00770302: 0x0175, - 0x00590302: 0x0176, - 0x00790302: 0x0177, - 0x00590308: 0x0178, - 0x005A0301: 0x0179, - 0x007A0301: 0x017A, - 0x005A0307: 0x017B, - 0x007A0307: 0x017C, - 0x005A030C: 0x017D, - 0x007A030C: 0x017E, - 0x004F031B: 0x01A0, - 0x006F031B: 0x01A1, - 0x0055031B: 0x01AF, - 0x0075031B: 0x01B0, - 0x0041030C: 0x01CD, - 0x0061030C: 0x01CE, - 0x0049030C: 0x01CF, - 0x0069030C: 0x01D0, - 0x004F030C: 0x01D1, - 0x006F030C: 0x01D2, - 0x0055030C: 0x01D3, - 0x0075030C: 0x01D4, - 0x00DC0304: 0x01D5, - 0x00FC0304: 0x01D6, - 0x00DC0301: 0x01D7, - 0x00FC0301: 0x01D8, - 0x00DC030C: 0x01D9, - 0x00FC030C: 0x01DA, - 0x00DC0300: 0x01DB, - 0x00FC0300: 0x01DC, - 0x00C40304: 0x01DE, - 0x00E40304: 0x01DF, - 0x02260304: 0x01E0, - 0x02270304: 0x01E1, - 0x00C60304: 0x01E2, - 0x00E60304: 0x01E3, - 0x0047030C: 0x01E6, - 0x0067030C: 0x01E7, - 0x004B030C: 0x01E8, - 0x006B030C: 0x01E9, - 0x004F0328: 0x01EA, - 0x006F0328: 0x01EB, - 0x01EA0304: 0x01EC, - 0x01EB0304: 0x01ED, - 0x01B7030C: 0x01EE, - 0x0292030C: 0x01EF, - 0x006A030C: 0x01F0, - 0x00470301: 0x01F4, - 0x00670301: 0x01F5, - 0x004E0300: 0x01F8, - 0x006E0300: 0x01F9, - 0x00C50301: 0x01FA, - 0x00E50301: 0x01FB, - 0x00C60301: 0x01FC, - 0x00E60301: 0x01FD, - 0x00D80301: 0x01FE, - 0x00F80301: 0x01FF, - 0x0041030F: 0x0200, - 0x0061030F: 0x0201, - 0x00410311: 0x0202, - 0x00610311: 0x0203, - 0x0045030F: 0x0204, - 0x0065030F: 0x0205, - 0x00450311: 0x0206, - 0x00650311: 0x0207, - 0x0049030F: 0x0208, - 0x0069030F: 0x0209, - 0x00490311: 0x020A, - 0x00690311: 0x020B, - 0x004F030F: 0x020C, - 0x006F030F: 0x020D, - 0x004F0311: 0x020E, - 0x006F0311: 0x020F, - 0x0052030F: 0x0210, - 0x0072030F: 0x0211, - 0x00520311: 0x0212, - 0x00720311: 0x0213, - 0x0055030F: 0x0214, - 0x0075030F: 0x0215, - 0x00550311: 0x0216, - 0x00750311: 0x0217, - 0x00530326: 0x0218, - 0x00730326: 0x0219, - 0x00540326: 0x021A, - 0x00740326: 0x021B, - 0x0048030C: 0x021E, - 0x0068030C: 0x021F, - 0x00410307: 0x0226, - 0x00610307: 0x0227, - 0x00450327: 0x0228, - 0x00650327: 0x0229, - 0x00D60304: 0x022A, - 0x00F60304: 0x022B, - 0x00D50304: 0x022C, - 0x00F50304: 0x022D, - 0x004F0307: 0x022E, - 0x006F0307: 0x022F, - 0x022E0304: 0x0230, - 0x022F0304: 0x0231, - 0x00590304: 0x0232, - 0x00790304: 0x0233, - 0x00A80301: 0x0385, - 0x03910301: 0x0386, - 0x03950301: 0x0388, - 0x03970301: 0x0389, - 0x03990301: 0x038A, - 0x039F0301: 0x038C, - 0x03A50301: 0x038E, - 0x03A90301: 0x038F, - 0x03CA0301: 0x0390, - 0x03990308: 0x03AA, - 0x03A50308: 0x03AB, - 0x03B10301: 0x03AC, - 0x03B50301: 0x03AD, - 0x03B70301: 0x03AE, - 0x03B90301: 0x03AF, - 0x03CB0301: 0x03B0, - 0x03B90308: 0x03CA, - 0x03C50308: 0x03CB, - 0x03BF0301: 0x03CC, - 0x03C50301: 0x03CD, - 0x03C90301: 0x03CE, - 0x03D20301: 0x03D3, - 0x03D20308: 0x03D4, - 0x04150300: 0x0400, - 0x04150308: 0x0401, - 0x04130301: 0x0403, - 0x04060308: 0x0407, - 0x041A0301: 0x040C, - 0x04180300: 0x040D, - 0x04230306: 0x040E, - 0x04180306: 0x0419, - 0x04380306: 0x0439, - 0x04350300: 0x0450, - 0x04350308: 0x0451, - 0x04330301: 0x0453, - 0x04560308: 0x0457, - 0x043A0301: 0x045C, - 0x04380300: 0x045D, - 0x04430306: 0x045E, - 0x0474030F: 0x0476, - 0x0475030F: 0x0477, - 0x04160306: 0x04C1, - 0x04360306: 0x04C2, - 0x04100306: 0x04D0, - 0x04300306: 0x04D1, - 0x04100308: 0x04D2, - 0x04300308: 0x04D3, - 0x04150306: 0x04D6, - 0x04350306: 0x04D7, - 0x04D80308: 0x04DA, - 0x04D90308: 0x04DB, - 0x04160308: 0x04DC, - 0x04360308: 0x04DD, - 0x04170308: 0x04DE, - 0x04370308: 0x04DF, - 0x04180304: 0x04E2, - 0x04380304: 0x04E3, - 0x04180308: 0x04E4, - 0x04380308: 0x04E5, - 0x041E0308: 0x04E6, - 0x043E0308: 0x04E7, - 0x04E80308: 0x04EA, - 0x04E90308: 0x04EB, - 0x042D0308: 0x04EC, - 0x044D0308: 0x04ED, - 0x04230304: 0x04EE, - 0x04430304: 0x04EF, - 0x04230308: 0x04F0, - 0x04430308: 0x04F1, - 0x0423030B: 0x04F2, - 0x0443030B: 0x04F3, - 0x04270308: 0x04F4, - 0x04470308: 0x04F5, - 0x042B0308: 0x04F8, - 0x044B0308: 0x04F9, - 0x06270653: 0x0622, - 0x06270654: 0x0623, - 0x06480654: 0x0624, - 0x06270655: 0x0625, - 0x064A0654: 0x0626, - 0x06D50654: 0x06C0, - 0x06C10654: 0x06C2, - 0x06D20654: 0x06D3, - 0x0928093C: 0x0929, - 0x0930093C: 0x0931, - 0x0933093C: 0x0934, - 0x09C709BE: 0x09CB, - 0x09C709D7: 0x09CC, - 0x0B470B56: 0x0B48, - 0x0B470B3E: 0x0B4B, - 0x0B470B57: 0x0B4C, - 0x0B920BD7: 0x0B94, - 0x0BC60BBE: 0x0BCA, - 0x0BC70BBE: 0x0BCB, - 0x0BC60BD7: 0x0BCC, - 0x0C460C56: 0x0C48, - 0x0CBF0CD5: 0x0CC0, - 0x0CC60CD5: 0x0CC7, - 0x0CC60CD6: 0x0CC8, - 0x0CC60CC2: 0x0CCA, - 0x0CCA0CD5: 0x0CCB, - 0x0D460D3E: 0x0D4A, - 0x0D470D3E: 0x0D4B, - 0x0D460D57: 0x0D4C, - 0x0DD90DCA: 0x0DDA, - 0x0DD90DCF: 0x0DDC, - 0x0DDC0DCA: 0x0DDD, - 0x0DD90DDF: 0x0DDE, - 0x1025102E: 0x1026, - 0x1B051B35: 0x1B06, - 0x1B071B35: 0x1B08, - 0x1B091B35: 0x1B0A, - 0x1B0B1B35: 0x1B0C, - 0x1B0D1B35: 0x1B0E, - 0x1B111B35: 0x1B12, - 0x1B3A1B35: 0x1B3B, - 0x1B3C1B35: 0x1B3D, - 0x1B3E1B35: 0x1B40, - 0x1B3F1B35: 0x1B41, - 0x1B421B35: 0x1B43, - 0x00410325: 0x1E00, - 0x00610325: 0x1E01, - 0x00420307: 0x1E02, - 0x00620307: 0x1E03, - 0x00420323: 0x1E04, - 0x00620323: 0x1E05, - 0x00420331: 0x1E06, - 0x00620331: 0x1E07, - 0x00C70301: 0x1E08, - 0x00E70301: 0x1E09, - 0x00440307: 0x1E0A, - 0x00640307: 0x1E0B, - 0x00440323: 0x1E0C, - 0x00640323: 0x1E0D, - 0x00440331: 0x1E0E, - 0x00640331: 0x1E0F, - 0x00440327: 0x1E10, - 0x00640327: 0x1E11, - 0x0044032D: 0x1E12, - 0x0064032D: 0x1E13, - 0x01120300: 0x1E14, - 0x01130300: 0x1E15, - 0x01120301: 0x1E16, - 0x01130301: 0x1E17, - 0x0045032D: 0x1E18, - 0x0065032D: 0x1E19, - 0x00450330: 0x1E1A, - 0x00650330: 0x1E1B, - 0x02280306: 0x1E1C, - 0x02290306: 0x1E1D, - 0x00460307: 0x1E1E, - 0x00660307: 0x1E1F, - 0x00470304: 0x1E20, - 0x00670304: 0x1E21, - 0x00480307: 0x1E22, - 0x00680307: 0x1E23, - 0x00480323: 0x1E24, - 0x00680323: 0x1E25, - 0x00480308: 0x1E26, - 0x00680308: 0x1E27, - 0x00480327: 0x1E28, - 0x00680327: 0x1E29, - 0x0048032E: 0x1E2A, - 0x0068032E: 0x1E2B, - 0x00490330: 0x1E2C, - 0x00690330: 0x1E2D, - 0x00CF0301: 0x1E2E, - 0x00EF0301: 0x1E2F, - 0x004B0301: 0x1E30, - 0x006B0301: 0x1E31, - 0x004B0323: 0x1E32, - 0x006B0323: 0x1E33, - 0x004B0331: 0x1E34, - 0x006B0331: 0x1E35, - 0x004C0323: 0x1E36, - 0x006C0323: 0x1E37, - 0x1E360304: 0x1E38, - 0x1E370304: 0x1E39, - 0x004C0331: 0x1E3A, - 0x006C0331: 0x1E3B, - 0x004C032D: 0x1E3C, - 0x006C032D: 0x1E3D, - 0x004D0301: 0x1E3E, - 0x006D0301: 0x1E3F, - 0x004D0307: 0x1E40, - 0x006D0307: 0x1E41, - 0x004D0323: 0x1E42, - 0x006D0323: 0x1E43, - 0x004E0307: 0x1E44, - 0x006E0307: 0x1E45, - 0x004E0323: 0x1E46, - 0x006E0323: 0x1E47, - 0x004E0331: 0x1E48, - 0x006E0331: 0x1E49, - 0x004E032D: 0x1E4A, - 0x006E032D: 0x1E4B, - 0x00D50301: 0x1E4C, - 0x00F50301: 0x1E4D, - 0x00D50308: 0x1E4E, - 0x00F50308: 0x1E4F, - 0x014C0300: 0x1E50, - 0x014D0300: 0x1E51, - 0x014C0301: 0x1E52, - 0x014D0301: 0x1E53, - 0x00500301: 0x1E54, - 0x00700301: 0x1E55, - 0x00500307: 0x1E56, - 0x00700307: 0x1E57, - 0x00520307: 0x1E58, - 0x00720307: 0x1E59, - 0x00520323: 0x1E5A, - 0x00720323: 0x1E5B, - 0x1E5A0304: 0x1E5C, - 0x1E5B0304: 0x1E5D, - 0x00520331: 0x1E5E, - 0x00720331: 0x1E5F, - 0x00530307: 0x1E60, - 0x00730307: 0x1E61, - 0x00530323: 0x1E62, - 0x00730323: 0x1E63, - 0x015A0307: 0x1E64, - 0x015B0307: 0x1E65, - 0x01600307: 0x1E66, - 0x01610307: 0x1E67, - 0x1E620307: 0x1E68, - 0x1E630307: 0x1E69, - 0x00540307: 0x1E6A, - 0x00740307: 0x1E6B, - 0x00540323: 0x1E6C, - 0x00740323: 0x1E6D, - 0x00540331: 0x1E6E, - 0x00740331: 0x1E6F, - 0x0054032D: 0x1E70, - 0x0074032D: 0x1E71, - 0x00550324: 0x1E72, - 0x00750324: 0x1E73, - 0x00550330: 0x1E74, - 0x00750330: 0x1E75, - 0x0055032D: 0x1E76, - 0x0075032D: 0x1E77, - 0x01680301: 0x1E78, - 0x01690301: 0x1E79, - 0x016A0308: 0x1E7A, - 0x016B0308: 0x1E7B, - 0x00560303: 0x1E7C, - 0x00760303: 0x1E7D, - 0x00560323: 0x1E7E, - 0x00760323: 0x1E7F, - 0x00570300: 0x1E80, - 0x00770300: 0x1E81, - 0x00570301: 0x1E82, - 0x00770301: 0x1E83, - 0x00570308: 0x1E84, - 0x00770308: 0x1E85, - 0x00570307: 0x1E86, - 0x00770307: 0x1E87, - 0x00570323: 0x1E88, - 0x00770323: 0x1E89, - 0x00580307: 0x1E8A, - 0x00780307: 0x1E8B, - 0x00580308: 0x1E8C, - 0x00780308: 0x1E8D, - 0x00590307: 0x1E8E, - 0x00790307: 0x1E8F, - 0x005A0302: 0x1E90, - 0x007A0302: 0x1E91, - 0x005A0323: 0x1E92, - 0x007A0323: 0x1E93, - 0x005A0331: 0x1E94, - 0x007A0331: 0x1E95, - 0x00680331: 0x1E96, - 0x00740308: 0x1E97, - 0x0077030A: 0x1E98, - 0x0079030A: 0x1E99, - 0x017F0307: 0x1E9B, - 0x00410323: 0x1EA0, - 0x00610323: 0x1EA1, - 0x00410309: 0x1EA2, - 0x00610309: 0x1EA3, - 0x00C20301: 0x1EA4, - 0x00E20301: 0x1EA5, - 0x00C20300: 0x1EA6, - 0x00E20300: 0x1EA7, - 0x00C20309: 0x1EA8, - 0x00E20309: 0x1EA9, - 0x00C20303: 0x1EAA, - 0x00E20303: 0x1EAB, - 0x1EA00302: 0x1EAC, - 0x1EA10302: 0x1EAD, - 0x01020301: 0x1EAE, - 0x01030301: 0x1EAF, - 0x01020300: 0x1EB0, - 0x01030300: 0x1EB1, - 0x01020309: 0x1EB2, - 0x01030309: 0x1EB3, - 0x01020303: 0x1EB4, - 0x01030303: 0x1EB5, - 0x1EA00306: 0x1EB6, - 0x1EA10306: 0x1EB7, - 0x00450323: 0x1EB8, - 0x00650323: 0x1EB9, - 0x00450309: 0x1EBA, - 0x00650309: 0x1EBB, - 0x00450303: 0x1EBC, - 0x00650303: 0x1EBD, - 0x00CA0301: 0x1EBE, - 0x00EA0301: 0x1EBF, - 0x00CA0300: 0x1EC0, - 0x00EA0300: 0x1EC1, - 0x00CA0309: 0x1EC2, - 0x00EA0309: 0x1EC3, - 0x00CA0303: 0x1EC4, - 0x00EA0303: 0x1EC5, - 0x1EB80302: 0x1EC6, - 0x1EB90302: 0x1EC7, - 0x00490309: 0x1EC8, - 0x00690309: 0x1EC9, - 0x00490323: 0x1ECA, - 0x00690323: 0x1ECB, - 0x004F0323: 0x1ECC, - 0x006F0323: 0x1ECD, - 0x004F0309: 0x1ECE, - 0x006F0309: 0x1ECF, - 0x00D40301: 0x1ED0, - 0x00F40301: 0x1ED1, - 0x00D40300: 0x1ED2, - 0x00F40300: 0x1ED3, - 0x00D40309: 0x1ED4, - 0x00F40309: 0x1ED5, - 0x00D40303: 0x1ED6, - 0x00F40303: 0x1ED7, - 0x1ECC0302: 0x1ED8, - 0x1ECD0302: 0x1ED9, - 0x01A00301: 0x1EDA, - 0x01A10301: 0x1EDB, - 0x01A00300: 0x1EDC, - 0x01A10300: 0x1EDD, - 0x01A00309: 0x1EDE, - 0x01A10309: 0x1EDF, - 0x01A00303: 0x1EE0, - 0x01A10303: 0x1EE1, - 0x01A00323: 0x1EE2, - 0x01A10323: 0x1EE3, - 0x00550323: 0x1EE4, - 0x00750323: 0x1EE5, - 0x00550309: 0x1EE6, - 0x00750309: 0x1EE7, - 0x01AF0301: 0x1EE8, - 0x01B00301: 0x1EE9, - 0x01AF0300: 0x1EEA, - 0x01B00300: 0x1EEB, - 0x01AF0309: 0x1EEC, - 0x01B00309: 0x1EED, - 0x01AF0303: 0x1EEE, - 0x01B00303: 0x1EEF, - 0x01AF0323: 0x1EF0, - 0x01B00323: 0x1EF1, - 0x00590300: 0x1EF2, - 0x00790300: 0x1EF3, - 0x00590323: 0x1EF4, - 0x00790323: 0x1EF5, - 0x00590309: 0x1EF6, - 0x00790309: 0x1EF7, - 0x00590303: 0x1EF8, - 0x00790303: 0x1EF9, - 0x03B10313: 0x1F00, - 0x03B10314: 0x1F01, - 0x1F000300: 0x1F02, - 0x1F010300: 0x1F03, - 0x1F000301: 0x1F04, - 0x1F010301: 0x1F05, - 0x1F000342: 0x1F06, - 0x1F010342: 0x1F07, - 0x03910313: 0x1F08, - 0x03910314: 0x1F09, - 0x1F080300: 0x1F0A, - 0x1F090300: 0x1F0B, - 0x1F080301: 0x1F0C, - 0x1F090301: 0x1F0D, - 0x1F080342: 0x1F0E, - 0x1F090342: 0x1F0F, - 0x03B50313: 0x1F10, - 0x03B50314: 0x1F11, - 0x1F100300: 0x1F12, - 0x1F110300: 0x1F13, - 0x1F100301: 0x1F14, - 0x1F110301: 0x1F15, - 0x03950313: 0x1F18, - 0x03950314: 0x1F19, - 0x1F180300: 0x1F1A, - 0x1F190300: 0x1F1B, - 0x1F180301: 0x1F1C, - 0x1F190301: 0x1F1D, - 0x03B70313: 0x1F20, - 0x03B70314: 0x1F21, - 0x1F200300: 0x1F22, - 0x1F210300: 0x1F23, - 0x1F200301: 0x1F24, - 0x1F210301: 0x1F25, - 0x1F200342: 0x1F26, - 0x1F210342: 0x1F27, - 0x03970313: 0x1F28, - 0x03970314: 0x1F29, - 0x1F280300: 0x1F2A, - 0x1F290300: 0x1F2B, - 0x1F280301: 0x1F2C, - 0x1F290301: 0x1F2D, - 0x1F280342: 0x1F2E, - 0x1F290342: 0x1F2F, - 0x03B90313: 0x1F30, - 0x03B90314: 0x1F31, - 0x1F300300: 0x1F32, - 0x1F310300: 0x1F33, - 0x1F300301: 0x1F34, - 0x1F310301: 0x1F35, - 0x1F300342: 0x1F36, - 0x1F310342: 0x1F37, - 0x03990313: 0x1F38, - 0x03990314: 0x1F39, - 0x1F380300: 0x1F3A, - 0x1F390300: 0x1F3B, - 0x1F380301: 0x1F3C, - 0x1F390301: 0x1F3D, - 0x1F380342: 0x1F3E, - 0x1F390342: 0x1F3F, - 0x03BF0313: 0x1F40, - 0x03BF0314: 0x1F41, - 0x1F400300: 0x1F42, - 0x1F410300: 0x1F43, - 0x1F400301: 0x1F44, - 0x1F410301: 0x1F45, - 0x039F0313: 0x1F48, - 0x039F0314: 0x1F49, - 0x1F480300: 0x1F4A, - 0x1F490300: 0x1F4B, - 0x1F480301: 0x1F4C, - 0x1F490301: 0x1F4D, - 0x03C50313: 0x1F50, - 0x03C50314: 0x1F51, - 0x1F500300: 0x1F52, - 0x1F510300: 0x1F53, - 0x1F500301: 0x1F54, - 0x1F510301: 0x1F55, - 0x1F500342: 0x1F56, - 0x1F510342: 0x1F57, - 0x03A50314: 0x1F59, - 0x1F590300: 0x1F5B, - 0x1F590301: 0x1F5D, - 0x1F590342: 0x1F5F, - 0x03C90313: 0x1F60, - 0x03C90314: 0x1F61, - 0x1F600300: 0x1F62, - 0x1F610300: 0x1F63, - 0x1F600301: 0x1F64, - 0x1F610301: 0x1F65, - 0x1F600342: 0x1F66, - 0x1F610342: 0x1F67, - 0x03A90313: 0x1F68, - 0x03A90314: 0x1F69, - 0x1F680300: 0x1F6A, - 0x1F690300: 0x1F6B, - 0x1F680301: 0x1F6C, - 0x1F690301: 0x1F6D, - 0x1F680342: 0x1F6E, - 0x1F690342: 0x1F6F, - 0x03B10300: 0x1F70, - 0x03B50300: 0x1F72, - 0x03B70300: 0x1F74, - 0x03B90300: 0x1F76, - 0x03BF0300: 0x1F78, - 0x03C50300: 0x1F7A, - 0x03C90300: 0x1F7C, - 0x1F000345: 0x1F80, - 0x1F010345: 0x1F81, - 0x1F020345: 0x1F82, - 0x1F030345: 0x1F83, - 0x1F040345: 0x1F84, - 0x1F050345: 0x1F85, - 0x1F060345: 0x1F86, - 0x1F070345: 0x1F87, - 0x1F080345: 0x1F88, - 0x1F090345: 0x1F89, - 0x1F0A0345: 0x1F8A, - 0x1F0B0345: 0x1F8B, - 0x1F0C0345: 0x1F8C, - 0x1F0D0345: 0x1F8D, - 0x1F0E0345: 0x1F8E, - 0x1F0F0345: 0x1F8F, - 0x1F200345: 0x1F90, - 0x1F210345: 0x1F91, - 0x1F220345: 0x1F92, - 0x1F230345: 0x1F93, - 0x1F240345: 0x1F94, - 0x1F250345: 0x1F95, - 0x1F260345: 0x1F96, - 0x1F270345: 0x1F97, - 0x1F280345: 0x1F98, - 0x1F290345: 0x1F99, - 0x1F2A0345: 0x1F9A, - 0x1F2B0345: 0x1F9B, - 0x1F2C0345: 0x1F9C, - 0x1F2D0345: 0x1F9D, - 0x1F2E0345: 0x1F9E, - 0x1F2F0345: 0x1F9F, - 0x1F600345: 0x1FA0, - 0x1F610345: 0x1FA1, - 0x1F620345: 0x1FA2, - 0x1F630345: 0x1FA3, - 0x1F640345: 0x1FA4, - 0x1F650345: 0x1FA5, - 0x1F660345: 0x1FA6, - 0x1F670345: 0x1FA7, - 0x1F680345: 0x1FA8, - 0x1F690345: 0x1FA9, - 0x1F6A0345: 0x1FAA, - 0x1F6B0345: 0x1FAB, - 0x1F6C0345: 0x1FAC, - 0x1F6D0345: 0x1FAD, - 0x1F6E0345: 0x1FAE, - 0x1F6F0345: 0x1FAF, - 0x03B10306: 0x1FB0, - 0x03B10304: 0x1FB1, - 0x1F700345: 0x1FB2, - 0x03B10345: 0x1FB3, - 0x03AC0345: 0x1FB4, - 0x03B10342: 0x1FB6, - 0x1FB60345: 0x1FB7, - 0x03910306: 0x1FB8, - 0x03910304: 0x1FB9, - 0x03910300: 0x1FBA, - 0x03910345: 0x1FBC, - 0x00A80342: 0x1FC1, - 0x1F740345: 0x1FC2, - 0x03B70345: 0x1FC3, - 0x03AE0345: 0x1FC4, - 0x03B70342: 0x1FC6, - 0x1FC60345: 0x1FC7, - 0x03950300: 0x1FC8, - 0x03970300: 0x1FCA, - 0x03970345: 0x1FCC, - 0x1FBF0300: 0x1FCD, - 0x1FBF0301: 0x1FCE, - 0x1FBF0342: 0x1FCF, - 0x03B90306: 0x1FD0, - 0x03B90304: 0x1FD1, - 0x03CA0300: 0x1FD2, - 0x03B90342: 0x1FD6, - 0x03CA0342: 0x1FD7, - 0x03990306: 0x1FD8, - 0x03990304: 0x1FD9, - 0x03990300: 0x1FDA, - 0x1FFE0300: 0x1FDD, - 0x1FFE0301: 0x1FDE, - 0x1FFE0342: 0x1FDF, - 0x03C50306: 0x1FE0, - 0x03C50304: 0x1FE1, - 0x03CB0300: 0x1FE2, - 0x03C10313: 0x1FE4, - 0x03C10314: 0x1FE5, - 0x03C50342: 0x1FE6, - 0x03CB0342: 0x1FE7, - 0x03A50306: 0x1FE8, - 0x03A50304: 0x1FE9, - 0x03A50300: 0x1FEA, - 0x03A10314: 0x1FEC, - 0x00A80300: 0x1FED, - 0x1F7C0345: 0x1FF2, - 0x03C90345: 0x1FF3, - 0x03CE0345: 0x1FF4, - 0x03C90342: 0x1FF6, - 0x1FF60345: 0x1FF7, - 0x039F0300: 0x1FF8, - 0x03A90300: 0x1FFA, - 0x03A90345: 0x1FFC, - 0x21900338: 0x219A, - 0x21920338: 0x219B, - 0x21940338: 0x21AE, - 0x21D00338: 0x21CD, - 0x21D40338: 0x21CE, - 0x21D20338: 0x21CF, - 0x22030338: 0x2204, - 0x22080338: 0x2209, - 0x220B0338: 0x220C, - 0x22230338: 0x2224, - 0x22250338: 0x2226, - 0x223C0338: 0x2241, - 0x22430338: 0x2244, - 0x22450338: 0x2247, - 0x22480338: 0x2249, - 0x003D0338: 0x2260, - 0x22610338: 0x2262, - 0x224D0338: 0x226D, - 0x003C0338: 0x226E, - 0x003E0338: 0x226F, - 0x22640338: 0x2270, - 0x22650338: 0x2271, - 0x22720338: 0x2274, - 0x22730338: 0x2275, - 0x22760338: 0x2278, - 0x22770338: 0x2279, - 0x227A0338: 0x2280, - 0x227B0338: 0x2281, - 0x22820338: 0x2284, - 0x22830338: 0x2285, - 0x22860338: 0x2288, - 0x22870338: 0x2289, - 0x22A20338: 0x22AC, - 0x22A80338: 0x22AD, - 0x22A90338: 0x22AE, - 0x22AB0338: 0x22AF, - 0x227C0338: 0x22E0, - 0x227D0338: 0x22E1, - 0x22910338: 0x22E2, - 0x22920338: 0x22E3, - 0x22B20338: 0x22EA, - 0x22B30338: 0x22EB, - 0x22B40338: 0x22EC, - 0x22B50338: 0x22ED, - 0x304B3099: 0x304C, - 0x304D3099: 0x304E, - 0x304F3099: 0x3050, - 0x30513099: 0x3052, - 0x30533099: 0x3054, - 0x30553099: 0x3056, - 0x30573099: 0x3058, - 0x30593099: 0x305A, - 0x305B3099: 0x305C, - 0x305D3099: 0x305E, - 0x305F3099: 0x3060, - 0x30613099: 0x3062, - 0x30643099: 0x3065, - 0x30663099: 0x3067, - 0x30683099: 0x3069, - 0x306F3099: 0x3070, - 0x306F309A: 0x3071, - 0x30723099: 0x3073, - 0x3072309A: 0x3074, - 0x30753099: 0x3076, - 0x3075309A: 0x3077, - 0x30783099: 0x3079, - 0x3078309A: 0x307A, - 0x307B3099: 0x307C, - 0x307B309A: 0x307D, - 0x30463099: 0x3094, - 0x309D3099: 0x309E, - 0x30AB3099: 0x30AC, - 0x30AD3099: 0x30AE, - 0x30AF3099: 0x30B0, - 0x30B13099: 0x30B2, - 0x30B33099: 0x30B4, - 0x30B53099: 0x30B6, - 0x30B73099: 0x30B8, - 0x30B93099: 0x30BA, - 0x30BB3099: 0x30BC, - 0x30BD3099: 0x30BE, - 0x30BF3099: 0x30C0, - 0x30C13099: 0x30C2, - 0x30C43099: 0x30C5, - 0x30C63099: 0x30C7, - 0x30C83099: 0x30C9, - 0x30CF3099: 0x30D0, - 0x30CF309A: 0x30D1, - 0x30D23099: 0x30D3, - 0x30D2309A: 0x30D4, - 0x30D53099: 0x30D6, - 0x30D5309A: 0x30D7, - 0x30D83099: 0x30D9, - 0x30D8309A: 0x30DA, - 0x30DB3099: 0x30DC, - 0x30DB309A: 0x30DD, - 0x30A63099: 0x30F4, - 0x30EF3099: 0x30F7, - 0x30F03099: 0x30F8, - 0x30F13099: 0x30F9, - 0x30F23099: 0x30FA, - 0x30FD3099: 0x30FE, - 0x109910BA: 0x1109A, - 0x109B10BA: 0x1109C, - 0x10A510BA: 0x110AB, - 0x11311127: 0x1112E, - 0x11321127: 0x1112F, - 0x1347133E: 0x1134B, - 0x13471357: 0x1134C, - 0x14B914BA: 0x114BB, - 0x14B914B0: 0x114BC, - 0x14B914BD: 0x114BE, - 0x15B815AF: 0x115BA, - 0x15B915AF: 0x115BB, -} +var recompMap map[uint32]rune +var recompMapOnce sync.Once -// Total size of tables: 53KB (54006 bytes) +const recompMapPacked = "" + + "\x00A\x03\x00\x00\x00\x00\xc0" + // 0x00410300: 0x000000C0 + "\x00A\x03\x01\x00\x00\x00\xc1" + // 0x00410301: 0x000000C1 + "\x00A\x03\x02\x00\x00\x00\xc2" + // 0x00410302: 0x000000C2 + "\x00A\x03\x03\x00\x00\x00\xc3" + // 0x00410303: 0x000000C3 + "\x00A\x03\b\x00\x00\x00\xc4" + // 0x00410308: 0x000000C4 + "\x00A\x03\n\x00\x00\x00\xc5" + // 0x0041030A: 0x000000C5 + "\x00C\x03'\x00\x00\x00\xc7" + // 0x00430327: 0x000000C7 + "\x00E\x03\x00\x00\x00\x00\xc8" + // 0x00450300: 0x000000C8 + "\x00E\x03\x01\x00\x00\x00\xc9" + // 0x00450301: 0x000000C9 + "\x00E\x03\x02\x00\x00\x00\xca" + // 0x00450302: 0x000000CA + "\x00E\x03\b\x00\x00\x00\xcb" + // 0x00450308: 0x000000CB + "\x00I\x03\x00\x00\x00\x00\xcc" + // 0x00490300: 0x000000CC + "\x00I\x03\x01\x00\x00\x00\xcd" + // 0x00490301: 0x000000CD + "\x00I\x03\x02\x00\x00\x00\xce" + // 0x00490302: 0x000000CE + "\x00I\x03\b\x00\x00\x00\xcf" + // 0x00490308: 0x000000CF + "\x00N\x03\x03\x00\x00\x00\xd1" + // 0x004E0303: 0x000000D1 + "\x00O\x03\x00\x00\x00\x00\xd2" + // 0x004F0300: 0x000000D2 + "\x00O\x03\x01\x00\x00\x00\xd3" + // 0x004F0301: 0x000000D3 + "\x00O\x03\x02\x00\x00\x00\xd4" + // 0x004F0302: 0x000000D4 + "\x00O\x03\x03\x00\x00\x00\xd5" + // 0x004F0303: 0x000000D5 + "\x00O\x03\b\x00\x00\x00\xd6" + // 0x004F0308: 0x000000D6 + "\x00U\x03\x00\x00\x00\x00\xd9" + // 0x00550300: 0x000000D9 + "\x00U\x03\x01\x00\x00\x00\xda" + // 0x00550301: 0x000000DA + "\x00U\x03\x02\x00\x00\x00\xdb" + // 0x00550302: 0x000000DB + "\x00U\x03\b\x00\x00\x00\xdc" + // 0x00550308: 0x000000DC + "\x00Y\x03\x01\x00\x00\x00\xdd" + // 0x00590301: 0x000000DD + "\x00a\x03\x00\x00\x00\x00\xe0" + // 0x00610300: 0x000000E0 + "\x00a\x03\x01\x00\x00\x00\xe1" + // 0x00610301: 0x000000E1 + "\x00a\x03\x02\x00\x00\x00\xe2" + // 0x00610302: 0x000000E2 + "\x00a\x03\x03\x00\x00\x00\xe3" + // 0x00610303: 0x000000E3 + "\x00a\x03\b\x00\x00\x00\xe4" + // 0x00610308: 0x000000E4 + "\x00a\x03\n\x00\x00\x00\xe5" + // 0x0061030A: 0x000000E5 + "\x00c\x03'\x00\x00\x00\xe7" + // 0x00630327: 0x000000E7 + "\x00e\x03\x00\x00\x00\x00\xe8" + // 0x00650300: 0x000000E8 + "\x00e\x03\x01\x00\x00\x00\xe9" + // 0x00650301: 0x000000E9 + "\x00e\x03\x02\x00\x00\x00\xea" + // 0x00650302: 0x000000EA + "\x00e\x03\b\x00\x00\x00\xeb" + // 0x00650308: 0x000000EB + "\x00i\x03\x00\x00\x00\x00\xec" + // 0x00690300: 0x000000EC + "\x00i\x03\x01\x00\x00\x00\xed" + // 0x00690301: 0x000000ED + "\x00i\x03\x02\x00\x00\x00\xee" + // 0x00690302: 0x000000EE + "\x00i\x03\b\x00\x00\x00\xef" + // 0x00690308: 0x000000EF + "\x00n\x03\x03\x00\x00\x00\xf1" + // 0x006E0303: 0x000000F1 + "\x00o\x03\x00\x00\x00\x00\xf2" + // 0x006F0300: 0x000000F2 + "\x00o\x03\x01\x00\x00\x00\xf3" + // 0x006F0301: 0x000000F3 + "\x00o\x03\x02\x00\x00\x00\xf4" + // 0x006F0302: 0x000000F4 + "\x00o\x03\x03\x00\x00\x00\xf5" + // 0x006F0303: 0x000000F5 + "\x00o\x03\b\x00\x00\x00\xf6" + // 0x006F0308: 0x000000F6 + "\x00u\x03\x00\x00\x00\x00\xf9" + // 0x00750300: 0x000000F9 + "\x00u\x03\x01\x00\x00\x00\xfa" + // 0x00750301: 0x000000FA + "\x00u\x03\x02\x00\x00\x00\xfb" + // 0x00750302: 0x000000FB + "\x00u\x03\b\x00\x00\x00\xfc" + // 0x00750308: 0x000000FC + "\x00y\x03\x01\x00\x00\x00\xfd" + // 0x00790301: 0x000000FD + "\x00y\x03\b\x00\x00\x00\xff" + // 0x00790308: 0x000000FF + "\x00A\x03\x04\x00\x00\x01\x00" + // 0x00410304: 0x00000100 + "\x00a\x03\x04\x00\x00\x01\x01" + // 0x00610304: 0x00000101 + "\x00A\x03\x06\x00\x00\x01\x02" + // 0x00410306: 0x00000102 + "\x00a\x03\x06\x00\x00\x01\x03" + // 0x00610306: 0x00000103 + "\x00A\x03(\x00\x00\x01\x04" + // 0x00410328: 0x00000104 + "\x00a\x03(\x00\x00\x01\x05" + // 0x00610328: 0x00000105 + "\x00C\x03\x01\x00\x00\x01\x06" + // 0x00430301: 0x00000106 + "\x00c\x03\x01\x00\x00\x01\a" + // 0x00630301: 0x00000107 + "\x00C\x03\x02\x00\x00\x01\b" + // 0x00430302: 0x00000108 + "\x00c\x03\x02\x00\x00\x01\t" + // 0x00630302: 0x00000109 + "\x00C\x03\a\x00\x00\x01\n" + // 0x00430307: 0x0000010A + "\x00c\x03\a\x00\x00\x01\v" + // 0x00630307: 0x0000010B + "\x00C\x03\f\x00\x00\x01\f" + // 0x0043030C: 0x0000010C + "\x00c\x03\f\x00\x00\x01\r" + // 0x0063030C: 0x0000010D + "\x00D\x03\f\x00\x00\x01\x0e" + // 0x0044030C: 0x0000010E + "\x00d\x03\f\x00\x00\x01\x0f" + // 0x0064030C: 0x0000010F + "\x00E\x03\x04\x00\x00\x01\x12" + // 0x00450304: 0x00000112 + "\x00e\x03\x04\x00\x00\x01\x13" + // 0x00650304: 0x00000113 + "\x00E\x03\x06\x00\x00\x01\x14" + // 0x00450306: 0x00000114 + "\x00e\x03\x06\x00\x00\x01\x15" + // 0x00650306: 0x00000115 + "\x00E\x03\a\x00\x00\x01\x16" + // 0x00450307: 0x00000116 + "\x00e\x03\a\x00\x00\x01\x17" + // 0x00650307: 0x00000117 + "\x00E\x03(\x00\x00\x01\x18" + // 0x00450328: 0x00000118 + "\x00e\x03(\x00\x00\x01\x19" + // 0x00650328: 0x00000119 + "\x00E\x03\f\x00\x00\x01\x1a" + // 0x0045030C: 0x0000011A + "\x00e\x03\f\x00\x00\x01\x1b" + // 0x0065030C: 0x0000011B + "\x00G\x03\x02\x00\x00\x01\x1c" + // 0x00470302: 0x0000011C + "\x00g\x03\x02\x00\x00\x01\x1d" + // 0x00670302: 0x0000011D + "\x00G\x03\x06\x00\x00\x01\x1e" + // 0x00470306: 0x0000011E + "\x00g\x03\x06\x00\x00\x01\x1f" + // 0x00670306: 0x0000011F + "\x00G\x03\a\x00\x00\x01 " + // 0x00470307: 0x00000120 + "\x00g\x03\a\x00\x00\x01!" + // 0x00670307: 0x00000121 + "\x00G\x03'\x00\x00\x01\"" + // 0x00470327: 0x00000122 + "\x00g\x03'\x00\x00\x01#" + // 0x00670327: 0x00000123 + "\x00H\x03\x02\x00\x00\x01$" + // 0x00480302: 0x00000124 + "\x00h\x03\x02\x00\x00\x01%" + // 0x00680302: 0x00000125 + "\x00I\x03\x03\x00\x00\x01(" + // 0x00490303: 0x00000128 + "\x00i\x03\x03\x00\x00\x01)" + // 0x00690303: 0x00000129 + "\x00I\x03\x04\x00\x00\x01*" + // 0x00490304: 0x0000012A + "\x00i\x03\x04\x00\x00\x01+" + // 0x00690304: 0x0000012B + "\x00I\x03\x06\x00\x00\x01," + // 0x00490306: 0x0000012C + "\x00i\x03\x06\x00\x00\x01-" + // 0x00690306: 0x0000012D + "\x00I\x03(\x00\x00\x01." + // 0x00490328: 0x0000012E + "\x00i\x03(\x00\x00\x01/" + // 0x00690328: 0x0000012F + "\x00I\x03\a\x00\x00\x010" + // 0x00490307: 0x00000130 + "\x00J\x03\x02\x00\x00\x014" + // 0x004A0302: 0x00000134 + "\x00j\x03\x02\x00\x00\x015" + // 0x006A0302: 0x00000135 + "\x00K\x03'\x00\x00\x016" + // 0x004B0327: 0x00000136 + "\x00k\x03'\x00\x00\x017" + // 0x006B0327: 0x00000137 + "\x00L\x03\x01\x00\x00\x019" + // 0x004C0301: 0x00000139 + "\x00l\x03\x01\x00\x00\x01:" + // 0x006C0301: 0x0000013A + "\x00L\x03'\x00\x00\x01;" + // 0x004C0327: 0x0000013B + "\x00l\x03'\x00\x00\x01<" + // 0x006C0327: 0x0000013C + "\x00L\x03\f\x00\x00\x01=" + // 0x004C030C: 0x0000013D + "\x00l\x03\f\x00\x00\x01>" + // 0x006C030C: 0x0000013E + "\x00N\x03\x01\x00\x00\x01C" + // 0x004E0301: 0x00000143 + "\x00n\x03\x01\x00\x00\x01D" + // 0x006E0301: 0x00000144 + "\x00N\x03'\x00\x00\x01E" + // 0x004E0327: 0x00000145 + "\x00n\x03'\x00\x00\x01F" + // 0x006E0327: 0x00000146 + "\x00N\x03\f\x00\x00\x01G" + // 0x004E030C: 0x00000147 + "\x00n\x03\f\x00\x00\x01H" + // 0x006E030C: 0x00000148 + "\x00O\x03\x04\x00\x00\x01L" + // 0x004F0304: 0x0000014C + "\x00o\x03\x04\x00\x00\x01M" + // 0x006F0304: 0x0000014D + "\x00O\x03\x06\x00\x00\x01N" + // 0x004F0306: 0x0000014E + "\x00o\x03\x06\x00\x00\x01O" + // 0x006F0306: 0x0000014F + "\x00O\x03\v\x00\x00\x01P" + // 0x004F030B: 0x00000150 + "\x00o\x03\v\x00\x00\x01Q" + // 0x006F030B: 0x00000151 + "\x00R\x03\x01\x00\x00\x01T" + // 0x00520301: 0x00000154 + "\x00r\x03\x01\x00\x00\x01U" + // 0x00720301: 0x00000155 + "\x00R\x03'\x00\x00\x01V" + // 0x00520327: 0x00000156 + "\x00r\x03'\x00\x00\x01W" + // 0x00720327: 0x00000157 + "\x00R\x03\f\x00\x00\x01X" + // 0x0052030C: 0x00000158 + "\x00r\x03\f\x00\x00\x01Y" + // 0x0072030C: 0x00000159 + "\x00S\x03\x01\x00\x00\x01Z" + // 0x00530301: 0x0000015A + "\x00s\x03\x01\x00\x00\x01[" + // 0x00730301: 0x0000015B + "\x00S\x03\x02\x00\x00\x01\\" + // 0x00530302: 0x0000015C + "\x00s\x03\x02\x00\x00\x01]" + // 0x00730302: 0x0000015D + "\x00S\x03'\x00\x00\x01^" + // 0x00530327: 0x0000015E + "\x00s\x03'\x00\x00\x01_" + // 0x00730327: 0x0000015F + "\x00S\x03\f\x00\x00\x01`" + // 0x0053030C: 0x00000160 + "\x00s\x03\f\x00\x00\x01a" + // 0x0073030C: 0x00000161 + "\x00T\x03'\x00\x00\x01b" + // 0x00540327: 0x00000162 + "\x00t\x03'\x00\x00\x01c" + // 0x00740327: 0x00000163 + "\x00T\x03\f\x00\x00\x01d" + // 0x0054030C: 0x00000164 + "\x00t\x03\f\x00\x00\x01e" + // 0x0074030C: 0x00000165 + "\x00U\x03\x03\x00\x00\x01h" + // 0x00550303: 0x00000168 + "\x00u\x03\x03\x00\x00\x01i" + // 0x00750303: 0x00000169 + "\x00U\x03\x04\x00\x00\x01j" + // 0x00550304: 0x0000016A + "\x00u\x03\x04\x00\x00\x01k" + // 0x00750304: 0x0000016B + "\x00U\x03\x06\x00\x00\x01l" + // 0x00550306: 0x0000016C + "\x00u\x03\x06\x00\x00\x01m" + // 0x00750306: 0x0000016D + "\x00U\x03\n\x00\x00\x01n" + // 0x0055030A: 0x0000016E + "\x00u\x03\n\x00\x00\x01o" + // 0x0075030A: 0x0000016F + "\x00U\x03\v\x00\x00\x01p" + // 0x0055030B: 0x00000170 + "\x00u\x03\v\x00\x00\x01q" + // 0x0075030B: 0x00000171 + "\x00U\x03(\x00\x00\x01r" + // 0x00550328: 0x00000172 + "\x00u\x03(\x00\x00\x01s" + // 0x00750328: 0x00000173 + "\x00W\x03\x02\x00\x00\x01t" + // 0x00570302: 0x00000174 + "\x00w\x03\x02\x00\x00\x01u" + // 0x00770302: 0x00000175 + "\x00Y\x03\x02\x00\x00\x01v" + // 0x00590302: 0x00000176 + "\x00y\x03\x02\x00\x00\x01w" + // 0x00790302: 0x00000177 + "\x00Y\x03\b\x00\x00\x01x" + // 0x00590308: 0x00000178 + "\x00Z\x03\x01\x00\x00\x01y" + // 0x005A0301: 0x00000179 + "\x00z\x03\x01\x00\x00\x01z" + // 0x007A0301: 0x0000017A + "\x00Z\x03\a\x00\x00\x01{" + // 0x005A0307: 0x0000017B + "\x00z\x03\a\x00\x00\x01|" + // 0x007A0307: 0x0000017C + "\x00Z\x03\f\x00\x00\x01}" + // 0x005A030C: 0x0000017D + "\x00z\x03\f\x00\x00\x01~" + // 0x007A030C: 0x0000017E + "\x00O\x03\x1b\x00\x00\x01\xa0" + // 0x004F031B: 0x000001A0 + "\x00o\x03\x1b\x00\x00\x01\xa1" + // 0x006F031B: 0x000001A1 + "\x00U\x03\x1b\x00\x00\x01\xaf" + // 0x0055031B: 0x000001AF + "\x00u\x03\x1b\x00\x00\x01\xb0" + // 0x0075031B: 0x000001B0 + "\x00A\x03\f\x00\x00\x01\xcd" + // 0x0041030C: 0x000001CD + "\x00a\x03\f\x00\x00\x01\xce" + // 0x0061030C: 0x000001CE + "\x00I\x03\f\x00\x00\x01\xcf" + // 0x0049030C: 0x000001CF + "\x00i\x03\f\x00\x00\x01\xd0" + // 0x0069030C: 0x000001D0 + "\x00O\x03\f\x00\x00\x01\xd1" + // 0x004F030C: 0x000001D1 + "\x00o\x03\f\x00\x00\x01\xd2" + // 0x006F030C: 0x000001D2 + "\x00U\x03\f\x00\x00\x01\xd3" + // 0x0055030C: 0x000001D3 + "\x00u\x03\f\x00\x00\x01\xd4" + // 0x0075030C: 0x000001D4 + "\x00\xdc\x03\x04\x00\x00\x01\xd5" + // 0x00DC0304: 0x000001D5 + "\x00\xfc\x03\x04\x00\x00\x01\xd6" + // 0x00FC0304: 0x000001D6 + "\x00\xdc\x03\x01\x00\x00\x01\xd7" + // 0x00DC0301: 0x000001D7 + "\x00\xfc\x03\x01\x00\x00\x01\xd8" + // 0x00FC0301: 0x000001D8 + "\x00\xdc\x03\f\x00\x00\x01\xd9" + // 0x00DC030C: 0x000001D9 + "\x00\xfc\x03\f\x00\x00\x01\xda" + // 0x00FC030C: 0x000001DA + "\x00\xdc\x03\x00\x00\x00\x01\xdb" + // 0x00DC0300: 0x000001DB + "\x00\xfc\x03\x00\x00\x00\x01\xdc" + // 0x00FC0300: 0x000001DC + "\x00\xc4\x03\x04\x00\x00\x01\xde" + // 0x00C40304: 0x000001DE + "\x00\xe4\x03\x04\x00\x00\x01\xdf" + // 0x00E40304: 0x000001DF + "\x02&\x03\x04\x00\x00\x01\xe0" + // 0x02260304: 0x000001E0 + "\x02'\x03\x04\x00\x00\x01\xe1" + // 0x02270304: 0x000001E1 + "\x00\xc6\x03\x04\x00\x00\x01\xe2" + // 0x00C60304: 0x000001E2 + "\x00\xe6\x03\x04\x00\x00\x01\xe3" + // 0x00E60304: 0x000001E3 + "\x00G\x03\f\x00\x00\x01\xe6" + // 0x0047030C: 0x000001E6 + "\x00g\x03\f\x00\x00\x01\xe7" + // 0x0067030C: 0x000001E7 + "\x00K\x03\f\x00\x00\x01\xe8" + // 0x004B030C: 0x000001E8 + "\x00k\x03\f\x00\x00\x01\xe9" + // 0x006B030C: 0x000001E9 + "\x00O\x03(\x00\x00\x01\xea" + // 0x004F0328: 0x000001EA + "\x00o\x03(\x00\x00\x01\xeb" + // 0x006F0328: 0x000001EB + "\x01\xea\x03\x04\x00\x00\x01\xec" + // 0x01EA0304: 0x000001EC + "\x01\xeb\x03\x04\x00\x00\x01\xed" + // 0x01EB0304: 0x000001ED + "\x01\xb7\x03\f\x00\x00\x01\xee" + // 0x01B7030C: 0x000001EE + "\x02\x92\x03\f\x00\x00\x01\xef" + // 0x0292030C: 0x000001EF + "\x00j\x03\f\x00\x00\x01\xf0" + // 0x006A030C: 0x000001F0 + "\x00G\x03\x01\x00\x00\x01\xf4" + // 0x00470301: 0x000001F4 + "\x00g\x03\x01\x00\x00\x01\xf5" + // 0x00670301: 0x000001F5 + "\x00N\x03\x00\x00\x00\x01\xf8" + // 0x004E0300: 0x000001F8 + "\x00n\x03\x00\x00\x00\x01\xf9" + // 0x006E0300: 0x000001F9 + "\x00\xc5\x03\x01\x00\x00\x01\xfa" + // 0x00C50301: 0x000001FA + "\x00\xe5\x03\x01\x00\x00\x01\xfb" + // 0x00E50301: 0x000001FB + "\x00\xc6\x03\x01\x00\x00\x01\xfc" + // 0x00C60301: 0x000001FC + "\x00\xe6\x03\x01\x00\x00\x01\xfd" + // 0x00E60301: 0x000001FD + "\x00\xd8\x03\x01\x00\x00\x01\xfe" + // 0x00D80301: 0x000001FE + "\x00\xf8\x03\x01\x00\x00\x01\xff" + // 0x00F80301: 0x000001FF + "\x00A\x03\x0f\x00\x00\x02\x00" + // 0x0041030F: 0x00000200 + "\x00a\x03\x0f\x00\x00\x02\x01" + // 0x0061030F: 0x00000201 + "\x00A\x03\x11\x00\x00\x02\x02" + // 0x00410311: 0x00000202 + "\x00a\x03\x11\x00\x00\x02\x03" + // 0x00610311: 0x00000203 + "\x00E\x03\x0f\x00\x00\x02\x04" + // 0x0045030F: 0x00000204 + "\x00e\x03\x0f\x00\x00\x02\x05" + // 0x0065030F: 0x00000205 + "\x00E\x03\x11\x00\x00\x02\x06" + // 0x00450311: 0x00000206 + "\x00e\x03\x11\x00\x00\x02\a" + // 0x00650311: 0x00000207 + "\x00I\x03\x0f\x00\x00\x02\b" + // 0x0049030F: 0x00000208 + "\x00i\x03\x0f\x00\x00\x02\t" + // 0x0069030F: 0x00000209 + "\x00I\x03\x11\x00\x00\x02\n" + // 0x00490311: 0x0000020A + "\x00i\x03\x11\x00\x00\x02\v" + // 0x00690311: 0x0000020B + "\x00O\x03\x0f\x00\x00\x02\f" + // 0x004F030F: 0x0000020C + "\x00o\x03\x0f\x00\x00\x02\r" + // 0x006F030F: 0x0000020D + "\x00O\x03\x11\x00\x00\x02\x0e" + // 0x004F0311: 0x0000020E + "\x00o\x03\x11\x00\x00\x02\x0f" + // 0x006F0311: 0x0000020F + "\x00R\x03\x0f\x00\x00\x02\x10" + // 0x0052030F: 0x00000210 + "\x00r\x03\x0f\x00\x00\x02\x11" + // 0x0072030F: 0x00000211 + "\x00R\x03\x11\x00\x00\x02\x12" + // 0x00520311: 0x00000212 + "\x00r\x03\x11\x00\x00\x02\x13" + // 0x00720311: 0x00000213 + "\x00U\x03\x0f\x00\x00\x02\x14" + // 0x0055030F: 0x00000214 + "\x00u\x03\x0f\x00\x00\x02\x15" + // 0x0075030F: 0x00000215 + "\x00U\x03\x11\x00\x00\x02\x16" + // 0x00550311: 0x00000216 + "\x00u\x03\x11\x00\x00\x02\x17" + // 0x00750311: 0x00000217 + "\x00S\x03&\x00\x00\x02\x18" + // 0x00530326: 0x00000218 + "\x00s\x03&\x00\x00\x02\x19" + // 0x00730326: 0x00000219 + "\x00T\x03&\x00\x00\x02\x1a" + // 0x00540326: 0x0000021A + "\x00t\x03&\x00\x00\x02\x1b" + // 0x00740326: 0x0000021B + "\x00H\x03\f\x00\x00\x02\x1e" + // 0x0048030C: 0x0000021E + "\x00h\x03\f\x00\x00\x02\x1f" + // 0x0068030C: 0x0000021F + "\x00A\x03\a\x00\x00\x02&" + // 0x00410307: 0x00000226 + "\x00a\x03\a\x00\x00\x02'" + // 0x00610307: 0x00000227 + "\x00E\x03'\x00\x00\x02(" + // 0x00450327: 0x00000228 + "\x00e\x03'\x00\x00\x02)" + // 0x00650327: 0x00000229 + "\x00\xd6\x03\x04\x00\x00\x02*" + // 0x00D60304: 0x0000022A + "\x00\xf6\x03\x04\x00\x00\x02+" + // 0x00F60304: 0x0000022B + "\x00\xd5\x03\x04\x00\x00\x02," + // 0x00D50304: 0x0000022C + "\x00\xf5\x03\x04\x00\x00\x02-" + // 0x00F50304: 0x0000022D + "\x00O\x03\a\x00\x00\x02." + // 0x004F0307: 0x0000022E + "\x00o\x03\a\x00\x00\x02/" + // 0x006F0307: 0x0000022F + "\x02.\x03\x04\x00\x00\x020" + // 0x022E0304: 0x00000230 + "\x02/\x03\x04\x00\x00\x021" + // 0x022F0304: 0x00000231 + "\x00Y\x03\x04\x00\x00\x022" + // 0x00590304: 0x00000232 + "\x00y\x03\x04\x00\x00\x023" + // 0x00790304: 0x00000233 + "\x00\xa8\x03\x01\x00\x00\x03\x85" + // 0x00A80301: 0x00000385 + "\x03\x91\x03\x01\x00\x00\x03\x86" + // 0x03910301: 0x00000386 + "\x03\x95\x03\x01\x00\x00\x03\x88" + // 0x03950301: 0x00000388 + "\x03\x97\x03\x01\x00\x00\x03\x89" + // 0x03970301: 0x00000389 + "\x03\x99\x03\x01\x00\x00\x03\x8a" + // 0x03990301: 0x0000038A + "\x03\x9f\x03\x01\x00\x00\x03\x8c" + // 0x039F0301: 0x0000038C + "\x03\xa5\x03\x01\x00\x00\x03\x8e" + // 0x03A50301: 0x0000038E + "\x03\xa9\x03\x01\x00\x00\x03\x8f" + // 0x03A90301: 0x0000038F + "\x03\xca\x03\x01\x00\x00\x03\x90" + // 0x03CA0301: 0x00000390 + "\x03\x99\x03\b\x00\x00\x03\xaa" + // 0x03990308: 0x000003AA + "\x03\xa5\x03\b\x00\x00\x03\xab" + // 0x03A50308: 0x000003AB + "\x03\xb1\x03\x01\x00\x00\x03\xac" + // 0x03B10301: 0x000003AC + "\x03\xb5\x03\x01\x00\x00\x03\xad" + // 0x03B50301: 0x000003AD + "\x03\xb7\x03\x01\x00\x00\x03\xae" + // 0x03B70301: 0x000003AE + "\x03\xb9\x03\x01\x00\x00\x03\xaf" + // 0x03B90301: 0x000003AF + "\x03\xcb\x03\x01\x00\x00\x03\xb0" + // 0x03CB0301: 0x000003B0 + "\x03\xb9\x03\b\x00\x00\x03\xca" + // 0x03B90308: 0x000003CA + "\x03\xc5\x03\b\x00\x00\x03\xcb" + // 0x03C50308: 0x000003CB + "\x03\xbf\x03\x01\x00\x00\x03\xcc" + // 0x03BF0301: 0x000003CC + "\x03\xc5\x03\x01\x00\x00\x03\xcd" + // 0x03C50301: 0x000003CD + "\x03\xc9\x03\x01\x00\x00\x03\xce" + // 0x03C90301: 0x000003CE + "\x03\xd2\x03\x01\x00\x00\x03\xd3" + // 0x03D20301: 0x000003D3 + "\x03\xd2\x03\b\x00\x00\x03\xd4" + // 0x03D20308: 0x000003D4 + "\x04\x15\x03\x00\x00\x00\x04\x00" + // 0x04150300: 0x00000400 + "\x04\x15\x03\b\x00\x00\x04\x01" + // 0x04150308: 0x00000401 + "\x04\x13\x03\x01\x00\x00\x04\x03" + // 0x04130301: 0x00000403 + "\x04\x06\x03\b\x00\x00\x04\a" + // 0x04060308: 0x00000407 + "\x04\x1a\x03\x01\x00\x00\x04\f" + // 0x041A0301: 0x0000040C + "\x04\x18\x03\x00\x00\x00\x04\r" + // 0x04180300: 0x0000040D + "\x04#\x03\x06\x00\x00\x04\x0e" + // 0x04230306: 0x0000040E + "\x04\x18\x03\x06\x00\x00\x04\x19" + // 0x04180306: 0x00000419 + "\x048\x03\x06\x00\x00\x049" + // 0x04380306: 0x00000439 + "\x045\x03\x00\x00\x00\x04P" + // 0x04350300: 0x00000450 + "\x045\x03\b\x00\x00\x04Q" + // 0x04350308: 0x00000451 + "\x043\x03\x01\x00\x00\x04S" + // 0x04330301: 0x00000453 + "\x04V\x03\b\x00\x00\x04W" + // 0x04560308: 0x00000457 + "\x04:\x03\x01\x00\x00\x04\\" + // 0x043A0301: 0x0000045C + "\x048\x03\x00\x00\x00\x04]" + // 0x04380300: 0x0000045D + "\x04C\x03\x06\x00\x00\x04^" + // 0x04430306: 0x0000045E + "\x04t\x03\x0f\x00\x00\x04v" + // 0x0474030F: 0x00000476 + "\x04u\x03\x0f\x00\x00\x04w" + // 0x0475030F: 0x00000477 + "\x04\x16\x03\x06\x00\x00\x04\xc1" + // 0x04160306: 0x000004C1 + "\x046\x03\x06\x00\x00\x04\xc2" + // 0x04360306: 0x000004C2 + "\x04\x10\x03\x06\x00\x00\x04\xd0" + // 0x04100306: 0x000004D0 + "\x040\x03\x06\x00\x00\x04\xd1" + // 0x04300306: 0x000004D1 + "\x04\x10\x03\b\x00\x00\x04\xd2" + // 0x04100308: 0x000004D2 + "\x040\x03\b\x00\x00\x04\xd3" + // 0x04300308: 0x000004D3 + "\x04\x15\x03\x06\x00\x00\x04\xd6" + // 0x04150306: 0x000004D6 + "\x045\x03\x06\x00\x00\x04\xd7" + // 0x04350306: 0x000004D7 + "\x04\xd8\x03\b\x00\x00\x04\xda" + // 0x04D80308: 0x000004DA + "\x04\xd9\x03\b\x00\x00\x04\xdb" + // 0x04D90308: 0x000004DB + "\x04\x16\x03\b\x00\x00\x04\xdc" + // 0x04160308: 0x000004DC + "\x046\x03\b\x00\x00\x04\xdd" + // 0x04360308: 0x000004DD + "\x04\x17\x03\b\x00\x00\x04\xde" + // 0x04170308: 0x000004DE + "\x047\x03\b\x00\x00\x04\xdf" + // 0x04370308: 0x000004DF + "\x04\x18\x03\x04\x00\x00\x04\xe2" + // 0x04180304: 0x000004E2 + "\x048\x03\x04\x00\x00\x04\xe3" + // 0x04380304: 0x000004E3 + "\x04\x18\x03\b\x00\x00\x04\xe4" + // 0x04180308: 0x000004E4 + "\x048\x03\b\x00\x00\x04\xe5" + // 0x04380308: 0x000004E5 + "\x04\x1e\x03\b\x00\x00\x04\xe6" + // 0x041E0308: 0x000004E6 + "\x04>\x03\b\x00\x00\x04\xe7" + // 0x043E0308: 0x000004E7 + "\x04\xe8\x03\b\x00\x00\x04\xea" + // 0x04E80308: 0x000004EA + "\x04\xe9\x03\b\x00\x00\x04\xeb" + // 0x04E90308: 0x000004EB + "\x04-\x03\b\x00\x00\x04\xec" + // 0x042D0308: 0x000004EC + "\x04M\x03\b\x00\x00\x04\xed" + // 0x044D0308: 0x000004ED + "\x04#\x03\x04\x00\x00\x04\xee" + // 0x04230304: 0x000004EE + "\x04C\x03\x04\x00\x00\x04\xef" + // 0x04430304: 0x000004EF + "\x04#\x03\b\x00\x00\x04\xf0" + // 0x04230308: 0x000004F0 + "\x04C\x03\b\x00\x00\x04\xf1" + // 0x04430308: 0x000004F1 + "\x04#\x03\v\x00\x00\x04\xf2" + // 0x0423030B: 0x000004F2 + "\x04C\x03\v\x00\x00\x04\xf3" + // 0x0443030B: 0x000004F3 + "\x04'\x03\b\x00\x00\x04\xf4" + // 0x04270308: 0x000004F4 + "\x04G\x03\b\x00\x00\x04\xf5" + // 0x04470308: 0x000004F5 + "\x04+\x03\b\x00\x00\x04\xf8" + // 0x042B0308: 0x000004F8 + "\x04K\x03\b\x00\x00\x04\xf9" + // 0x044B0308: 0x000004F9 + "\x06'\x06S\x00\x00\x06\"" + // 0x06270653: 0x00000622 + "\x06'\x06T\x00\x00\x06#" + // 0x06270654: 0x00000623 + "\x06H\x06T\x00\x00\x06$" + // 0x06480654: 0x00000624 + "\x06'\x06U\x00\x00\x06%" + // 0x06270655: 0x00000625 + "\x06J\x06T\x00\x00\x06&" + // 0x064A0654: 0x00000626 + "\x06\xd5\x06T\x00\x00\x06\xc0" + // 0x06D50654: 0x000006C0 + "\x06\xc1\x06T\x00\x00\x06\xc2" + // 0x06C10654: 0x000006C2 + "\x06\xd2\x06T\x00\x00\x06\xd3" + // 0x06D20654: 0x000006D3 + "\t(\t<\x00\x00\t)" + // 0x0928093C: 0x00000929 + "\t0\t<\x00\x00\t1" + // 0x0930093C: 0x00000931 + "\t3\t<\x00\x00\t4" + // 0x0933093C: 0x00000934 + "\t\xc7\t\xbe\x00\x00\t\xcb" + // 0x09C709BE: 0x000009CB + "\t\xc7\t\xd7\x00\x00\t\xcc" + // 0x09C709D7: 0x000009CC + "\vG\vV\x00\x00\vH" + // 0x0B470B56: 0x00000B48 + "\vG\v>\x00\x00\vK" + // 0x0B470B3E: 0x00000B4B + "\vG\vW\x00\x00\vL" + // 0x0B470B57: 0x00000B4C + "\v\x92\v\xd7\x00\x00\v\x94" + // 0x0B920BD7: 0x00000B94 + "\v\xc6\v\xbe\x00\x00\v\xca" + // 0x0BC60BBE: 0x00000BCA + "\v\xc7\v\xbe\x00\x00\v\xcb" + // 0x0BC70BBE: 0x00000BCB + "\v\xc6\v\xd7\x00\x00\v\xcc" + // 0x0BC60BD7: 0x00000BCC + "\fF\fV\x00\x00\fH" + // 0x0C460C56: 0x00000C48 + "\f\xbf\f\xd5\x00\x00\f\xc0" + // 0x0CBF0CD5: 0x00000CC0 + "\f\xc6\f\xd5\x00\x00\f\xc7" + // 0x0CC60CD5: 0x00000CC7 + "\f\xc6\f\xd6\x00\x00\f\xc8" + // 0x0CC60CD6: 0x00000CC8 + "\f\xc6\f\xc2\x00\x00\f\xca" + // 0x0CC60CC2: 0x00000CCA + "\f\xca\f\xd5\x00\x00\f\xcb" + // 0x0CCA0CD5: 0x00000CCB + "\rF\r>\x00\x00\rJ" + // 0x0D460D3E: 0x00000D4A + "\rG\r>\x00\x00\rK" + // 0x0D470D3E: 0x00000D4B + "\rF\rW\x00\x00\rL" + // 0x0D460D57: 0x00000D4C + "\r\xd9\r\xca\x00\x00\r\xda" + // 0x0DD90DCA: 0x00000DDA + "\r\xd9\r\xcf\x00\x00\r\xdc" + // 0x0DD90DCF: 0x00000DDC + "\r\xdc\r\xca\x00\x00\r\xdd" + // 0x0DDC0DCA: 0x00000DDD + "\r\xd9\r\xdf\x00\x00\r\xde" + // 0x0DD90DDF: 0x00000DDE + "\x10%\x10.\x00\x00\x10&" + // 0x1025102E: 0x00001026 + "\x1b\x05\x1b5\x00\x00\x1b\x06" + // 0x1B051B35: 0x00001B06 + "\x1b\a\x1b5\x00\x00\x1b\b" + // 0x1B071B35: 0x00001B08 + "\x1b\t\x1b5\x00\x00\x1b\n" + // 0x1B091B35: 0x00001B0A + "\x1b\v\x1b5\x00\x00\x1b\f" + // 0x1B0B1B35: 0x00001B0C + "\x1b\r\x1b5\x00\x00\x1b\x0e" + // 0x1B0D1B35: 0x00001B0E + "\x1b\x11\x1b5\x00\x00\x1b\x12" + // 0x1B111B35: 0x00001B12 + "\x1b:\x1b5\x00\x00\x1b;" + // 0x1B3A1B35: 0x00001B3B + "\x1b<\x1b5\x00\x00\x1b=" + // 0x1B3C1B35: 0x00001B3D + "\x1b>\x1b5\x00\x00\x1b@" + // 0x1B3E1B35: 0x00001B40 + "\x1b?\x1b5\x00\x00\x1bA" + // 0x1B3F1B35: 0x00001B41 + "\x1bB\x1b5\x00\x00\x1bC" + // 0x1B421B35: 0x00001B43 + "\x00A\x03%\x00\x00\x1e\x00" + // 0x00410325: 0x00001E00 + "\x00a\x03%\x00\x00\x1e\x01" + // 0x00610325: 0x00001E01 + "\x00B\x03\a\x00\x00\x1e\x02" + // 0x00420307: 0x00001E02 + "\x00b\x03\a\x00\x00\x1e\x03" + // 0x00620307: 0x00001E03 + "\x00B\x03#\x00\x00\x1e\x04" + // 0x00420323: 0x00001E04 + "\x00b\x03#\x00\x00\x1e\x05" + // 0x00620323: 0x00001E05 + "\x00B\x031\x00\x00\x1e\x06" + // 0x00420331: 0x00001E06 + "\x00b\x031\x00\x00\x1e\a" + // 0x00620331: 0x00001E07 + "\x00\xc7\x03\x01\x00\x00\x1e\b" + // 0x00C70301: 0x00001E08 + "\x00\xe7\x03\x01\x00\x00\x1e\t" + // 0x00E70301: 0x00001E09 + "\x00D\x03\a\x00\x00\x1e\n" + // 0x00440307: 0x00001E0A + "\x00d\x03\a\x00\x00\x1e\v" + // 0x00640307: 0x00001E0B + "\x00D\x03#\x00\x00\x1e\f" + // 0x00440323: 0x00001E0C + "\x00d\x03#\x00\x00\x1e\r" + // 0x00640323: 0x00001E0D + "\x00D\x031\x00\x00\x1e\x0e" + // 0x00440331: 0x00001E0E + "\x00d\x031\x00\x00\x1e\x0f" + // 0x00640331: 0x00001E0F + "\x00D\x03'\x00\x00\x1e\x10" + // 0x00440327: 0x00001E10 + "\x00d\x03'\x00\x00\x1e\x11" + // 0x00640327: 0x00001E11 + "\x00D\x03-\x00\x00\x1e\x12" + // 0x0044032D: 0x00001E12 + "\x00d\x03-\x00\x00\x1e\x13" + // 0x0064032D: 0x00001E13 + "\x01\x12\x03\x00\x00\x00\x1e\x14" + // 0x01120300: 0x00001E14 + "\x01\x13\x03\x00\x00\x00\x1e\x15" + // 0x01130300: 0x00001E15 + "\x01\x12\x03\x01\x00\x00\x1e\x16" + // 0x01120301: 0x00001E16 + "\x01\x13\x03\x01\x00\x00\x1e\x17" + // 0x01130301: 0x00001E17 + "\x00E\x03-\x00\x00\x1e\x18" + // 0x0045032D: 0x00001E18 + "\x00e\x03-\x00\x00\x1e\x19" + // 0x0065032D: 0x00001E19 + "\x00E\x030\x00\x00\x1e\x1a" + // 0x00450330: 0x00001E1A + "\x00e\x030\x00\x00\x1e\x1b" + // 0x00650330: 0x00001E1B + "\x02(\x03\x06\x00\x00\x1e\x1c" + // 0x02280306: 0x00001E1C + "\x02)\x03\x06\x00\x00\x1e\x1d" + // 0x02290306: 0x00001E1D + "\x00F\x03\a\x00\x00\x1e\x1e" + // 0x00460307: 0x00001E1E + "\x00f\x03\a\x00\x00\x1e\x1f" + // 0x00660307: 0x00001E1F + "\x00G\x03\x04\x00\x00\x1e " + // 0x00470304: 0x00001E20 + "\x00g\x03\x04\x00\x00\x1e!" + // 0x00670304: 0x00001E21 + "\x00H\x03\a\x00\x00\x1e\"" + // 0x00480307: 0x00001E22 + "\x00h\x03\a\x00\x00\x1e#" + // 0x00680307: 0x00001E23 + "\x00H\x03#\x00\x00\x1e$" + // 0x00480323: 0x00001E24 + "\x00h\x03#\x00\x00\x1e%" + // 0x00680323: 0x00001E25 + "\x00H\x03\b\x00\x00\x1e&" + // 0x00480308: 0x00001E26 + "\x00h\x03\b\x00\x00\x1e'" + // 0x00680308: 0x00001E27 + "\x00H\x03'\x00\x00\x1e(" + // 0x00480327: 0x00001E28 + "\x00h\x03'\x00\x00\x1e)" + // 0x00680327: 0x00001E29 + "\x00H\x03.\x00\x00\x1e*" + // 0x0048032E: 0x00001E2A + "\x00h\x03.\x00\x00\x1e+" + // 0x0068032E: 0x00001E2B + "\x00I\x030\x00\x00\x1e," + // 0x00490330: 0x00001E2C + "\x00i\x030\x00\x00\x1e-" + // 0x00690330: 0x00001E2D + "\x00\xcf\x03\x01\x00\x00\x1e." + // 0x00CF0301: 0x00001E2E + "\x00\xef\x03\x01\x00\x00\x1e/" + // 0x00EF0301: 0x00001E2F + "\x00K\x03\x01\x00\x00\x1e0" + // 0x004B0301: 0x00001E30 + "\x00k\x03\x01\x00\x00\x1e1" + // 0x006B0301: 0x00001E31 + "\x00K\x03#\x00\x00\x1e2" + // 0x004B0323: 0x00001E32 + "\x00k\x03#\x00\x00\x1e3" + // 0x006B0323: 0x00001E33 + "\x00K\x031\x00\x00\x1e4" + // 0x004B0331: 0x00001E34 + "\x00k\x031\x00\x00\x1e5" + // 0x006B0331: 0x00001E35 + "\x00L\x03#\x00\x00\x1e6" + // 0x004C0323: 0x00001E36 + "\x00l\x03#\x00\x00\x1e7" + // 0x006C0323: 0x00001E37 + "\x1e6\x03\x04\x00\x00\x1e8" + // 0x1E360304: 0x00001E38 + "\x1e7\x03\x04\x00\x00\x1e9" + // 0x1E370304: 0x00001E39 + "\x00L\x031\x00\x00\x1e:" + // 0x004C0331: 0x00001E3A + "\x00l\x031\x00\x00\x1e;" + // 0x006C0331: 0x00001E3B + "\x00L\x03-\x00\x00\x1e<" + // 0x004C032D: 0x00001E3C + "\x00l\x03-\x00\x00\x1e=" + // 0x006C032D: 0x00001E3D + "\x00M\x03\x01\x00\x00\x1e>" + // 0x004D0301: 0x00001E3E + "\x00m\x03\x01\x00\x00\x1e?" + // 0x006D0301: 0x00001E3F + "\x00M\x03\a\x00\x00\x1e@" + // 0x004D0307: 0x00001E40 + "\x00m\x03\a\x00\x00\x1eA" + // 0x006D0307: 0x00001E41 + "\x00M\x03#\x00\x00\x1eB" + // 0x004D0323: 0x00001E42 + "\x00m\x03#\x00\x00\x1eC" + // 0x006D0323: 0x00001E43 + "\x00N\x03\a\x00\x00\x1eD" + // 0x004E0307: 0x00001E44 + "\x00n\x03\a\x00\x00\x1eE" + // 0x006E0307: 0x00001E45 + "\x00N\x03#\x00\x00\x1eF" + // 0x004E0323: 0x00001E46 + "\x00n\x03#\x00\x00\x1eG" + // 0x006E0323: 0x00001E47 + "\x00N\x031\x00\x00\x1eH" + // 0x004E0331: 0x00001E48 + "\x00n\x031\x00\x00\x1eI" + // 0x006E0331: 0x00001E49 + "\x00N\x03-\x00\x00\x1eJ" + // 0x004E032D: 0x00001E4A + "\x00n\x03-\x00\x00\x1eK" + // 0x006E032D: 0x00001E4B + "\x00\xd5\x03\x01\x00\x00\x1eL" + // 0x00D50301: 0x00001E4C + "\x00\xf5\x03\x01\x00\x00\x1eM" + // 0x00F50301: 0x00001E4D + "\x00\xd5\x03\b\x00\x00\x1eN" + // 0x00D50308: 0x00001E4E + "\x00\xf5\x03\b\x00\x00\x1eO" + // 0x00F50308: 0x00001E4F + "\x01L\x03\x00\x00\x00\x1eP" + // 0x014C0300: 0x00001E50 + "\x01M\x03\x00\x00\x00\x1eQ" + // 0x014D0300: 0x00001E51 + "\x01L\x03\x01\x00\x00\x1eR" + // 0x014C0301: 0x00001E52 + "\x01M\x03\x01\x00\x00\x1eS" + // 0x014D0301: 0x00001E53 + "\x00P\x03\x01\x00\x00\x1eT" + // 0x00500301: 0x00001E54 + "\x00p\x03\x01\x00\x00\x1eU" + // 0x00700301: 0x00001E55 + "\x00P\x03\a\x00\x00\x1eV" + // 0x00500307: 0x00001E56 + "\x00p\x03\a\x00\x00\x1eW" + // 0x00700307: 0x00001E57 + "\x00R\x03\a\x00\x00\x1eX" + // 0x00520307: 0x00001E58 + "\x00r\x03\a\x00\x00\x1eY" + // 0x00720307: 0x00001E59 + "\x00R\x03#\x00\x00\x1eZ" + // 0x00520323: 0x00001E5A + "\x00r\x03#\x00\x00\x1e[" + // 0x00720323: 0x00001E5B + "\x1eZ\x03\x04\x00\x00\x1e\\" + // 0x1E5A0304: 0x00001E5C + "\x1e[\x03\x04\x00\x00\x1e]" + // 0x1E5B0304: 0x00001E5D + "\x00R\x031\x00\x00\x1e^" + // 0x00520331: 0x00001E5E + "\x00r\x031\x00\x00\x1e_" + // 0x00720331: 0x00001E5F + "\x00S\x03\a\x00\x00\x1e`" + // 0x00530307: 0x00001E60 + "\x00s\x03\a\x00\x00\x1ea" + // 0x00730307: 0x00001E61 + "\x00S\x03#\x00\x00\x1eb" + // 0x00530323: 0x00001E62 + "\x00s\x03#\x00\x00\x1ec" + // 0x00730323: 0x00001E63 + "\x01Z\x03\a\x00\x00\x1ed" + // 0x015A0307: 0x00001E64 + "\x01[\x03\a\x00\x00\x1ee" + // 0x015B0307: 0x00001E65 + "\x01`\x03\a\x00\x00\x1ef" + // 0x01600307: 0x00001E66 + "\x01a\x03\a\x00\x00\x1eg" + // 0x01610307: 0x00001E67 + "\x1eb\x03\a\x00\x00\x1eh" + // 0x1E620307: 0x00001E68 + "\x1ec\x03\a\x00\x00\x1ei" + // 0x1E630307: 0x00001E69 + "\x00T\x03\a\x00\x00\x1ej" + // 0x00540307: 0x00001E6A + "\x00t\x03\a\x00\x00\x1ek" + // 0x00740307: 0x00001E6B + "\x00T\x03#\x00\x00\x1el" + // 0x00540323: 0x00001E6C + "\x00t\x03#\x00\x00\x1em" + // 0x00740323: 0x00001E6D + "\x00T\x031\x00\x00\x1en" + // 0x00540331: 0x00001E6E + "\x00t\x031\x00\x00\x1eo" + // 0x00740331: 0x00001E6F + "\x00T\x03-\x00\x00\x1ep" + // 0x0054032D: 0x00001E70 + "\x00t\x03-\x00\x00\x1eq" + // 0x0074032D: 0x00001E71 + "\x00U\x03$\x00\x00\x1er" + // 0x00550324: 0x00001E72 + "\x00u\x03$\x00\x00\x1es" + // 0x00750324: 0x00001E73 + "\x00U\x030\x00\x00\x1et" + // 0x00550330: 0x00001E74 + "\x00u\x030\x00\x00\x1eu" + // 0x00750330: 0x00001E75 + "\x00U\x03-\x00\x00\x1ev" + // 0x0055032D: 0x00001E76 + "\x00u\x03-\x00\x00\x1ew" + // 0x0075032D: 0x00001E77 + "\x01h\x03\x01\x00\x00\x1ex" + // 0x01680301: 0x00001E78 + "\x01i\x03\x01\x00\x00\x1ey" + // 0x01690301: 0x00001E79 + "\x01j\x03\b\x00\x00\x1ez" + // 0x016A0308: 0x00001E7A + "\x01k\x03\b\x00\x00\x1e{" + // 0x016B0308: 0x00001E7B + "\x00V\x03\x03\x00\x00\x1e|" + // 0x00560303: 0x00001E7C + "\x00v\x03\x03\x00\x00\x1e}" + // 0x00760303: 0x00001E7D + "\x00V\x03#\x00\x00\x1e~" + // 0x00560323: 0x00001E7E + "\x00v\x03#\x00\x00\x1e\u007f" + // 0x00760323: 0x00001E7F + "\x00W\x03\x00\x00\x00\x1e\x80" + // 0x00570300: 0x00001E80 + "\x00w\x03\x00\x00\x00\x1e\x81" + // 0x00770300: 0x00001E81 + "\x00W\x03\x01\x00\x00\x1e\x82" + // 0x00570301: 0x00001E82 + "\x00w\x03\x01\x00\x00\x1e\x83" + // 0x00770301: 0x00001E83 + "\x00W\x03\b\x00\x00\x1e\x84" + // 0x00570308: 0x00001E84 + "\x00w\x03\b\x00\x00\x1e\x85" + // 0x00770308: 0x00001E85 + "\x00W\x03\a\x00\x00\x1e\x86" + // 0x00570307: 0x00001E86 + "\x00w\x03\a\x00\x00\x1e\x87" + // 0x00770307: 0x00001E87 + "\x00W\x03#\x00\x00\x1e\x88" + // 0x00570323: 0x00001E88 + "\x00w\x03#\x00\x00\x1e\x89" + // 0x00770323: 0x00001E89 + "\x00X\x03\a\x00\x00\x1e\x8a" + // 0x00580307: 0x00001E8A + "\x00x\x03\a\x00\x00\x1e\x8b" + // 0x00780307: 0x00001E8B + "\x00X\x03\b\x00\x00\x1e\x8c" + // 0x00580308: 0x00001E8C + "\x00x\x03\b\x00\x00\x1e\x8d" + // 0x00780308: 0x00001E8D + "\x00Y\x03\a\x00\x00\x1e\x8e" + // 0x00590307: 0x00001E8E + "\x00y\x03\a\x00\x00\x1e\x8f" + // 0x00790307: 0x00001E8F + "\x00Z\x03\x02\x00\x00\x1e\x90" + // 0x005A0302: 0x00001E90 + "\x00z\x03\x02\x00\x00\x1e\x91" + // 0x007A0302: 0x00001E91 + "\x00Z\x03#\x00\x00\x1e\x92" + // 0x005A0323: 0x00001E92 + "\x00z\x03#\x00\x00\x1e\x93" + // 0x007A0323: 0x00001E93 + "\x00Z\x031\x00\x00\x1e\x94" + // 0x005A0331: 0x00001E94 + "\x00z\x031\x00\x00\x1e\x95" + // 0x007A0331: 0x00001E95 + "\x00h\x031\x00\x00\x1e\x96" + // 0x00680331: 0x00001E96 + "\x00t\x03\b\x00\x00\x1e\x97" + // 0x00740308: 0x00001E97 + "\x00w\x03\n\x00\x00\x1e\x98" + // 0x0077030A: 0x00001E98 + "\x00y\x03\n\x00\x00\x1e\x99" + // 0x0079030A: 0x00001E99 + "\x01\u007f\x03\a\x00\x00\x1e\x9b" + // 0x017F0307: 0x00001E9B + "\x00A\x03#\x00\x00\x1e\xa0" + // 0x00410323: 0x00001EA0 + "\x00a\x03#\x00\x00\x1e\xa1" + // 0x00610323: 0x00001EA1 + "\x00A\x03\t\x00\x00\x1e\xa2" + // 0x00410309: 0x00001EA2 + "\x00a\x03\t\x00\x00\x1e\xa3" + // 0x00610309: 0x00001EA3 + "\x00\xc2\x03\x01\x00\x00\x1e\xa4" + // 0x00C20301: 0x00001EA4 + "\x00\xe2\x03\x01\x00\x00\x1e\xa5" + // 0x00E20301: 0x00001EA5 + "\x00\xc2\x03\x00\x00\x00\x1e\xa6" + // 0x00C20300: 0x00001EA6 + "\x00\xe2\x03\x00\x00\x00\x1e\xa7" + // 0x00E20300: 0x00001EA7 + "\x00\xc2\x03\t\x00\x00\x1e\xa8" + // 0x00C20309: 0x00001EA8 + "\x00\xe2\x03\t\x00\x00\x1e\xa9" + // 0x00E20309: 0x00001EA9 + "\x00\xc2\x03\x03\x00\x00\x1e\xaa" + // 0x00C20303: 0x00001EAA + "\x00\xe2\x03\x03\x00\x00\x1e\xab" + // 0x00E20303: 0x00001EAB + "\x1e\xa0\x03\x02\x00\x00\x1e\xac" + // 0x1EA00302: 0x00001EAC + "\x1e\xa1\x03\x02\x00\x00\x1e\xad" + // 0x1EA10302: 0x00001EAD + "\x01\x02\x03\x01\x00\x00\x1e\xae" + // 0x01020301: 0x00001EAE + "\x01\x03\x03\x01\x00\x00\x1e\xaf" + // 0x01030301: 0x00001EAF + "\x01\x02\x03\x00\x00\x00\x1e\xb0" + // 0x01020300: 0x00001EB0 + "\x01\x03\x03\x00\x00\x00\x1e\xb1" + // 0x01030300: 0x00001EB1 + "\x01\x02\x03\t\x00\x00\x1e\xb2" + // 0x01020309: 0x00001EB2 + "\x01\x03\x03\t\x00\x00\x1e\xb3" + // 0x01030309: 0x00001EB3 + "\x01\x02\x03\x03\x00\x00\x1e\xb4" + // 0x01020303: 0x00001EB4 + "\x01\x03\x03\x03\x00\x00\x1e\xb5" + // 0x01030303: 0x00001EB5 + "\x1e\xa0\x03\x06\x00\x00\x1e\xb6" + // 0x1EA00306: 0x00001EB6 + "\x1e\xa1\x03\x06\x00\x00\x1e\xb7" + // 0x1EA10306: 0x00001EB7 + "\x00E\x03#\x00\x00\x1e\xb8" + // 0x00450323: 0x00001EB8 + "\x00e\x03#\x00\x00\x1e\xb9" + // 0x00650323: 0x00001EB9 + "\x00E\x03\t\x00\x00\x1e\xba" + // 0x00450309: 0x00001EBA + "\x00e\x03\t\x00\x00\x1e\xbb" + // 0x00650309: 0x00001EBB + "\x00E\x03\x03\x00\x00\x1e\xbc" + // 0x00450303: 0x00001EBC + "\x00e\x03\x03\x00\x00\x1e\xbd" + // 0x00650303: 0x00001EBD + "\x00\xca\x03\x01\x00\x00\x1e\xbe" + // 0x00CA0301: 0x00001EBE + "\x00\xea\x03\x01\x00\x00\x1e\xbf" + // 0x00EA0301: 0x00001EBF + "\x00\xca\x03\x00\x00\x00\x1e\xc0" + // 0x00CA0300: 0x00001EC0 + "\x00\xea\x03\x00\x00\x00\x1e\xc1" + // 0x00EA0300: 0x00001EC1 + "\x00\xca\x03\t\x00\x00\x1e\xc2" + // 0x00CA0309: 0x00001EC2 + "\x00\xea\x03\t\x00\x00\x1e\xc3" + // 0x00EA0309: 0x00001EC3 + "\x00\xca\x03\x03\x00\x00\x1e\xc4" + // 0x00CA0303: 0x00001EC4 + "\x00\xea\x03\x03\x00\x00\x1e\xc5" + // 0x00EA0303: 0x00001EC5 + "\x1e\xb8\x03\x02\x00\x00\x1e\xc6" + // 0x1EB80302: 0x00001EC6 + "\x1e\xb9\x03\x02\x00\x00\x1e\xc7" + // 0x1EB90302: 0x00001EC7 + "\x00I\x03\t\x00\x00\x1e\xc8" + // 0x00490309: 0x00001EC8 + "\x00i\x03\t\x00\x00\x1e\xc9" + // 0x00690309: 0x00001EC9 + "\x00I\x03#\x00\x00\x1e\xca" + // 0x00490323: 0x00001ECA + "\x00i\x03#\x00\x00\x1e\xcb" + // 0x00690323: 0x00001ECB + "\x00O\x03#\x00\x00\x1e\xcc" + // 0x004F0323: 0x00001ECC + "\x00o\x03#\x00\x00\x1e\xcd" + // 0x006F0323: 0x00001ECD + "\x00O\x03\t\x00\x00\x1e\xce" + // 0x004F0309: 0x00001ECE + "\x00o\x03\t\x00\x00\x1e\xcf" + // 0x006F0309: 0x00001ECF + "\x00\xd4\x03\x01\x00\x00\x1e\xd0" + // 0x00D40301: 0x00001ED0 + "\x00\xf4\x03\x01\x00\x00\x1e\xd1" + // 0x00F40301: 0x00001ED1 + "\x00\xd4\x03\x00\x00\x00\x1e\xd2" + // 0x00D40300: 0x00001ED2 + "\x00\xf4\x03\x00\x00\x00\x1e\xd3" + // 0x00F40300: 0x00001ED3 + "\x00\xd4\x03\t\x00\x00\x1e\xd4" + // 0x00D40309: 0x00001ED4 + "\x00\xf4\x03\t\x00\x00\x1e\xd5" + // 0x00F40309: 0x00001ED5 + "\x00\xd4\x03\x03\x00\x00\x1e\xd6" + // 0x00D40303: 0x00001ED6 + "\x00\xf4\x03\x03\x00\x00\x1e\xd7" + // 0x00F40303: 0x00001ED7 + "\x1e\xcc\x03\x02\x00\x00\x1e\xd8" + // 0x1ECC0302: 0x00001ED8 + "\x1e\xcd\x03\x02\x00\x00\x1e\xd9" + // 0x1ECD0302: 0x00001ED9 + "\x01\xa0\x03\x01\x00\x00\x1e\xda" + // 0x01A00301: 0x00001EDA + "\x01\xa1\x03\x01\x00\x00\x1e\xdb" + // 0x01A10301: 0x00001EDB + "\x01\xa0\x03\x00\x00\x00\x1e\xdc" + // 0x01A00300: 0x00001EDC + "\x01\xa1\x03\x00\x00\x00\x1e\xdd" + // 0x01A10300: 0x00001EDD + "\x01\xa0\x03\t\x00\x00\x1e\xde" + // 0x01A00309: 0x00001EDE + "\x01\xa1\x03\t\x00\x00\x1e\xdf" + // 0x01A10309: 0x00001EDF + "\x01\xa0\x03\x03\x00\x00\x1e\xe0" + // 0x01A00303: 0x00001EE0 + "\x01\xa1\x03\x03\x00\x00\x1e\xe1" + // 0x01A10303: 0x00001EE1 + "\x01\xa0\x03#\x00\x00\x1e\xe2" + // 0x01A00323: 0x00001EE2 + "\x01\xa1\x03#\x00\x00\x1e\xe3" + // 0x01A10323: 0x00001EE3 + "\x00U\x03#\x00\x00\x1e\xe4" + // 0x00550323: 0x00001EE4 + "\x00u\x03#\x00\x00\x1e\xe5" + // 0x00750323: 0x00001EE5 + "\x00U\x03\t\x00\x00\x1e\xe6" + // 0x00550309: 0x00001EE6 + "\x00u\x03\t\x00\x00\x1e\xe7" + // 0x00750309: 0x00001EE7 + "\x01\xaf\x03\x01\x00\x00\x1e\xe8" + // 0x01AF0301: 0x00001EE8 + "\x01\xb0\x03\x01\x00\x00\x1e\xe9" + // 0x01B00301: 0x00001EE9 + "\x01\xaf\x03\x00\x00\x00\x1e\xea" + // 0x01AF0300: 0x00001EEA + "\x01\xb0\x03\x00\x00\x00\x1e\xeb" + // 0x01B00300: 0x00001EEB + "\x01\xaf\x03\t\x00\x00\x1e\xec" + // 0x01AF0309: 0x00001EEC + "\x01\xb0\x03\t\x00\x00\x1e\xed" + // 0x01B00309: 0x00001EED + "\x01\xaf\x03\x03\x00\x00\x1e\xee" + // 0x01AF0303: 0x00001EEE + "\x01\xb0\x03\x03\x00\x00\x1e\xef" + // 0x01B00303: 0x00001EEF + "\x01\xaf\x03#\x00\x00\x1e\xf0" + // 0x01AF0323: 0x00001EF0 + "\x01\xb0\x03#\x00\x00\x1e\xf1" + // 0x01B00323: 0x00001EF1 + "\x00Y\x03\x00\x00\x00\x1e\xf2" + // 0x00590300: 0x00001EF2 + "\x00y\x03\x00\x00\x00\x1e\xf3" + // 0x00790300: 0x00001EF3 + "\x00Y\x03#\x00\x00\x1e\xf4" + // 0x00590323: 0x00001EF4 + "\x00y\x03#\x00\x00\x1e\xf5" + // 0x00790323: 0x00001EF5 + "\x00Y\x03\t\x00\x00\x1e\xf6" + // 0x00590309: 0x00001EF6 + "\x00y\x03\t\x00\x00\x1e\xf7" + // 0x00790309: 0x00001EF7 + "\x00Y\x03\x03\x00\x00\x1e\xf8" + // 0x00590303: 0x00001EF8 + "\x00y\x03\x03\x00\x00\x1e\xf9" + // 0x00790303: 0x00001EF9 + "\x03\xb1\x03\x13\x00\x00\x1f\x00" + // 0x03B10313: 0x00001F00 + "\x03\xb1\x03\x14\x00\x00\x1f\x01" + // 0x03B10314: 0x00001F01 + "\x1f\x00\x03\x00\x00\x00\x1f\x02" + // 0x1F000300: 0x00001F02 + "\x1f\x01\x03\x00\x00\x00\x1f\x03" + // 0x1F010300: 0x00001F03 + "\x1f\x00\x03\x01\x00\x00\x1f\x04" + // 0x1F000301: 0x00001F04 + "\x1f\x01\x03\x01\x00\x00\x1f\x05" + // 0x1F010301: 0x00001F05 + "\x1f\x00\x03B\x00\x00\x1f\x06" + // 0x1F000342: 0x00001F06 + "\x1f\x01\x03B\x00\x00\x1f\a" + // 0x1F010342: 0x00001F07 + "\x03\x91\x03\x13\x00\x00\x1f\b" + // 0x03910313: 0x00001F08 + "\x03\x91\x03\x14\x00\x00\x1f\t" + // 0x03910314: 0x00001F09 + "\x1f\b\x03\x00\x00\x00\x1f\n" + // 0x1F080300: 0x00001F0A + "\x1f\t\x03\x00\x00\x00\x1f\v" + // 0x1F090300: 0x00001F0B + "\x1f\b\x03\x01\x00\x00\x1f\f" + // 0x1F080301: 0x00001F0C + "\x1f\t\x03\x01\x00\x00\x1f\r" + // 0x1F090301: 0x00001F0D + "\x1f\b\x03B\x00\x00\x1f\x0e" + // 0x1F080342: 0x00001F0E + "\x1f\t\x03B\x00\x00\x1f\x0f" + // 0x1F090342: 0x00001F0F + "\x03\xb5\x03\x13\x00\x00\x1f\x10" + // 0x03B50313: 0x00001F10 + "\x03\xb5\x03\x14\x00\x00\x1f\x11" + // 0x03B50314: 0x00001F11 + "\x1f\x10\x03\x00\x00\x00\x1f\x12" + // 0x1F100300: 0x00001F12 + "\x1f\x11\x03\x00\x00\x00\x1f\x13" + // 0x1F110300: 0x00001F13 + "\x1f\x10\x03\x01\x00\x00\x1f\x14" + // 0x1F100301: 0x00001F14 + "\x1f\x11\x03\x01\x00\x00\x1f\x15" + // 0x1F110301: 0x00001F15 + "\x03\x95\x03\x13\x00\x00\x1f\x18" + // 0x03950313: 0x00001F18 + "\x03\x95\x03\x14\x00\x00\x1f\x19" + // 0x03950314: 0x00001F19 + "\x1f\x18\x03\x00\x00\x00\x1f\x1a" + // 0x1F180300: 0x00001F1A + "\x1f\x19\x03\x00\x00\x00\x1f\x1b" + // 0x1F190300: 0x00001F1B + "\x1f\x18\x03\x01\x00\x00\x1f\x1c" + // 0x1F180301: 0x00001F1C + "\x1f\x19\x03\x01\x00\x00\x1f\x1d" + // 0x1F190301: 0x00001F1D + "\x03\xb7\x03\x13\x00\x00\x1f " + // 0x03B70313: 0x00001F20 + "\x03\xb7\x03\x14\x00\x00\x1f!" + // 0x03B70314: 0x00001F21 + "\x1f \x03\x00\x00\x00\x1f\"" + // 0x1F200300: 0x00001F22 + "\x1f!\x03\x00\x00\x00\x1f#" + // 0x1F210300: 0x00001F23 + "\x1f \x03\x01\x00\x00\x1f$" + // 0x1F200301: 0x00001F24 + "\x1f!\x03\x01\x00\x00\x1f%" + // 0x1F210301: 0x00001F25 + "\x1f \x03B\x00\x00\x1f&" + // 0x1F200342: 0x00001F26 + "\x1f!\x03B\x00\x00\x1f'" + // 0x1F210342: 0x00001F27 + "\x03\x97\x03\x13\x00\x00\x1f(" + // 0x03970313: 0x00001F28 + "\x03\x97\x03\x14\x00\x00\x1f)" + // 0x03970314: 0x00001F29 + "\x1f(\x03\x00\x00\x00\x1f*" + // 0x1F280300: 0x00001F2A + "\x1f)\x03\x00\x00\x00\x1f+" + // 0x1F290300: 0x00001F2B + "\x1f(\x03\x01\x00\x00\x1f," + // 0x1F280301: 0x00001F2C + "\x1f)\x03\x01\x00\x00\x1f-" + // 0x1F290301: 0x00001F2D + "\x1f(\x03B\x00\x00\x1f." + // 0x1F280342: 0x00001F2E + "\x1f)\x03B\x00\x00\x1f/" + // 0x1F290342: 0x00001F2F + "\x03\xb9\x03\x13\x00\x00\x1f0" + // 0x03B90313: 0x00001F30 + "\x03\xb9\x03\x14\x00\x00\x1f1" + // 0x03B90314: 0x00001F31 + "\x1f0\x03\x00\x00\x00\x1f2" + // 0x1F300300: 0x00001F32 + "\x1f1\x03\x00\x00\x00\x1f3" + // 0x1F310300: 0x00001F33 + "\x1f0\x03\x01\x00\x00\x1f4" + // 0x1F300301: 0x00001F34 + "\x1f1\x03\x01\x00\x00\x1f5" + // 0x1F310301: 0x00001F35 + "\x1f0\x03B\x00\x00\x1f6" + // 0x1F300342: 0x00001F36 + "\x1f1\x03B\x00\x00\x1f7" + // 0x1F310342: 0x00001F37 + "\x03\x99\x03\x13\x00\x00\x1f8" + // 0x03990313: 0x00001F38 + "\x03\x99\x03\x14\x00\x00\x1f9" + // 0x03990314: 0x00001F39 + "\x1f8\x03\x00\x00\x00\x1f:" + // 0x1F380300: 0x00001F3A + "\x1f9\x03\x00\x00\x00\x1f;" + // 0x1F390300: 0x00001F3B + "\x1f8\x03\x01\x00\x00\x1f<" + // 0x1F380301: 0x00001F3C + "\x1f9\x03\x01\x00\x00\x1f=" + // 0x1F390301: 0x00001F3D + "\x1f8\x03B\x00\x00\x1f>" + // 0x1F380342: 0x00001F3E + "\x1f9\x03B\x00\x00\x1f?" + // 0x1F390342: 0x00001F3F + "\x03\xbf\x03\x13\x00\x00\x1f@" + // 0x03BF0313: 0x00001F40 + "\x03\xbf\x03\x14\x00\x00\x1fA" + // 0x03BF0314: 0x00001F41 + "\x1f@\x03\x00\x00\x00\x1fB" + // 0x1F400300: 0x00001F42 + "\x1fA\x03\x00\x00\x00\x1fC" + // 0x1F410300: 0x00001F43 + "\x1f@\x03\x01\x00\x00\x1fD" + // 0x1F400301: 0x00001F44 + "\x1fA\x03\x01\x00\x00\x1fE" + // 0x1F410301: 0x00001F45 + "\x03\x9f\x03\x13\x00\x00\x1fH" + // 0x039F0313: 0x00001F48 + "\x03\x9f\x03\x14\x00\x00\x1fI" + // 0x039F0314: 0x00001F49 + "\x1fH\x03\x00\x00\x00\x1fJ" + // 0x1F480300: 0x00001F4A + "\x1fI\x03\x00\x00\x00\x1fK" + // 0x1F490300: 0x00001F4B + "\x1fH\x03\x01\x00\x00\x1fL" + // 0x1F480301: 0x00001F4C + "\x1fI\x03\x01\x00\x00\x1fM" + // 0x1F490301: 0x00001F4D + "\x03\xc5\x03\x13\x00\x00\x1fP" + // 0x03C50313: 0x00001F50 + "\x03\xc5\x03\x14\x00\x00\x1fQ" + // 0x03C50314: 0x00001F51 + "\x1fP\x03\x00\x00\x00\x1fR" + // 0x1F500300: 0x00001F52 + "\x1fQ\x03\x00\x00\x00\x1fS" + // 0x1F510300: 0x00001F53 + "\x1fP\x03\x01\x00\x00\x1fT" + // 0x1F500301: 0x00001F54 + "\x1fQ\x03\x01\x00\x00\x1fU" + // 0x1F510301: 0x00001F55 + "\x1fP\x03B\x00\x00\x1fV" + // 0x1F500342: 0x00001F56 + "\x1fQ\x03B\x00\x00\x1fW" + // 0x1F510342: 0x00001F57 + "\x03\xa5\x03\x14\x00\x00\x1fY" + // 0x03A50314: 0x00001F59 + "\x1fY\x03\x00\x00\x00\x1f[" + // 0x1F590300: 0x00001F5B + "\x1fY\x03\x01\x00\x00\x1f]" + // 0x1F590301: 0x00001F5D + "\x1fY\x03B\x00\x00\x1f_" + // 0x1F590342: 0x00001F5F + "\x03\xc9\x03\x13\x00\x00\x1f`" + // 0x03C90313: 0x00001F60 + "\x03\xc9\x03\x14\x00\x00\x1fa" + // 0x03C90314: 0x00001F61 + "\x1f`\x03\x00\x00\x00\x1fb" + // 0x1F600300: 0x00001F62 + "\x1fa\x03\x00\x00\x00\x1fc" + // 0x1F610300: 0x00001F63 + "\x1f`\x03\x01\x00\x00\x1fd" + // 0x1F600301: 0x00001F64 + "\x1fa\x03\x01\x00\x00\x1fe" + // 0x1F610301: 0x00001F65 + "\x1f`\x03B\x00\x00\x1ff" + // 0x1F600342: 0x00001F66 + "\x1fa\x03B\x00\x00\x1fg" + // 0x1F610342: 0x00001F67 + "\x03\xa9\x03\x13\x00\x00\x1fh" + // 0x03A90313: 0x00001F68 + "\x03\xa9\x03\x14\x00\x00\x1fi" + // 0x03A90314: 0x00001F69 + "\x1fh\x03\x00\x00\x00\x1fj" + // 0x1F680300: 0x00001F6A + "\x1fi\x03\x00\x00\x00\x1fk" + // 0x1F690300: 0x00001F6B + "\x1fh\x03\x01\x00\x00\x1fl" + // 0x1F680301: 0x00001F6C + "\x1fi\x03\x01\x00\x00\x1fm" + // 0x1F690301: 0x00001F6D + "\x1fh\x03B\x00\x00\x1fn" + // 0x1F680342: 0x00001F6E + "\x1fi\x03B\x00\x00\x1fo" + // 0x1F690342: 0x00001F6F + "\x03\xb1\x03\x00\x00\x00\x1fp" + // 0x03B10300: 0x00001F70 + "\x03\xb5\x03\x00\x00\x00\x1fr" + // 0x03B50300: 0x00001F72 + "\x03\xb7\x03\x00\x00\x00\x1ft" + // 0x03B70300: 0x00001F74 + "\x03\xb9\x03\x00\x00\x00\x1fv" + // 0x03B90300: 0x00001F76 + "\x03\xbf\x03\x00\x00\x00\x1fx" + // 0x03BF0300: 0x00001F78 + "\x03\xc5\x03\x00\x00\x00\x1fz" + // 0x03C50300: 0x00001F7A + "\x03\xc9\x03\x00\x00\x00\x1f|" + // 0x03C90300: 0x00001F7C + "\x1f\x00\x03E\x00\x00\x1f\x80" + // 0x1F000345: 0x00001F80 + "\x1f\x01\x03E\x00\x00\x1f\x81" + // 0x1F010345: 0x00001F81 + "\x1f\x02\x03E\x00\x00\x1f\x82" + // 0x1F020345: 0x00001F82 + "\x1f\x03\x03E\x00\x00\x1f\x83" + // 0x1F030345: 0x00001F83 + "\x1f\x04\x03E\x00\x00\x1f\x84" + // 0x1F040345: 0x00001F84 + "\x1f\x05\x03E\x00\x00\x1f\x85" + // 0x1F050345: 0x00001F85 + "\x1f\x06\x03E\x00\x00\x1f\x86" + // 0x1F060345: 0x00001F86 + "\x1f\a\x03E\x00\x00\x1f\x87" + // 0x1F070345: 0x00001F87 + "\x1f\b\x03E\x00\x00\x1f\x88" + // 0x1F080345: 0x00001F88 + "\x1f\t\x03E\x00\x00\x1f\x89" + // 0x1F090345: 0x00001F89 + "\x1f\n\x03E\x00\x00\x1f\x8a" + // 0x1F0A0345: 0x00001F8A + "\x1f\v\x03E\x00\x00\x1f\x8b" + // 0x1F0B0345: 0x00001F8B + "\x1f\f\x03E\x00\x00\x1f\x8c" + // 0x1F0C0345: 0x00001F8C + "\x1f\r\x03E\x00\x00\x1f\x8d" + // 0x1F0D0345: 0x00001F8D + "\x1f\x0e\x03E\x00\x00\x1f\x8e" + // 0x1F0E0345: 0x00001F8E + "\x1f\x0f\x03E\x00\x00\x1f\x8f" + // 0x1F0F0345: 0x00001F8F + "\x1f \x03E\x00\x00\x1f\x90" + // 0x1F200345: 0x00001F90 + "\x1f!\x03E\x00\x00\x1f\x91" + // 0x1F210345: 0x00001F91 + "\x1f\"\x03E\x00\x00\x1f\x92" + // 0x1F220345: 0x00001F92 + "\x1f#\x03E\x00\x00\x1f\x93" + // 0x1F230345: 0x00001F93 + "\x1f$\x03E\x00\x00\x1f\x94" + // 0x1F240345: 0x00001F94 + "\x1f%\x03E\x00\x00\x1f\x95" + // 0x1F250345: 0x00001F95 + "\x1f&\x03E\x00\x00\x1f\x96" + // 0x1F260345: 0x00001F96 + "\x1f'\x03E\x00\x00\x1f\x97" + // 0x1F270345: 0x00001F97 + "\x1f(\x03E\x00\x00\x1f\x98" + // 0x1F280345: 0x00001F98 + "\x1f)\x03E\x00\x00\x1f\x99" + // 0x1F290345: 0x00001F99 + "\x1f*\x03E\x00\x00\x1f\x9a" + // 0x1F2A0345: 0x00001F9A + "\x1f+\x03E\x00\x00\x1f\x9b" + // 0x1F2B0345: 0x00001F9B + "\x1f,\x03E\x00\x00\x1f\x9c" + // 0x1F2C0345: 0x00001F9C + "\x1f-\x03E\x00\x00\x1f\x9d" + // 0x1F2D0345: 0x00001F9D + "\x1f.\x03E\x00\x00\x1f\x9e" + // 0x1F2E0345: 0x00001F9E + "\x1f/\x03E\x00\x00\x1f\x9f" + // 0x1F2F0345: 0x00001F9F + "\x1f`\x03E\x00\x00\x1f\xa0" + // 0x1F600345: 0x00001FA0 + "\x1fa\x03E\x00\x00\x1f\xa1" + // 0x1F610345: 0x00001FA1 + "\x1fb\x03E\x00\x00\x1f\xa2" + // 0x1F620345: 0x00001FA2 + "\x1fc\x03E\x00\x00\x1f\xa3" + // 0x1F630345: 0x00001FA3 + "\x1fd\x03E\x00\x00\x1f\xa4" + // 0x1F640345: 0x00001FA4 + "\x1fe\x03E\x00\x00\x1f\xa5" + // 0x1F650345: 0x00001FA5 + "\x1ff\x03E\x00\x00\x1f\xa6" + // 0x1F660345: 0x00001FA6 + "\x1fg\x03E\x00\x00\x1f\xa7" + // 0x1F670345: 0x00001FA7 + "\x1fh\x03E\x00\x00\x1f\xa8" + // 0x1F680345: 0x00001FA8 + "\x1fi\x03E\x00\x00\x1f\xa9" + // 0x1F690345: 0x00001FA9 + "\x1fj\x03E\x00\x00\x1f\xaa" + // 0x1F6A0345: 0x00001FAA + "\x1fk\x03E\x00\x00\x1f\xab" + // 0x1F6B0345: 0x00001FAB + "\x1fl\x03E\x00\x00\x1f\xac" + // 0x1F6C0345: 0x00001FAC + "\x1fm\x03E\x00\x00\x1f\xad" + // 0x1F6D0345: 0x00001FAD + "\x1fn\x03E\x00\x00\x1f\xae" + // 0x1F6E0345: 0x00001FAE + "\x1fo\x03E\x00\x00\x1f\xaf" + // 0x1F6F0345: 0x00001FAF + "\x03\xb1\x03\x06\x00\x00\x1f\xb0" + // 0x03B10306: 0x00001FB0 + "\x03\xb1\x03\x04\x00\x00\x1f\xb1" + // 0x03B10304: 0x00001FB1 + "\x1fp\x03E\x00\x00\x1f\xb2" + // 0x1F700345: 0x00001FB2 + "\x03\xb1\x03E\x00\x00\x1f\xb3" + // 0x03B10345: 0x00001FB3 + "\x03\xac\x03E\x00\x00\x1f\xb4" + // 0x03AC0345: 0x00001FB4 + "\x03\xb1\x03B\x00\x00\x1f\xb6" + // 0x03B10342: 0x00001FB6 + "\x1f\xb6\x03E\x00\x00\x1f\xb7" + // 0x1FB60345: 0x00001FB7 + "\x03\x91\x03\x06\x00\x00\x1f\xb8" + // 0x03910306: 0x00001FB8 + "\x03\x91\x03\x04\x00\x00\x1f\xb9" + // 0x03910304: 0x00001FB9 + "\x03\x91\x03\x00\x00\x00\x1f\xba" + // 0x03910300: 0x00001FBA + "\x03\x91\x03E\x00\x00\x1f\xbc" + // 0x03910345: 0x00001FBC + "\x00\xa8\x03B\x00\x00\x1f\xc1" + // 0x00A80342: 0x00001FC1 + "\x1ft\x03E\x00\x00\x1f\xc2" + // 0x1F740345: 0x00001FC2 + "\x03\xb7\x03E\x00\x00\x1f\xc3" + // 0x03B70345: 0x00001FC3 + "\x03\xae\x03E\x00\x00\x1f\xc4" + // 0x03AE0345: 0x00001FC4 + "\x03\xb7\x03B\x00\x00\x1f\xc6" + // 0x03B70342: 0x00001FC6 + "\x1f\xc6\x03E\x00\x00\x1f\xc7" + // 0x1FC60345: 0x00001FC7 + "\x03\x95\x03\x00\x00\x00\x1f\xc8" + // 0x03950300: 0x00001FC8 + "\x03\x97\x03\x00\x00\x00\x1f\xca" + // 0x03970300: 0x00001FCA + "\x03\x97\x03E\x00\x00\x1f\xcc" + // 0x03970345: 0x00001FCC + "\x1f\xbf\x03\x00\x00\x00\x1f\xcd" + // 0x1FBF0300: 0x00001FCD + "\x1f\xbf\x03\x01\x00\x00\x1f\xce" + // 0x1FBF0301: 0x00001FCE + "\x1f\xbf\x03B\x00\x00\x1f\xcf" + // 0x1FBF0342: 0x00001FCF + "\x03\xb9\x03\x06\x00\x00\x1f\xd0" + // 0x03B90306: 0x00001FD0 + "\x03\xb9\x03\x04\x00\x00\x1f\xd1" + // 0x03B90304: 0x00001FD1 + "\x03\xca\x03\x00\x00\x00\x1f\xd2" + // 0x03CA0300: 0x00001FD2 + "\x03\xb9\x03B\x00\x00\x1f\xd6" + // 0x03B90342: 0x00001FD6 + "\x03\xca\x03B\x00\x00\x1f\xd7" + // 0x03CA0342: 0x00001FD7 + "\x03\x99\x03\x06\x00\x00\x1f\xd8" + // 0x03990306: 0x00001FD8 + "\x03\x99\x03\x04\x00\x00\x1f\xd9" + // 0x03990304: 0x00001FD9 + "\x03\x99\x03\x00\x00\x00\x1f\xda" + // 0x03990300: 0x00001FDA + "\x1f\xfe\x03\x00\x00\x00\x1f\xdd" + // 0x1FFE0300: 0x00001FDD + "\x1f\xfe\x03\x01\x00\x00\x1f\xde" + // 0x1FFE0301: 0x00001FDE + "\x1f\xfe\x03B\x00\x00\x1f\xdf" + // 0x1FFE0342: 0x00001FDF + "\x03\xc5\x03\x06\x00\x00\x1f\xe0" + // 0x03C50306: 0x00001FE0 + "\x03\xc5\x03\x04\x00\x00\x1f\xe1" + // 0x03C50304: 0x00001FE1 + "\x03\xcb\x03\x00\x00\x00\x1f\xe2" + // 0x03CB0300: 0x00001FE2 + "\x03\xc1\x03\x13\x00\x00\x1f\xe4" + // 0x03C10313: 0x00001FE4 + "\x03\xc1\x03\x14\x00\x00\x1f\xe5" + // 0x03C10314: 0x00001FE5 + "\x03\xc5\x03B\x00\x00\x1f\xe6" + // 0x03C50342: 0x00001FE6 + "\x03\xcb\x03B\x00\x00\x1f\xe7" + // 0x03CB0342: 0x00001FE7 + "\x03\xa5\x03\x06\x00\x00\x1f\xe8" + // 0x03A50306: 0x00001FE8 + "\x03\xa5\x03\x04\x00\x00\x1f\xe9" + // 0x03A50304: 0x00001FE9 + "\x03\xa5\x03\x00\x00\x00\x1f\xea" + // 0x03A50300: 0x00001FEA + "\x03\xa1\x03\x14\x00\x00\x1f\xec" + // 0x03A10314: 0x00001FEC + "\x00\xa8\x03\x00\x00\x00\x1f\xed" + // 0x00A80300: 0x00001FED + "\x1f|\x03E\x00\x00\x1f\xf2" + // 0x1F7C0345: 0x00001FF2 + "\x03\xc9\x03E\x00\x00\x1f\xf3" + // 0x03C90345: 0x00001FF3 + "\x03\xce\x03E\x00\x00\x1f\xf4" + // 0x03CE0345: 0x00001FF4 + "\x03\xc9\x03B\x00\x00\x1f\xf6" + // 0x03C90342: 0x00001FF6 + "\x1f\xf6\x03E\x00\x00\x1f\xf7" + // 0x1FF60345: 0x00001FF7 + "\x03\x9f\x03\x00\x00\x00\x1f\xf8" + // 0x039F0300: 0x00001FF8 + "\x03\xa9\x03\x00\x00\x00\x1f\xfa" + // 0x03A90300: 0x00001FFA + "\x03\xa9\x03E\x00\x00\x1f\xfc" + // 0x03A90345: 0x00001FFC + "!\x90\x038\x00\x00!\x9a" + // 0x21900338: 0x0000219A + "!\x92\x038\x00\x00!\x9b" + // 0x21920338: 0x0000219B + "!\x94\x038\x00\x00!\xae" + // 0x21940338: 0x000021AE + "!\xd0\x038\x00\x00!\xcd" + // 0x21D00338: 0x000021CD + "!\xd4\x038\x00\x00!\xce" + // 0x21D40338: 0x000021CE + "!\xd2\x038\x00\x00!\xcf" + // 0x21D20338: 0x000021CF + "\"\x03\x038\x00\x00\"\x04" + // 0x22030338: 0x00002204 + "\"\b\x038\x00\x00\"\t" + // 0x22080338: 0x00002209 + "\"\v\x038\x00\x00\"\f" + // 0x220B0338: 0x0000220C + "\"#\x038\x00\x00\"$" + // 0x22230338: 0x00002224 + "\"%\x038\x00\x00\"&" + // 0x22250338: 0x00002226 + "\"<\x038\x00\x00\"A" + // 0x223C0338: 0x00002241 + "\"C\x038\x00\x00\"D" + // 0x22430338: 0x00002244 + "\"E\x038\x00\x00\"G" + // 0x22450338: 0x00002247 + "\"H\x038\x00\x00\"I" + // 0x22480338: 0x00002249 + "\x00=\x038\x00\x00\"`" + // 0x003D0338: 0x00002260 + "\"a\x038\x00\x00\"b" + // 0x22610338: 0x00002262 + "\"M\x038\x00\x00\"m" + // 0x224D0338: 0x0000226D + "\x00<\x038\x00\x00\"n" + // 0x003C0338: 0x0000226E + "\x00>\x038\x00\x00\"o" + // 0x003E0338: 0x0000226F + "\"d\x038\x00\x00\"p" + // 0x22640338: 0x00002270 + "\"e\x038\x00\x00\"q" + // 0x22650338: 0x00002271 + "\"r\x038\x00\x00\"t" + // 0x22720338: 0x00002274 + "\"s\x038\x00\x00\"u" + // 0x22730338: 0x00002275 + "\"v\x038\x00\x00\"x" + // 0x22760338: 0x00002278 + "\"w\x038\x00\x00\"y" + // 0x22770338: 0x00002279 + "\"z\x038\x00\x00\"\x80" + // 0x227A0338: 0x00002280 + "\"{\x038\x00\x00\"\x81" + // 0x227B0338: 0x00002281 + "\"\x82\x038\x00\x00\"\x84" + // 0x22820338: 0x00002284 + "\"\x83\x038\x00\x00\"\x85" + // 0x22830338: 0x00002285 + "\"\x86\x038\x00\x00\"\x88" + // 0x22860338: 0x00002288 + "\"\x87\x038\x00\x00\"\x89" + // 0x22870338: 0x00002289 + "\"\xa2\x038\x00\x00\"\xac" + // 0x22A20338: 0x000022AC + "\"\xa8\x038\x00\x00\"\xad" + // 0x22A80338: 0x000022AD + "\"\xa9\x038\x00\x00\"\xae" + // 0x22A90338: 0x000022AE + "\"\xab\x038\x00\x00\"\xaf" + // 0x22AB0338: 0x000022AF + "\"|\x038\x00\x00\"\xe0" + // 0x227C0338: 0x000022E0 + "\"}\x038\x00\x00\"\xe1" + // 0x227D0338: 0x000022E1 + "\"\x91\x038\x00\x00\"\xe2" + // 0x22910338: 0x000022E2 + "\"\x92\x038\x00\x00\"\xe3" + // 0x22920338: 0x000022E3 + "\"\xb2\x038\x00\x00\"\xea" + // 0x22B20338: 0x000022EA + "\"\xb3\x038\x00\x00\"\xeb" + // 0x22B30338: 0x000022EB + "\"\xb4\x038\x00\x00\"\xec" + // 0x22B40338: 0x000022EC + "\"\xb5\x038\x00\x00\"\xed" + // 0x22B50338: 0x000022ED + "0K0\x99\x00\x000L" + // 0x304B3099: 0x0000304C + "0M0\x99\x00\x000N" + // 0x304D3099: 0x0000304E + "0O0\x99\x00\x000P" + // 0x304F3099: 0x00003050 + "0Q0\x99\x00\x000R" + // 0x30513099: 0x00003052 + "0S0\x99\x00\x000T" + // 0x30533099: 0x00003054 + "0U0\x99\x00\x000V" + // 0x30553099: 0x00003056 + "0W0\x99\x00\x000X" + // 0x30573099: 0x00003058 + "0Y0\x99\x00\x000Z" + // 0x30593099: 0x0000305A + "0[0\x99\x00\x000\\" + // 0x305B3099: 0x0000305C + "0]0\x99\x00\x000^" + // 0x305D3099: 0x0000305E + "0_0\x99\x00\x000`" + // 0x305F3099: 0x00003060 + "0a0\x99\x00\x000b" + // 0x30613099: 0x00003062 + "0d0\x99\x00\x000e" + // 0x30643099: 0x00003065 + "0f0\x99\x00\x000g" + // 0x30663099: 0x00003067 + "0h0\x99\x00\x000i" + // 0x30683099: 0x00003069 + "0o0\x99\x00\x000p" + // 0x306F3099: 0x00003070 + "0o0\x9a\x00\x000q" + // 0x306F309A: 0x00003071 + "0r0\x99\x00\x000s" + // 0x30723099: 0x00003073 + "0r0\x9a\x00\x000t" + // 0x3072309A: 0x00003074 + "0u0\x99\x00\x000v" + // 0x30753099: 0x00003076 + "0u0\x9a\x00\x000w" + // 0x3075309A: 0x00003077 + "0x0\x99\x00\x000y" + // 0x30783099: 0x00003079 + "0x0\x9a\x00\x000z" + // 0x3078309A: 0x0000307A + "0{0\x99\x00\x000|" + // 0x307B3099: 0x0000307C + "0{0\x9a\x00\x000}" + // 0x307B309A: 0x0000307D + "0F0\x99\x00\x000\x94" + // 0x30463099: 0x00003094 + "0\x9d0\x99\x00\x000\x9e" + // 0x309D3099: 0x0000309E + "0\xab0\x99\x00\x000\xac" + // 0x30AB3099: 0x000030AC + "0\xad0\x99\x00\x000\xae" + // 0x30AD3099: 0x000030AE + "0\xaf0\x99\x00\x000\xb0" + // 0x30AF3099: 0x000030B0 + "0\xb10\x99\x00\x000\xb2" + // 0x30B13099: 0x000030B2 + "0\xb30\x99\x00\x000\xb4" + // 0x30B33099: 0x000030B4 + "0\xb50\x99\x00\x000\xb6" + // 0x30B53099: 0x000030B6 + "0\xb70\x99\x00\x000\xb8" + // 0x30B73099: 0x000030B8 + "0\xb90\x99\x00\x000\xba" + // 0x30B93099: 0x000030BA + "0\xbb0\x99\x00\x000\xbc" + // 0x30BB3099: 0x000030BC + "0\xbd0\x99\x00\x000\xbe" + // 0x30BD3099: 0x000030BE + "0\xbf0\x99\x00\x000\xc0" + // 0x30BF3099: 0x000030C0 + "0\xc10\x99\x00\x000\xc2" + // 0x30C13099: 0x000030C2 + "0\xc40\x99\x00\x000\xc5" + // 0x30C43099: 0x000030C5 + "0\xc60\x99\x00\x000\xc7" + // 0x30C63099: 0x000030C7 + "0\xc80\x99\x00\x000\xc9" + // 0x30C83099: 0x000030C9 + "0\xcf0\x99\x00\x000\xd0" + // 0x30CF3099: 0x000030D0 + "0\xcf0\x9a\x00\x000\xd1" + // 0x30CF309A: 0x000030D1 + "0\xd20\x99\x00\x000\xd3" + // 0x30D23099: 0x000030D3 + "0\xd20\x9a\x00\x000\xd4" + // 0x30D2309A: 0x000030D4 + "0\xd50\x99\x00\x000\xd6" + // 0x30D53099: 0x000030D6 + "0\xd50\x9a\x00\x000\xd7" + // 0x30D5309A: 0x000030D7 + "0\xd80\x99\x00\x000\xd9" + // 0x30D83099: 0x000030D9 + "0\xd80\x9a\x00\x000\xda" + // 0x30D8309A: 0x000030DA + "0\xdb0\x99\x00\x000\xdc" + // 0x30DB3099: 0x000030DC + "0\xdb0\x9a\x00\x000\xdd" + // 0x30DB309A: 0x000030DD + "0\xa60\x99\x00\x000\xf4" + // 0x30A63099: 0x000030F4 + "0\xef0\x99\x00\x000\xf7" + // 0x30EF3099: 0x000030F7 + "0\xf00\x99\x00\x000\xf8" + // 0x30F03099: 0x000030F8 + "0\xf10\x99\x00\x000\xf9" + // 0x30F13099: 0x000030F9 + "0\xf20\x99\x00\x000\xfa" + // 0x30F23099: 0x000030FA + "0\xfd0\x99\x00\x000\xfe" + // 0x30FD3099: 0x000030FE + "\x10\x99\x10\xba\x00\x01\x10\x9a" + // 0x109910BA: 0x0001109A + "\x10\x9b\x10\xba\x00\x01\x10\x9c" + // 0x109B10BA: 0x0001109C + "\x10\xa5\x10\xba\x00\x01\x10\xab" + // 0x10A510BA: 0x000110AB + "\x111\x11'\x00\x01\x11." + // 0x11311127: 0x0001112E + "\x112\x11'\x00\x01\x11/" + // 0x11321127: 0x0001112F + "\x13G\x13>\x00\x01\x13K" + // 0x1347133E: 0x0001134B + "\x13G\x13W\x00\x01\x13L" + // 0x13471357: 0x0001134C + "\x14\xb9\x14\xba\x00\x01\x14\xbb" + // 0x14B914BA: 0x000114BB + "\x14\xb9\x14\xb0\x00\x01\x14\xbc" + // 0x14B914B0: 0x000114BC + "\x14\xb9\x14\xbd\x00\x01\x14\xbe" + // 0x14B914BD: 0x000114BE + "\x15\xb8\x15\xaf\x00\x01\x15\xba" + // 0x15B815AF: 0x000115BA + "\x15\xb9\x15\xaf\x00\x01\x15\xbb" + // 0x15B915AF: 0x000115BB + "" + // Total size of tables: 53KB (54006 bytes) diff --git a/vendor/golang.org/x/text/unicode/norm/transform.go b/vendor/golang.org/x/text/unicode/norm/transform.go index 9f47efbaf6..a1d366ae48 100644 --- a/vendor/golang.org/x/text/unicode/norm/transform.go +++ b/vendor/golang.org/x/text/unicode/norm/transform.go @@ -18,7 +18,6 @@ func (Form) Reset() {} // Users should either catch ErrShortDst and allow dst to grow or have dst be at // least of size MaxTransformChunkSize to be guaranteed of progress. func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - n := 0 // Cap the maximum number of src bytes to check. b := src eof := atEOF @@ -27,13 +26,14 @@ func (f Form) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) eof = false b = b[:ns] } - i, ok := formTable[f].quickSpan(inputBytes(b), n, len(b), eof) - n += copy(dst[n:], b[n:i]) + i, ok := formTable[f].quickSpan(inputBytes(b), 0, len(b), eof) + n := copy(dst, b[:i]) if !ok { nDst, nSrc, err = f.transform(dst[n:], src[n:], atEOF) return nDst + n, nSrc + n, err } - if n < len(src) && !atEOF { + + if err == nil && n < len(src) && !atEOF { err = transform.ErrShortSrc } return n, n, err @@ -79,7 +79,7 @@ func (f Form) transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) nSrc += n nDst += n if ok { - if n < rb.nsrc && !atEOF { + if err == nil && n < rb.nsrc && !atEOF { err = transform.ErrShortSrc } return nDst, nSrc, err |